diff --git a/cmd/cloudflared/access/cmd.go b/cmd/cloudflared/access/cmd.go index c0088ff6..6fec29f9 100644 --- a/cmd/cloudflared/access/cmd.go +++ b/cmd/cloudflared/access/cmd.go @@ -11,7 +11,7 @@ import ( "text/template" "time" - "github.com/getsentry/raven-go" + "github.com/getsentry/sentry-go" "github.com/pkg/errors" "github.com/rs/zerolog" "github.com/urfave/cli/v2" @@ -202,7 +202,11 @@ func Commands() []*cli.Command { // login pops up the browser window to do the actual login and JWT generation func login(c *cli.Context) error { - if err := raven.SetDSN(sentryDSN); err != nil { + err := sentry.Init(sentry.ClientOptions{ + Dsn: sentryDSN, + Release: c.App.Version, + }) + if err != nil { return err } @@ -251,7 +255,11 @@ func ensureURLScheme(url string) string { // curl provides a wrapper around curl, passing Access JWT along in request func curl(c *cli.Context) error { - if err := raven.SetDSN(sentryDSN); err != nil { + err := sentry.Init(sentry.ClientOptions{ + Dsn: sentryDSN, + Release: c.App.Version, + }) + if err != nil { return err } log := logger.CreateLoggerFromContext(c, logger.EnableTerminalLog) @@ -314,7 +322,11 @@ func run(cmd string, args ...string) error { // token dumps provided token to stdout func generateToken(c *cli.Context) error { - if err := raven.SetDSN(sentryDSN); err != nil { + err := sentry.Init(sentry.ClientOptions{ + Dsn: sentryDSN, + Release: c.App.Version, + }) + if err != nil { return err } appURL, err := url.Parse(ensureURLScheme(c.String("app"))) diff --git a/cmd/cloudflared/main.go b/cmd/cloudflared/main.go index 1ac06c3e..535ea18f 100644 --- a/cmd/cloudflared/main.go +++ b/cmd/cloudflared/main.go @@ -6,7 +6,7 @@ import ( "strings" "time" - "github.com/getsentry/raven-go" + "github.com/getsentry/sentry-go" homedir "github.com/mitchellh/go-homedir" "github.com/pkg/errors" "github.com/urfave/cli/v2" @@ -50,7 +50,6 @@ var ( func main() { rand.Seed(time.Now().UnixNano()) metrics.RegisterBuildInfo(BuildType, BuildTime, Version) - raven.SetRelease(Version) maxprocs.Set() bInfo := cliutil.GetBuildInfo(BuildType, Version) @@ -158,8 +157,10 @@ func action(graceShutdownC chan struct{}) cli.ActionFunc { } tags := make(map[string]string) tags["hostname"] = c.String("hostname") - raven.SetTagsContext(tags) - raven.CapturePanic(func() { err = tunnel.TunnelCommand(c) }, nil) + func() { + defer sentry.Recover() + err = tunnel.TunnelCommand(c) + }() if err != nil { captureError(err) } @@ -187,7 +188,7 @@ func captureError(err error) { return } } - raven.CaptureError(err, nil) + sentry.CaptureException(err) } // cloudflared was started without any flags diff --git a/cmd/cloudflared/tunnel/cmd.go b/cmd/cloudflared/tunnel/cmd.go index e691f93f..95cd98f9 100644 --- a/cmd/cloudflared/tunnel/cmd.go +++ b/cmd/cloudflared/tunnel/cmd.go @@ -14,7 +14,7 @@ import ( "github.com/coreos/go-systemd/daemon" "github.com/facebookgo/grace/gracenet" - "github.com/getsentry/raven-go" + "github.com/getsentry/sentry-go" "github.com/google/uuid" homedir "github.com/mitchellh/go-homedir" "github.com/pkg/errors" @@ -258,7 +258,13 @@ func StartServer( namedTunnel *connection.NamedTunnelProperties, log *zerolog.Logger, ) error { - _ = raven.SetDSN(sentryDSN) + err := sentry.Init(sentry.ClientOptions{ + Dsn: sentryDSN, + Release: c.App.Version, + }) + if err != nil { + return err + } var wg sync.WaitGroup listeners := gracenet.Net{} errC := make(chan error) diff --git a/go.mod b/go.mod index 3609f872..7ec14d71 100644 --- a/go.mod +++ b/go.mod @@ -10,7 +10,8 @@ require ( github.com/coreos/go-systemd v0.0.0-20191104093116-d3cd4ed1dbcf github.com/facebookgo/grace v0.0.0-20180706040059-75cf19382434 github.com/fsnotify/fsnotify v1.4.9 - github.com/getsentry/raven-go v0.0.0-20180517221441-ed7bcb39ff10 + github.com/getsentry/raven-go v0.2.0 + github.com/getsentry/sentry-go v0.16.0 github.com/gobwas/ws v1.0.4 github.com/golang-collections/collections v0.0.0-20130729185459-604e922904d3 github.com/google/gopacket v1.1.19 @@ -18,7 +19,7 @@ require ( github.com/gorilla/websocket v1.4.2 github.com/json-iterator/go v1.1.12 github.com/lucas-clemente/quic-go v0.28.1 - github.com/mattn/go-colorable v0.1.8 + github.com/mattn/go-colorable v0.1.13 github.com/miekg/dns v1.1.45 github.com/mitchellh/go-homedir v1.1.0 github.com/pkg/errors v0.9.1 @@ -39,7 +40,7 @@ require ( golang.org/x/sync v0.1.0 golang.org/x/sys v0.3.0 golang.org/x/term v0.3.0 - google.golang.org/protobuf v1.28.0 + google.golang.org/protobuf v1.28.1 gopkg.in/coreos/go-oidc.v2 v2.2.1 gopkg.in/natefinch/lumberjack.v2 v2.0.0 gopkg.in/square/go-jose.v2 v2.6.0 @@ -48,10 +49,10 @@ require ( ) require ( - github.com/BurntSushi/toml v0.3.1 // indirect + github.com/BurntSushi/toml v1.2.0 // indirect github.com/apparentlymart/go-cidr v1.1.0 // indirect github.com/beorn7/perks v1.0.1 // indirect - github.com/certifi/gocertifi v0.0.0-20200211180108-c7c1fbc02894 // indirect + github.com/certifi/gocertifi v0.0.0-20210507211836-431795d63e8d // indirect github.com/cespare/xxhash/v2 v2.1.2 // indirect github.com/cheekybits/genny v1.0.0 // indirect github.com/cloudflare/circl v1.2.1-0.20220809205628-0a9554f37a47 // indirect @@ -76,7 +77,7 @@ require ( github.com/marten-seemann/qtls-go1-17 v0.1.2 // indirect github.com/marten-seemann/qtls-go1-18 v0.1.2 // indirect github.com/marten-seemann/qtls-go1-19 v0.1.0-beta.1 // indirect - github.com/mattn/go-isatty v0.0.12 // indirect + github.com/mattn/go-isatty v0.0.16 // indirect github.com/matttproud/golang_protobuf_extensions v1.0.1 // indirect github.com/modern-go/concurrent v0.0.0-20180306012644-bacd9c7ef1dd // indirect github.com/modern-go/reflect2 v1.0.2 // indirect diff --git a/go.sum b/go.sum index 73758118..7a4dbfa7 100644 --- a/go.sum +++ b/go.sum @@ -77,8 +77,9 @@ github.com/Azure/go-autorest/autorest/mocks v0.4.1/go.mod h1:LTp+uSrOhSkaKrUy935 github.com/Azure/go-autorest/autorest/to v0.2.0/go.mod h1:GunWKJp1AEqgMaGLV+iocmRAJWqST1wQYhyyjXJ3SJc= github.com/Azure/go-autorest/logger v0.2.1/go.mod h1:T9E3cAhj2VqvPOtCYAvby9aBXkZmbF5NWuPV8+WeEW8= github.com/Azure/go-autorest/tracing v0.6.0/go.mod h1:+vhtPC754Xsa23ID7GlGsrdKBpUA79WCAKPPZVC2DeU= -github.com/BurntSushi/toml v0.3.1 h1:WXkYYl6Yr3qBf1K79EBnL4mak0OimBfB0XUf9Vl28OQ= github.com/BurntSushi/toml v0.3.1/go.mod h1:xHWCNGjB5oqiDr8zfno3MHue2Ht5sIBksp03qcyfWMU= +github.com/BurntSushi/toml v1.2.0 h1:Rt8g24XnyGTyglgET/PRUNlrUeu9F5L+7FilkXfZgs0= +github.com/BurntSushi/toml v1.2.0/go.mod h1:CxXYINrC8qIiEnFrOxCa7Jy5BFHlXnUU2pbicEuybxQ= github.com/BurntSushi/xgb v0.0.0-20160522181843-27f122750802/go.mod h1:IVnqGOEym/WlBOVXweHU+Q+/VP0lqqI8lqeDx9IjBqo= github.com/DataDog/datadog-go v4.4.0+incompatible/go.mod h1:LButxg5PwREeZtORoXG3tL4fMGNddJ+vMq1mwgfaqoQ= github.com/DataDog/gostackparse v0.5.0/go.mod h1:lTfqcJKqS9KnXQGnyQMCugq3u1FP6UZMfWR0aitKFMM= @@ -112,8 +113,8 @@ github.com/buger/jsonparser v0.0.0-20181115193947-bf1c66bbce23/go.mod h1:bbYlZJ7 github.com/bwesterb/go-ristretto v1.2.2/go.mod h1:fUIoIZaG73pV5biE2Blr2xEzDoMj7NFEuV9ekS419A0= github.com/cenkalti/backoff/v4 v4.1.2/go.mod h1:scbssz8iZGpm3xbr14ovlUdkxfGXNInqkPWOWmG2CLw= github.com/census-instrumentation/opencensus-proto v0.2.1/go.mod h1:f6KPmirojxKA12rnyqOA5BBL4O983OfeGPqjHWSTneU= -github.com/certifi/gocertifi v0.0.0-20200211180108-c7c1fbc02894 h1:JLaf/iINcLyjwbtTsCJjc6rtlASgHeIJPrB6QmwURnA= -github.com/certifi/gocertifi v0.0.0-20200211180108-c7c1fbc02894/go.mod h1:sGbDF6GwGcLpkNXPUTkMRoywsNa/ol15pxFe6ERfguA= +github.com/certifi/gocertifi v0.0.0-20210507211836-431795d63e8d h1:S2NE3iHSwP0XV47EEXL8mWmRdEfGscSJ+7EgePNgt0s= +github.com/certifi/gocertifi v0.0.0-20210507211836-431795d63e8d/go.mod h1:sGbDF6GwGcLpkNXPUTkMRoywsNa/ol15pxFe6ERfguA= github.com/cespare/xxhash v1.1.0/go.mod h1:XrSqR1VqqWfGrhpAt58auRo0WTKS1nRRg3ghfAqPWnc= github.com/cespare/xxhash/v2 v2.1.1/go.mod h1:VGX0DQ3Q6kWi7AoAeZDth3/j3BFtOZR5XLFGgcrjCOs= github.com/cespare/xxhash/v2 v2.1.2 h1:YRXhKfTDauu4ajMg1TPgFO5jnlC2HCbmLXMcTG5cbYE= @@ -209,11 +210,14 @@ github.com/fsnotify/fsnotify v1.4.7/go.mod h1:jwhsz4b93w/PPRr/qN1Yymfu8t87LnFCMo github.com/fsnotify/fsnotify v1.4.9 h1:hsms1Qyu0jgnwNXIxa+/V/PDsU6CfLf6CNO8H7IWoS4= github.com/fsnotify/fsnotify v1.4.9/go.mod h1:znqG4EE+3YCdAaPaxE2ZRY/06pZUdp0tY4IgpuI1SZQ= github.com/getkin/kin-openapi v0.76.0/go.mod h1:660oXbgy5JFMKreazJaQTw7o+X00qeSyhcnluiMv+Xg= -github.com/getsentry/raven-go v0.0.0-20180517221441-ed7bcb39ff10 h1:YO10pIIBftO/kkTFdWhctH96grJ7qiy7bMdiZcIvPKs= -github.com/getsentry/raven-go v0.0.0-20180517221441-ed7bcb39ff10/go.mod h1:KungGk8q33+aIAZUIVWZDr2OfAEBsO49PX4NzFV5kcQ= +github.com/getsentry/raven-go v0.2.0 h1:no+xWJRb5ZI7eE8TWgIq1jLulQiIoLG0IfYxv5JYMGs= +github.com/getsentry/raven-go v0.2.0/go.mod h1:KungGk8q33+aIAZUIVWZDr2OfAEBsO49PX4NzFV5kcQ= +github.com/getsentry/sentry-go v0.16.0 h1:owk+S+5XcgJLlGR/3+3s6N4d+uKwqYvh/eS0AIMjPWo= +github.com/getsentry/sentry-go v0.16.0/go.mod h1:ZXCloQLj0pG7mja5NK6NPf2V4A88YJ4pNlc2mOHwh6Y= github.com/ghodss/yaml v1.0.0/go.mod h1:4dBDuWmgqj2HViK6kFavaiC9ZROes6MMH2rRYeMEF04= github.com/gliderlabs/ssh v0.1.1/go.mod h1:U7qILu1NlMHj9FlMhZLlkCdDnU1DBEAqr0aevW3Awn0= github.com/go-errors/errors v1.0.1/go.mod h1:f4zRHt4oKfwPJE5k8C9vpYG+aDHdBFUsgrm6/TyX73Q= +github.com/go-errors/errors v1.4.2 h1:J6MZopCL4uSllY1OfXM374weqZFFItUbrImctkmUxIA= github.com/go-gl/glfw v0.0.0-20190409004039-e6da0acd62b1/go.mod h1:vR7hzQXu2zJy9AVAgeJqvqgH9Q5CA+iKCZ2gyEVpxRU= github.com/go-gl/glfw/v3.3/glfw v0.0.0-20191125211704-12ad95a8df72/go.mod h1:tQ2UAYgL5IevRw8kRxooKSPJfGvJ9fJQFa0TUsXzTg8= github.com/go-gl/glfw/v3.3/glfw v0.0.0-20200222043503-6f7a984d4dc4/go.mod h1:tQ2UAYgL5IevRw8kRxooKSPJfGvJ9fJQFa0TUsXzTg8= @@ -307,8 +311,8 @@ github.com/google/go-cmp v0.5.4/go.mod h1:v8dTdLbMG2kIc/vJvl+f65V22dbkXbowE6jgT/ github.com/google/go-cmp v0.5.5/go.mod h1:v8dTdLbMG2kIc/vJvl+f65V22dbkXbowE6jgT/gNBxE= github.com/google/go-cmp v0.5.6/go.mod h1:v8dTdLbMG2kIc/vJvl+f65V22dbkXbowE6jgT/gNBxE= github.com/google/go-cmp v0.5.7/go.mod h1:n+brtR0CgQNWTVd5ZUFpTBC8YFBDLK/h/bpaJ8/DtOE= -github.com/google/go-cmp v0.5.8 h1:e6P7q2lk1O+qJJb4BtCQXlK8vWEO8V1ZeuEdJNOqZyg= github.com/google/go-cmp v0.5.8/go.mod h1:17dUlkBOakJ0+DkrSSNjCkIjxS6bF9zb3elmeNGIjoY= +github.com/google/go-cmp v0.5.9 h1:O2Tfq5qg4qc4AmwVlvv0oLiVAGB7enBSJ2x2DqQFi38= github.com/google/go-github v17.0.0+incompatible/go.mod h1:zLgOLi98H3fifZn+44m+umXrS52loVEgC2AApnigrVQ= github.com/google/go-querystring v1.0.0/go.mod h1:odCYkC5MyYFN7vkCjXpyrEuKhc/BUO6wN/zVPAxq5ck= github.com/google/gofuzz v1.0.0/go.mod h1:dBl0BpW6vV/+mYPU4Po3pmUjxk6FQPldtuIdl/M65Eg= @@ -427,10 +431,10 @@ github.com/marten-seemann/qtls-go1-16 v0.1.5 h1:o9JrYPPco/Nukd/HpOHMHZoBDXQqoNtU github.com/marten-seemann/qtls-go1-16 v0.1.5/go.mod h1:gNpI2Ol+lRS3WwSOtIUUtRwZEQMXjYK+dQSBFbethAk= github.com/marten-seemann/qtls-go1-17 v0.1.2 h1:JADBlm0LYiVbuSySCHeY863dNkcpMmDR7s0bLKJeYlQ= github.com/marten-seemann/qtls-go1-17 v0.1.2/go.mod h1:C2ekUKcDdz9SDWxec1N/MvcXBpaX9l3Nx67XaR84L5s= -github.com/mattn/go-colorable v0.1.8 h1:c1ghPdyEDarC70ftn0y+A/Ee++9zz8ljHG1b13eJ0s8= -github.com/mattn/go-colorable v0.1.8/go.mod h1:u6P/XSegPjTcexA+o6vUJrdnUu04hMope9wVRipJSqc= -github.com/mattn/go-isatty v0.0.12 h1:wuysRhFDzyxgEmMf5xjvJ2M9dZoWAXNNr5LSBS7uHXY= -github.com/mattn/go-isatty v0.0.12/go.mod h1:cbi8OIDigv2wuxKPP5vlRcQ1OAZbq2CE4Kysco4FUpU= +github.com/mattn/go-colorable v0.1.13 h1:fFA4WZxdEF4tXPZVKMLwD8oUnCTTo08duU7wxecdEvA= +github.com/mattn/go-colorable v0.1.13/go.mod h1:7S9/ev0klgBDR4GtXTXX8a3vIGJpMovkB8vQcUbaXHg= +github.com/mattn/go-isatty v0.0.16 h1:bq3VjFmv/sOjHtdEhmkEV4x1AJtvUvOJ2PFAZ5+peKQ= +github.com/mattn/go-isatty v0.0.16/go.mod h1:kYGgaQfpe5nmfYZH+SKPsOc2e4SrIfOl2e/yFXSvRLM= github.com/matttproud/golang_protobuf_extensions v1.0.1 h1:4hp9jkHxhMHkqkrB3Ix0jegS5sx/RkqARlsWZ6pIwiU= github.com/matttproud/golang_protobuf_extensions v1.0.1/go.mod h1:D8He9yQNgCq6Z5Ld7szi9bcBfOoFv/3dc6xSMkL2PC0= github.com/microcosm-cc/bluemonday v1.0.1/go.mod h1:hsXNsILzKxV+sX77C5b8FSuKF00vh2OMYv+xgHpAMF4= @@ -489,6 +493,7 @@ github.com/philhofer/fwd v1.1.1 h1:GdGcTjf5RNAxwS4QLsiMzJYj5KEvPJD3Abr261yRQXQ= github.com/philhofer/fwd v1.1.1/go.mod h1:gk3iGcWd9+svBvR0sR+KPcfE+RNWozjowpeBVG3ZVNU= github.com/pierrec/lz4 v1.0.2-0.20190131084431-473cd7ce01a1/go.mod h1:3/3N9NVKO0jef7pBehbT1qWhCMrIgbYNnFAZCqQ5LRc= github.com/pierrec/lz4 v2.6.1+incompatible/go.mod h1:pdkljMzZIN41W+lC3N2tnIh5sFi+IEE17M5jbnwPHcY= +github.com/pingcap/errors v0.11.4 h1:lFuQV/oaUMGcD2tqt+01ROSmJs75VG1ToEOkZIZ4nE4= github.com/pkg/errors v0.8.0/go.mod h1:bwawxfHBFNV+L2hUp1rHADufV3IMtnDRdf1r5NINEl0= github.com/pkg/errors v0.8.1/go.mod h1:bwawxfHBFNV+L2hUp1rHADufV3IMtnDRdf1r5NINEl0= github.com/pkg/errors v0.9.1 h1:FEBLx1zS214owpjy7qsBeixbURkuhQAwrK5UwLGTwt4= @@ -810,7 +815,6 @@ golang.org/x/sys v0.0.0-20191224085550-c709ea063b76/go.mod h1:h1NjWce9XRLGQEsW7w golang.org/x/sys v0.0.0-20191228213918-04cbcbbfeed8/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs= golang.org/x/sys v0.0.0-20200106162015-b016eb3dc98e/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs= golang.org/x/sys v0.0.0-20200113162924-86b910548bc1/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs= -golang.org/x/sys v0.0.0-20200116001909-b77594299b42/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs= golang.org/x/sys v0.0.0-20200122134326-e047566fdf82/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs= golang.org/x/sys v0.0.0-20200202164722-d101bd2416d5/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs= golang.org/x/sys v0.0.0-20200212091648-12a6c2dcc1e4/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs= @@ -868,6 +872,7 @@ golang.org/x/sys v0.0.0-20220520151302-bc2c85ada10a/go.mod h1:oPkhp1MJrh7nUepCBc golang.org/x/sys v0.0.0-20220610221304-9f5ed59c137d/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.0.0-20220728004956-3c1f35247d10/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.0.0-20220808155132-1c4a2a72c664/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= +golang.org/x/sys v0.0.0-20220811171246-fbc7d0a398ab/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.3.0 h1:w8ZOecv6NaNa/zC8944JTU3vz4u6Lagfk4RPQxv92NQ= golang.org/x/sys v0.3.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/term v0.0.0-20201126162022-7de9c90e9dd1/go.mod h1:bj7SfCRtBDWHUb9snDiAeCFNEtKQo2Wmx5Cou7ajbmo= @@ -1152,8 +1157,9 @@ google.golang.org/protobuf v1.25.0/go.mod h1:9JNX74DMeImyA3h4bdi1ymwjUzf21/xIlba google.golang.org/protobuf v1.26.0-rc.1/go.mod h1:jlhhOSvTdKEhbULTjvd4ARK9grFBp09yW+WbY/TyQbw= google.golang.org/protobuf v1.26.0/go.mod h1:9q0QmTI4eRPtz6boOQmLYwt+qCgq0jsYwAQnmE0givc= google.golang.org/protobuf v1.27.1/go.mod h1:9q0QmTI4eRPtz6boOQmLYwt+qCgq0jsYwAQnmE0givc= -google.golang.org/protobuf v1.28.0 h1:w43yiav+6bVFTBQFZX0r7ipe9JQ1QsbMgHwbBziscLw= google.golang.org/protobuf v1.28.0/go.mod h1:HV8QOd/L58Z+nl8r43ehVNZIU/HEI6OcFqwMG9pJV4I= +google.golang.org/protobuf v1.28.1 h1:d0NfwRgPtno5B1Wa6L2DAG+KivqkdutMf1UhdNx175w= +google.golang.org/protobuf v1.28.1/go.mod h1:HV8QOd/L58Z+nl8r43ehVNZIU/HEI6OcFqwMG9pJV4I= gopkg.in/DataDog/dd-trace-go.v1 v1.34.0/go.mod h1:HtrC65fyJ6lWazShCC9rlOeiTSZJ0XtZhkwjZM2WpC4= gopkg.in/alecthomas/kingpin.v2 v2.2.6/go.mod h1:FMv+mEhP44yOT+4EoQTLFTRgOQ1FBLkstjWtayDeSgw= gopkg.in/check.v1 v0.0.0-20161208181325-20d25e280405/go.mod h1:Co6ibVJAznAaIkqp8huTwlJQCZ016jof/cbN4VW5Yz0= diff --git a/tlsconfig/certreloader.go b/tlsconfig/certreloader.go index f2edce78..41e37c69 100644 --- a/tlsconfig/certreloader.go +++ b/tlsconfig/certreloader.go @@ -8,7 +8,7 @@ import ( "runtime" "sync" - "github.com/getsentry/raven-go" + "github.com/getsentry/sentry-go" "github.com/pkg/errors" "github.com/rs/zerolog" "github.com/urfave/cli/v2" @@ -65,7 +65,7 @@ func (cr *CertReloader) LoadCert() error { // Keep the old certificate if there's a problem reading the new one. if err != nil { - raven.CaptureError(fmt.Errorf("Error parsing X509 key pair: %v", err), nil) + sentry.CaptureException(fmt.Errorf("Error parsing X509 key pair: %v", err)) return err } cr.certificate = &cert diff --git a/vendor/github.com/BurntSushi/toml/.gitignore b/vendor/github.com/BurntSushi/toml/.gitignore index 0cd38003..fe79e3ad 100644 --- a/vendor/github.com/BurntSushi/toml/.gitignore +++ b/vendor/github.com/BurntSushi/toml/.gitignore @@ -1,5 +1,2 @@ -TAGS -tags -.*.swp -tomlcheck/tomlcheck -toml.test +/toml.test +/toml-test diff --git a/vendor/github.com/BurntSushi/toml/.travis.yml b/vendor/github.com/BurntSushi/toml/.travis.yml deleted file mode 100644 index 8b8afc4f..00000000 --- a/vendor/github.com/BurntSushi/toml/.travis.yml +++ /dev/null @@ -1,15 +0,0 @@ -language: go -go: - - 1.1 - - 1.2 - - 1.3 - - 1.4 - - 1.5 - - 1.6 - - tip -install: - - go install ./... - - go get github.com/BurntSushi/toml-test -script: - - export PATH="$PATH:$HOME/gopath/bin" - - make test diff --git a/vendor/github.com/BurntSushi/toml/COMPATIBLE b/vendor/github.com/BurntSushi/toml/COMPATIBLE deleted file mode 100644 index 6efcfd0c..00000000 --- a/vendor/github.com/BurntSushi/toml/COMPATIBLE +++ /dev/null @@ -1,3 +0,0 @@ -Compatible with TOML version -[v0.4.0](https://github.com/toml-lang/toml/blob/v0.4.0/versions/en/toml-v0.4.0.md) - diff --git a/vendor/github.com/BurntSushi/toml/Makefile b/vendor/github.com/BurntSushi/toml/Makefile deleted file mode 100644 index 3600848d..00000000 --- a/vendor/github.com/BurntSushi/toml/Makefile +++ /dev/null @@ -1,19 +0,0 @@ -install: - go install ./... - -test: install - go test -v - toml-test toml-test-decoder - toml-test -encoder toml-test-encoder - -fmt: - gofmt -w *.go */*.go - colcheck *.go */*.go - -tags: - find ./ -name '*.go' -print0 | xargs -0 gotags > TAGS - -push: - git push origin master - git push github master - diff --git a/vendor/github.com/BurntSushi/toml/README.md b/vendor/github.com/BurntSushi/toml/README.md index 7c1b37ec..3651cfa9 100644 --- a/vendor/github.com/BurntSushi/toml/README.md +++ b/vendor/github.com/BurntSushi/toml/README.md @@ -1,46 +1,26 @@ -## TOML parser and encoder for Go with reflection - TOML stands for Tom's Obvious, Minimal Language. This Go package provides a -reflection interface similar to Go's standard library `json` and `xml` -packages. This package also supports the `encoding.TextUnmarshaler` and -`encoding.TextMarshaler` interfaces so that you can define custom data -representations. (There is an example of this below.) +reflection interface similar to Go's standard library `json` and `xml` packages. -Spec: https://github.com/toml-lang/toml +Compatible with TOML version [v1.0.0](https://toml.io/en/v1.0.0). -Compatible with TOML version -[v0.4.0](https://github.com/toml-lang/toml/blob/master/versions/en/toml-v0.4.0.md) +Documentation: https://godocs.io/github.com/BurntSushi/toml -Documentation: https://godoc.org/github.com/BurntSushi/toml +See the [releases page](https://github.com/BurntSushi/toml/releases) for a +changelog; this information is also in the git tag annotations (e.g. `git show +v0.4.0`). -Installation: +This library requires Go 1.13 or newer; add it to your go.mod with: -```bash -go get github.com/BurntSushi/toml -``` + % go get github.com/BurntSushi/toml@latest -Try the toml validator: +It also comes with a TOML validator CLI tool: -```bash -go get github.com/BurntSushi/toml/cmd/tomlv -tomlv some-toml-file.toml -``` - -[![Build Status](https://travis-ci.org/BurntSushi/toml.svg?branch=master)](https://travis-ci.org/BurntSushi/toml) [![GoDoc](https://godoc.org/github.com/BurntSushi/toml?status.svg)](https://godoc.org/github.com/BurntSushi/toml) - -### Testing - -This package passes all tests in -[toml-test](https://github.com/BurntSushi/toml-test) for both the decoder -and the encoder. + % go install github.com/BurntSushi/toml/cmd/tomlv@latest + % tomlv some-toml-file.toml ### Examples - -This package works similarly to how the Go standard library handles `XML` -and `JSON`. Namely, data is loaded into Go values via reflection. - -For the simplest example, consider some TOML file as just a list of keys -and values: +For the simplest example, consider some TOML file as just a list of keys and +values: ```toml Age = 25 @@ -50,29 +30,23 @@ Perfection = [ 6, 28, 496, 8128 ] DOB = 1987-07-05T05:45:00Z ``` -Which could be defined in Go as: +Which can be decoded with: ```go type Config struct { - Age int - Cats []string - Pi float64 - Perfection []int - DOB time.Time // requires `import time` + Age int + Cats []string + Pi float64 + Perfection []int + DOB time.Time } -``` -And then decoded with: - -```go var conf Config -if _, err := toml.Decode(tomlData, &conf); err != nil { - // handle error -} +_, err := toml.Decode(tomlData, &conf) ``` -You can also use struct tags if your struct field name doesn't map to a TOML -key value directly: +You can also use struct tags if your struct field name doesn't map to a TOML key +value directly: ```toml some_key_NAME = "wat" @@ -80,139 +54,67 @@ some_key_NAME = "wat" ```go type TOML struct { - ObscureKey string `toml:"some_key_NAME"` + ObscureKey string `toml:"some_key_NAME"` } ``` -### Using the `encoding.TextUnmarshaler` interface +Beware that like other decoders **only exported fields** are considered when +encoding and decoding; private fields are silently ignored. -Here's an example that automatically parses duration strings into -`time.Duration` values: +### Using the `Marshaler` and `encoding.TextUnmarshaler` interfaces +Here's an example that automatically parses values in a `mail.Address`: ```toml -[[song]] -name = "Thunder Road" -duration = "4m49s" - -[[song]] -name = "Stairway to Heaven" -duration = "8m03s" -``` - -Which can be decoded with: - -```go -type song struct { - Name string - Duration duration -} -type songs struct { - Song []song -} -var favorites songs -if _, err := toml.Decode(blob, &favorites); err != nil { - log.Fatal(err) -} - -for _, s := range favorites.Song { - fmt.Printf("%s (%s)\n", s.Name, s.Duration) -} -``` - -And you'll also need a `duration` type that satisfies the -`encoding.TextUnmarshaler` interface: - -```go -type duration struct { - time.Duration -} - -func (d *duration) UnmarshalText(text []byte) error { - var err error - d.Duration, err = time.ParseDuration(string(text)) - return err -} -``` - -### More complex usage - -Here's an example of how to load the example from the official spec page: - -```toml -# This is a TOML document. Boom. - -title = "TOML Example" - -[owner] -name = "Tom Preston-Werner" -organization = "GitHub" -bio = "GitHub Cofounder & CEO\nLikes tater tots and beer." -dob = 1979-05-27T07:32:00Z # First class dates? Why not? - -[database] -server = "192.168.1.1" -ports = [ 8001, 8001, 8002 ] -connection_max = 5000 -enabled = true - -[servers] - - # You can indent as you please. Tabs or spaces. TOML don't care. - [servers.alpha] - ip = "10.0.0.1" - dc = "eqdc10" - - [servers.beta] - ip = "10.0.0.2" - dc = "eqdc10" - -[clients] -data = [ ["gamma", "delta"], [1, 2] ] # just an update to make sure parsers support it - -# Line breaks are OK when inside arrays -hosts = [ - "alpha", - "omega" +contacts = [ + "Donald Duck ", + "Scrooge McDuck ", ] ``` -And the corresponding Go types are: +Can be decoded with: ```go -type tomlConfig struct { - Title string - Owner ownerInfo - DB database `toml:"database"` - Servers map[string]server - Clients clients +// Create address type which satisfies the encoding.TextUnmarshaler interface. +type address struct { + *mail.Address } -type ownerInfo struct { - Name string - Org string `toml:"organization"` - Bio string - DOB time.Time +func (a *address) UnmarshalText(text []byte) error { + var err error + a.Address, err = mail.ParseAddress(string(text)) + return err } -type database struct { - Server string - Ports []int - ConnMax int `toml:"connection_max"` - Enabled bool -} +// Decode it. +func decode() { + blob := ` + contacts = [ + "Donald Duck ", + "Scrooge McDuck ", + ] + ` -type server struct { - IP string - DC string -} + var contacts struct { + Contacts []address + } -type clients struct { - Data [][]interface{} - Hosts []string + _, err := toml.Decode(blob, &contacts) + if err != nil { + log.Fatal(err) + } + + for _, c := range contacts.Contacts { + fmt.Printf("%#v\n", c.Address) + } + + // Output: + // &mail.Address{Name:"Donald Duck", Address:"donald@duckburg.com"} + // &mail.Address{Name:"Scrooge McDuck", Address:"scrooge@duckburg.com"} } ``` -Note that a case insensitive match will be tried if an exact match can't be -found. +To target TOML specifically you can implement `UnmarshalTOML` TOML interface in +a similar way. -A working example of the above can be found in `_examples/example.{go,toml}`. +### More complex usage +See the [`_example/`](/_example) directory for a more complex example. diff --git a/vendor/github.com/BurntSushi/toml/decode.go b/vendor/github.com/BurntSushi/toml/decode.go index b0fd51d5..09523315 100644 --- a/vendor/github.com/BurntSushi/toml/decode.go +++ b/vendor/github.com/BurntSushi/toml/decode.go @@ -1,54 +1,171 @@ package toml import ( + "bytes" + "encoding" + "encoding/json" "fmt" "io" "io/ioutil" "math" + "os" "reflect" + "strconv" "strings" "time" ) -func e(format string, args ...interface{}) error { - return fmt.Errorf("toml: "+format, args...) -} - // Unmarshaler is the interface implemented by objects that can unmarshal a // TOML description of themselves. type Unmarshaler interface { UnmarshalTOML(interface{}) error } -// Unmarshal decodes the contents of `p` in TOML format into a pointer `v`. -func Unmarshal(p []byte, v interface{}) error { - _, err := Decode(string(p), v) +// Unmarshal decodes the contents of `data` in TOML format into a pointer `v`. +func Unmarshal(data []byte, v interface{}) error { + _, err := NewDecoder(bytes.NewReader(data)).Decode(v) return err } +// Decode the TOML data in to the pointer v. +// +// See the documentation on Decoder for a description of the decoding process. +func Decode(data string, v interface{}) (MetaData, error) { + return NewDecoder(strings.NewReader(data)).Decode(v) +} + +// DecodeFile is just like Decode, except it will automatically read the +// contents of the file at path and decode it for you. +func DecodeFile(path string, v interface{}) (MetaData, error) { + fp, err := os.Open(path) + if err != nil { + return MetaData{}, err + } + defer fp.Close() + return NewDecoder(fp).Decode(v) +} + // Primitive is a TOML value that hasn't been decoded into a Go value. -// When using the various `Decode*` functions, the type `Primitive` may -// be given to any value, and its decoding will be delayed. // -// A `Primitive` value can be decoded using the `PrimitiveDecode` function. +// This type can be used for any value, which will cause decoding to be delayed. +// You can use the PrimitiveDecode() function to "manually" decode these values. // -// The underlying representation of a `Primitive` value is subject to change. -// Do not rely on it. +// NOTE: The underlying representation of a `Primitive` value is subject to +// change. Do not rely on it. // -// N.B. Primitive values are still parsed, so using them will only avoid -// the overhead of reflection. They can be useful when you don't know the -// exact type of TOML data until run time. +// NOTE: Primitive values are still parsed, so using them will only avoid the +// overhead of reflection. They can be useful when you don't know the exact type +// of TOML data until runtime. type Primitive struct { undecoded interface{} context Key } -// DEPRECATED! +// The significand precision for float32 and float64 is 24 and 53 bits; this is +// the range a natural number can be stored in a float without loss of data. +const ( + maxSafeFloat32Int = 16777215 // 2^24-1 + maxSafeFloat64Int = int64(9007199254740991) // 2^53-1 +) + +// Decoder decodes TOML data. // -// Use MetaData.PrimitiveDecode instead. -func PrimitiveDecode(primValue Primitive, v interface{}) error { - md := MetaData{decoded: make(map[string]bool)} - return md.unify(primValue.undecoded, rvalue(v)) +// TOML tables correspond to Go structs or maps (dealer's choice – they can be +// used interchangeably). +// +// TOML table arrays correspond to either a slice of structs or a slice of maps. +// +// TOML datetimes correspond to Go time.Time values. Local datetimes are parsed +// in the local timezone. +// +// time.Duration types are treated as nanoseconds if the TOML value is an +// integer, or they're parsed with time.ParseDuration() if they're strings. +// +// All other TOML types (float, string, int, bool and array) correspond to the +// obvious Go types. +// +// An exception to the above rules is if a type implements the TextUnmarshaler +// interface, in which case any primitive TOML value (floats, strings, integers, +// booleans, datetimes) will be converted to a []byte and given to the value's +// UnmarshalText method. See the Unmarshaler example for a demonstration with +// email addresses. +// +// Key mapping +// +// TOML keys can map to either keys in a Go map or field names in a Go struct. +// The special `toml` struct tag can be used to map TOML keys to struct fields +// that don't match the key name exactly (see the example). A case insensitive +// match to struct names will be tried if an exact match can't be found. +// +// The mapping between TOML values and Go values is loose. That is, there may +// exist TOML values that cannot be placed into your representation, and there +// may be parts of your representation that do not correspond to TOML values. +// This loose mapping can be made stricter by using the IsDefined and/or +// Undecoded methods on the MetaData returned. +// +// This decoder does not handle cyclic types. Decode will not terminate if a +// cyclic type is passed. +type Decoder struct { + r io.Reader +} + +// NewDecoder creates a new Decoder. +func NewDecoder(r io.Reader) *Decoder { + return &Decoder{r: r} +} + +var ( + unmarshalToml = reflect.TypeOf((*Unmarshaler)(nil)).Elem() + unmarshalText = reflect.TypeOf((*encoding.TextUnmarshaler)(nil)).Elem() + primitiveType = reflect.TypeOf((*Primitive)(nil)).Elem() +) + +// Decode TOML data in to the pointer `v`. +func (dec *Decoder) Decode(v interface{}) (MetaData, error) { + rv := reflect.ValueOf(v) + if rv.Kind() != reflect.Ptr { + s := "%q" + if reflect.TypeOf(v) == nil { + s = "%v" + } + + return MetaData{}, fmt.Errorf("toml: cannot decode to non-pointer "+s, reflect.TypeOf(v)) + } + if rv.IsNil() { + return MetaData{}, fmt.Errorf("toml: cannot decode to nil value of %q", reflect.TypeOf(v)) + } + + // Check if this is a supported type: struct, map, interface{}, or something + // that implements UnmarshalTOML or UnmarshalText. + rv = indirect(rv) + rt := rv.Type() + if rv.Kind() != reflect.Struct && rv.Kind() != reflect.Map && + !(rv.Kind() == reflect.Interface && rv.NumMethod() == 0) && + !rt.Implements(unmarshalToml) && !rt.Implements(unmarshalText) { + return MetaData{}, fmt.Errorf("toml: cannot decode to type %s", rt) + } + + // TODO: parser should read from io.Reader? Or at the very least, make it + // read from []byte rather than string + data, err := ioutil.ReadAll(dec.r) + if err != nil { + return MetaData{}, err + } + + p, err := parse(string(data)) + if err != nil { + return MetaData{}, err + } + + md := MetaData{ + mapping: p.mapping, + keyInfo: p.keyInfo, + keys: p.ordered, + decoded: make(map[string]struct{}, len(p.ordered)), + context: nil, + data: data, + } + return md, md.unify(p.mapping, rv) } // PrimitiveDecode is just like the other `Decode*` functions, except it @@ -68,90 +185,15 @@ func (md *MetaData) PrimitiveDecode(primValue Primitive, v interface{}) error { return md.unify(primValue.undecoded, rvalue(v)) } -// Decode will decode the contents of `data` in TOML format into a pointer -// `v`. -// -// TOML hashes correspond to Go structs or maps. (Dealer's choice. They can be -// used interchangeably.) -// -// TOML arrays of tables correspond to either a slice of structs or a slice -// of maps. -// -// TOML datetimes correspond to Go `time.Time` values. -// -// All other TOML types (float, string, int, bool and array) correspond -// to the obvious Go types. -// -// An exception to the above rules is if a type implements the -// encoding.TextUnmarshaler interface. In this case, any primitive TOML value -// (floats, strings, integers, booleans and datetimes) will be converted to -// a byte string and given to the value's UnmarshalText method. See the -// Unmarshaler example for a demonstration with time duration strings. -// -// Key mapping -// -// TOML keys can map to either keys in a Go map or field names in a Go -// struct. The special `toml` struct tag may be used to map TOML keys to -// struct fields that don't match the key name exactly. (See the example.) -// A case insensitive match to struct names will be tried if an exact match -// can't be found. -// -// The mapping between TOML values and Go values is loose. That is, there -// may exist TOML values that cannot be placed into your representation, and -// there may be parts of your representation that do not correspond to -// TOML values. This loose mapping can be made stricter by using the IsDefined -// and/or Undecoded methods on the MetaData returned. -// -// This decoder will not handle cyclic types. If a cyclic type is passed, -// `Decode` will not terminate. -func Decode(data string, v interface{}) (MetaData, error) { - rv := reflect.ValueOf(v) - if rv.Kind() != reflect.Ptr { - return MetaData{}, e("Decode of non-pointer %s", reflect.TypeOf(v)) - } - if rv.IsNil() { - return MetaData{}, e("Decode of nil %s", reflect.TypeOf(v)) - } - p, err := parse(data) - if err != nil { - return MetaData{}, err - } - md := MetaData{ - p.mapping, p.types, p.ordered, - make(map[string]bool, len(p.ordered)), nil, - } - return md, md.unify(p.mapping, indirect(rv)) -} - -// DecodeFile is just like Decode, except it will automatically read the -// contents of the file at `fpath` and decode it for you. -func DecodeFile(fpath string, v interface{}) (MetaData, error) { - bs, err := ioutil.ReadFile(fpath) - if err != nil { - return MetaData{}, err - } - return Decode(string(bs), v) -} - -// DecodeReader is just like Decode, except it will consume all bytes -// from the reader and decode it for you. -func DecodeReader(r io.Reader, v interface{}) (MetaData, error) { - bs, err := ioutil.ReadAll(r) - if err != nil { - return MetaData{}, err - } - return Decode(string(bs), v) -} - // unify performs a sort of type unification based on the structure of `rv`, // which is the client representation. // // Any type mismatch produces an error. Finding a type that we don't know // how to handle produces an unsupported type error. func (md *MetaData) unify(data interface{}, rv reflect.Value) error { - // Special case. Look for a `Primitive` value. - if rv.Type() == reflect.TypeOf((*Primitive)(nil)).Elem() { + // TODO: #76 would make this superfluous after implemented. + if rv.Type() == primitiveType { // Save the undecoded data and the key context into the primitive // value. context := make(Key, len(md.context)) @@ -163,36 +205,24 @@ func (md *MetaData) unify(data interface{}, rv reflect.Value) error { return nil } - // Special case. Unmarshaler Interface support. - if rv.CanAddr() { - if v, ok := rv.Addr().Interface().(Unmarshaler); ok { - return v.UnmarshalTOML(data) - } + rvi := rv.Interface() + if v, ok := rvi.(Unmarshaler); ok { + return v.UnmarshalTOML(data) } - - // Special case. Handle time.Time values specifically. - // TODO: Remove this code when we decide to drop support for Go 1.1. - // This isn't necessary in Go 1.2 because time.Time satisfies the encoding - // interfaces. - if rv.Type().AssignableTo(rvalue(time.Time{}).Type()) { - return md.unifyDatetime(data, rv) - } - - // Special case. Look for a value satisfying the TextUnmarshaler interface. - if v, ok := rv.Interface().(TextUnmarshaler); ok { + if v, ok := rvi.(encoding.TextUnmarshaler); ok { return md.unifyText(data, v) } - // BUG(burntsushi) + + // TODO: // The behavior here is incorrect whenever a Go type satisfies the - // encoding.TextUnmarshaler interface but also corresponds to a TOML - // hash or array. In particular, the unmarshaler should only be applied - // to primitive TOML values. But at this point, it will be applied to - // all kinds of values and produce an incorrect error whenever those values - // are hashes or arrays (including arrays of tables). + // encoding.TextUnmarshaler interface but also corresponds to a TOML hash or + // array. In particular, the unmarshaler should only be applied to primitive + // TOML values. But at this point, it will be applied to all kinds of values + // and produce an incorrect error whenever those values are hashes or arrays + // (including arrays of tables). k := rv.Kind() - // laziness if k >= reflect.Int && k <= reflect.Uint64 { return md.unifyInt(data, rv) } @@ -218,17 +248,14 @@ func (md *MetaData) unify(data interface{}, rv reflect.Value) error { case reflect.Bool: return md.unifyBool(data, rv) case reflect.Interface: - // we only support empty interfaces. - if rv.NumMethod() > 0 { - return e("unsupported type %s", rv.Type()) + if rv.NumMethod() > 0 { // Only support empty interfaces are supported. + return md.e("unsupported type %s", rv.Type()) } return md.unifyAnything(data, rv) - case reflect.Float32: - fallthrough - case reflect.Float64: + case reflect.Float32, reflect.Float64: return md.unifyFloat64(data, rv) } - return e("unsupported type %s", rv.Kind()) + return md.e("unsupported type %s", rv.Kind()) } func (md *MetaData) unifyStruct(mapping interface{}, rv reflect.Value) error { @@ -237,7 +264,7 @@ func (md *MetaData) unifyStruct(mapping interface{}, rv reflect.Value) error { if mapping == nil { return nil } - return e("type mismatch for %s: expected table but found %T", + return md.e("type mismatch for %s: expected table but found %T", rv.Type().String(), mapping) } @@ -259,17 +286,18 @@ func (md *MetaData) unifyStruct(mapping interface{}, rv reflect.Value) error { for _, i := range f.index { subv = indirect(subv.Field(i)) } + if isUnifiable(subv) { - md.decoded[md.context.add(key).String()] = true + md.decoded[md.context.add(key).String()] = struct{}{} md.context = append(md.context, key) - if err := md.unify(datum, subv); err != nil { + + err := md.unify(datum, subv) + if err != nil { return err } md.context = md.context[0 : len(md.context)-1] } else if f.name != "" { - // Bad user! No soup for you! - return e("cannot write unexported field %s.%s", - rv.Type().String(), f.name) + return md.e("cannot write unexported field %s.%s", rv.Type().String(), f.name) } } } @@ -277,28 +305,43 @@ func (md *MetaData) unifyStruct(mapping interface{}, rv reflect.Value) error { } func (md *MetaData) unifyMap(mapping interface{}, rv reflect.Value) error { + keyType := rv.Type().Key().Kind() + if keyType != reflect.String && keyType != reflect.Interface { + return fmt.Errorf("toml: cannot decode to a map with non-string key type (%s in %q)", + keyType, rv.Type()) + } + tmap, ok := mapping.(map[string]interface{}) if !ok { if tmap == nil { return nil } - return badtype("map", mapping) + return md.badtype("map", mapping) } if rv.IsNil() { rv.Set(reflect.MakeMap(rv.Type())) } for k, v := range tmap { - md.decoded[md.context.add(k).String()] = true + md.decoded[md.context.add(k).String()] = struct{}{} md.context = append(md.context, k) - rvkey := indirect(reflect.New(rv.Type().Key())) rvval := reflect.Indirect(reflect.New(rv.Type().Elem())) - if err := md.unify(v, rvval); err != nil { + + err := md.unify(v, indirect(rvval)) + if err != nil { return err } md.context = md.context[0 : len(md.context)-1] - rvkey.SetString(k) + rvkey := indirect(reflect.New(rv.Type().Key())) + + switch keyType { + case reflect.Interface: + rvkey.Set(reflect.ValueOf(k)) + case reflect.String: + rvkey.SetString(k) + } + rv.SetMapIndex(rvkey, rvval) } return nil @@ -310,12 +353,10 @@ func (md *MetaData) unifyArray(data interface{}, rv reflect.Value) error { if !datav.IsValid() { return nil } - return badtype("slice", data) + return md.badtype("slice", data) } - sliceLen := datav.Len() - if sliceLen != rv.Len() { - return e("expected array length %d; got TOML array of length %d", - rv.Len(), sliceLen) + if l := datav.Len(); l != rv.Len() { + return md.e("expected array length %d; got TOML array of length %d", rv.Len(), l) } return md.unifySliceArray(datav, rv) } @@ -326,7 +367,7 @@ func (md *MetaData) unifySlice(data interface{}, rv reflect.Value) error { if !datav.IsValid() { return nil } - return badtype("slice", data) + return md.badtype("slice", data) } n := datav.Len() if rv.IsNil() || rv.Cap() < n { @@ -337,37 +378,45 @@ func (md *MetaData) unifySlice(data interface{}, rv reflect.Value) error { } func (md *MetaData) unifySliceArray(data, rv reflect.Value) error { - sliceLen := data.Len() - for i := 0; i < sliceLen; i++ { - v := data.Index(i).Interface() - sliceval := indirect(rv.Index(i)) - if err := md.unify(v, sliceval); err != nil { + l := data.Len() + for i := 0; i < l; i++ { + err := md.unify(data.Index(i).Interface(), indirect(rv.Index(i))) + if err != nil { return err } } return nil } -func (md *MetaData) unifyDatetime(data interface{}, rv reflect.Value) error { - if _, ok := data.(time.Time); ok { - rv.Set(reflect.ValueOf(data)) +func (md *MetaData) unifyString(data interface{}, rv reflect.Value) error { + _, ok := rv.Interface().(json.Number) + if ok { + if i, ok := data.(int64); ok { + rv.SetString(strconv.FormatInt(i, 10)) + } else if f, ok := data.(float64); ok { + rv.SetString(strconv.FormatFloat(f, 'f', -1, 64)) + } else { + return md.badtype("string", data) + } return nil } - return badtype("time.Time", data) -} -func (md *MetaData) unifyString(data interface{}, rv reflect.Value) error { if s, ok := data.(string); ok { rv.SetString(s) return nil } - return badtype("string", data) + return md.badtype("string", data) } func (md *MetaData) unifyFloat64(data interface{}, rv reflect.Value) error { + rvk := rv.Kind() + if num, ok := data.(float64); ok { - switch rv.Kind() { + switch rvk { case reflect.Float32: + if num < -math.MaxFloat32 || num > math.MaxFloat32 { + return md.parseErr(errParseRange{i: num, size: rvk.String()}) + } fallthrough case reflect.Float64: rv.SetFloat(num) @@ -376,54 +425,60 @@ func (md *MetaData) unifyFloat64(data interface{}, rv reflect.Value) error { } return nil } - return badtype("float", data) + + if num, ok := data.(int64); ok { + if (rvk == reflect.Float32 && (num < -maxSafeFloat32Int || num > maxSafeFloat32Int)) || + (rvk == reflect.Float64 && (num < -maxSafeFloat64Int || num > maxSafeFloat64Int)) { + return md.parseErr(errParseRange{i: num, size: rvk.String()}) + } + rv.SetFloat(float64(num)) + return nil + } + + return md.badtype("float", data) } func (md *MetaData) unifyInt(data interface{}, rv reflect.Value) error { - if num, ok := data.(int64); ok { - if rv.Kind() >= reflect.Int && rv.Kind() <= reflect.Int64 { - switch rv.Kind() { - case reflect.Int, reflect.Int64: - // No bounds checking necessary. - case reflect.Int8: - if num < math.MinInt8 || num > math.MaxInt8 { - return e("value %d is out of range for int8", num) - } - case reflect.Int16: - if num < math.MinInt16 || num > math.MaxInt16 { - return e("value %d is out of range for int16", num) - } - case reflect.Int32: - if num < math.MinInt32 || num > math.MaxInt32 { - return e("value %d is out of range for int32", num) - } + _, ok := rv.Interface().(time.Duration) + if ok { + // Parse as string duration, and fall back to regular integer parsing + // (as nanosecond) if this is not a string. + if s, ok := data.(string); ok { + dur, err := time.ParseDuration(s) + if err != nil { + return md.parseErr(errParseDuration{s}) } - rv.SetInt(num) - } else if rv.Kind() >= reflect.Uint && rv.Kind() <= reflect.Uint64 { - unum := uint64(num) - switch rv.Kind() { - case reflect.Uint, reflect.Uint64: - // No bounds checking necessary. - case reflect.Uint8: - if num < 0 || unum > math.MaxUint8 { - return e("value %d is out of range for uint8", num) - } - case reflect.Uint16: - if num < 0 || unum > math.MaxUint16 { - return e("value %d is out of range for uint16", num) - } - case reflect.Uint32: - if num < 0 || unum > math.MaxUint32 { - return e("value %d is out of range for uint32", num) - } - } - rv.SetUint(unum) - } else { - panic("unreachable") + rv.SetInt(int64(dur)) + return nil } - return nil } - return badtype("integer", data) + + num, ok := data.(int64) + if !ok { + return md.badtype("integer", data) + } + + rvk := rv.Kind() + switch { + case rvk >= reflect.Int && rvk <= reflect.Int64: + if (rvk == reflect.Int8 && (num < math.MinInt8 || num > math.MaxInt8)) || + (rvk == reflect.Int16 && (num < math.MinInt16 || num > math.MaxInt16)) || + (rvk == reflect.Int32 && (num < math.MinInt32 || num > math.MaxInt32)) { + return md.parseErr(errParseRange{i: num, size: rvk.String()}) + } + rv.SetInt(num) + case rvk >= reflect.Uint && rvk <= reflect.Uint64: + unum := uint64(num) + if rvk == reflect.Uint8 && (num < 0 || unum > math.MaxUint8) || + rvk == reflect.Uint16 && (num < 0 || unum > math.MaxUint16) || + rvk == reflect.Uint32 && (num < 0 || unum > math.MaxUint32) { + return md.parseErr(errParseRange{i: num, size: rvk.String()}) + } + rv.SetUint(unum) + default: + panic("unreachable") + } + return nil } func (md *MetaData) unifyBool(data interface{}, rv reflect.Value) error { @@ -431,7 +486,7 @@ func (md *MetaData) unifyBool(data interface{}, rv reflect.Value) error { rv.SetBool(b) return nil } - return badtype("boolean", data) + return md.badtype("boolean", data) } func (md *MetaData) unifyAnything(data interface{}, rv reflect.Value) error { @@ -439,10 +494,16 @@ func (md *MetaData) unifyAnything(data interface{}, rv reflect.Value) error { return nil } -func (md *MetaData) unifyText(data interface{}, v TextUnmarshaler) error { +func (md *MetaData) unifyText(data interface{}, v encoding.TextUnmarshaler) error { var s string switch sdata := data.(type) { - case TextMarshaler: + case Marshaler: + text, err := sdata.MarshalTOML() + if err != nil { + return err + } + s = string(text) + case encoding.TextMarshaler: text, err := sdata.MarshalText() if err != nil { return err @@ -459,7 +520,7 @@ func (md *MetaData) unifyText(data interface{}, v TextUnmarshaler) error { case float64: s = fmt.Sprintf("%f", sdata) default: - return badtype("primitive (string-like)", data) + return md.badtype("primitive (string-like)", data) } if err := v.UnmarshalText([]byte(s)); err != nil { return err @@ -467,22 +528,54 @@ func (md *MetaData) unifyText(data interface{}, v TextUnmarshaler) error { return nil } +func (md *MetaData) badtype(dst string, data interface{}) error { + return md.e("incompatible types: TOML value has type %T; destination has type %s", data, dst) +} + +func (md *MetaData) parseErr(err error) error { + k := md.context.String() + return ParseError{ + LastKey: k, + Position: md.keyInfo[k].pos, + Line: md.keyInfo[k].pos.Line, + err: err, + input: string(md.data), + } +} + +func (md *MetaData) e(format string, args ...interface{}) error { + f := "toml: " + if len(md.context) > 0 { + f = fmt.Sprintf("toml: (last key %q): ", md.context) + p := md.keyInfo[md.context.String()].pos + if p.Line > 0 { + f = fmt.Sprintf("toml: line %d (last key %q): ", p.Line, md.context) + } + } + return fmt.Errorf(f+format, args...) +} + // rvalue returns a reflect.Value of `v`. All pointers are resolved. func rvalue(v interface{}) reflect.Value { return indirect(reflect.ValueOf(v)) } // indirect returns the value pointed to by a pointer. -// Pointers are followed until the value is not a pointer. -// New values are allocated for each nil pointer. // -// An exception to this rule is if the value satisfies an interface of -// interest to us (like encoding.TextUnmarshaler). +// Pointers are followed until the value is not a pointer. New values are +// allocated for each nil pointer. +// +// An exception to this rule is if the value satisfies an interface of interest +// to us (like encoding.TextUnmarshaler). func indirect(v reflect.Value) reflect.Value { if v.Kind() != reflect.Ptr { if v.CanSet() { pv := v.Addr() - if _, ok := pv.Interface().(TextUnmarshaler); ok { + pvi := pv.Interface() + if _, ok := pvi.(encoding.TextUnmarshaler); ok { + return pv + } + if _, ok := pvi.(Unmarshaler); ok { return pv } } @@ -498,12 +591,12 @@ func isUnifiable(rv reflect.Value) bool { if rv.CanSet() { return true } - if _, ok := rv.Interface().(TextUnmarshaler); ok { + rvi := rv.Interface() + if _, ok := rvi.(encoding.TextUnmarshaler); ok { + return true + } + if _, ok := rvi.(Unmarshaler); ok { return true } return false } - -func badtype(expected string, data interface{}) error { - return e("cannot load TOML value of type %T into a Go %s", data, expected) -} diff --git a/vendor/github.com/BurntSushi/toml/decode_go116.go b/vendor/github.com/BurntSushi/toml/decode_go116.go new file mode 100644 index 00000000..eddfb641 --- /dev/null +++ b/vendor/github.com/BurntSushi/toml/decode_go116.go @@ -0,0 +1,19 @@ +//go:build go1.16 +// +build go1.16 + +package toml + +import ( + "io/fs" +) + +// DecodeFS is just like Decode, except it will automatically read the contents +// of the file at `path` from a fs.FS instance. +func DecodeFS(fsys fs.FS, path string, v interface{}) (MetaData, error) { + fp, err := fsys.Open(path) + if err != nil { + return MetaData{}, err + } + defer fp.Close() + return NewDecoder(fp).Decode(v) +} diff --git a/vendor/github.com/BurntSushi/toml/deprecated.go b/vendor/github.com/BurntSushi/toml/deprecated.go new file mode 100644 index 00000000..c6af3f23 --- /dev/null +++ b/vendor/github.com/BurntSushi/toml/deprecated.go @@ -0,0 +1,21 @@ +package toml + +import ( + "encoding" + "io" +) + +// Deprecated: use encoding.TextMarshaler +type TextMarshaler encoding.TextMarshaler + +// Deprecated: use encoding.TextUnmarshaler +type TextUnmarshaler encoding.TextUnmarshaler + +// Deprecated: use MetaData.PrimitiveDecode. +func PrimitiveDecode(primValue Primitive, v interface{}) error { + md := MetaData{decoded: make(map[string]struct{})} + return md.unify(primValue.undecoded, rvalue(v)) +} + +// Deprecated: use NewDecoder(reader).Decode(&value). +func DecodeReader(r io.Reader, v interface{}) (MetaData, error) { return NewDecoder(r).Decode(v) } diff --git a/vendor/github.com/BurntSushi/toml/doc.go b/vendor/github.com/BurntSushi/toml/doc.go index b371f396..099c4a77 100644 --- a/vendor/github.com/BurntSushi/toml/doc.go +++ b/vendor/github.com/BurntSushi/toml/doc.go @@ -1,27 +1,13 @@ /* -Package toml provides facilities for decoding and encoding TOML configuration -files via reflection. There is also support for delaying decoding with -the Primitive type, and querying the set of keys in a TOML document with the -MetaData type. +Package toml implements decoding and encoding of TOML files. -The specification implemented: https://github.com/toml-lang/toml +This package supports TOML v1.0.0, as listed on https://toml.io -The sub-command github.com/BurntSushi/toml/cmd/tomlv can be used to verify -whether a file is a valid TOML document. It can also be used to print the -type of each key in a TOML document. +There is also support for delaying decoding with the Primitive type, and +querying the set of keys in a TOML document with the MetaData type. -Testing - -There are two important types of tests used for this package. The first is -contained inside '*_test.go' files and uses the standard Go unit testing -framework. These tests are primarily devoted to holistically testing the -decoder and encoder. - -The second type of testing is used to verify the implementation's adherence -to the TOML specification. These tests have been factored into their own -project: https://github.com/BurntSushi/toml-test - -The reason the tests are in a separate project is so that they can be used by -any implementation of TOML. Namely, it is language agnostic. +The github.com/BurntSushi/toml/cmd/tomlv package implements a TOML validator, +and can be used to verify if TOML document is valid. It can also be used to +print the type of each key. */ package toml diff --git a/vendor/github.com/BurntSushi/toml/encode.go b/vendor/github.com/BurntSushi/toml/encode.go index d905c21a..dc8568d1 100644 --- a/vendor/github.com/BurntSushi/toml/encode.go +++ b/vendor/github.com/BurntSushi/toml/encode.go @@ -2,57 +2,127 @@ package toml import ( "bufio" + "encoding" + "encoding/json" "errors" "fmt" "io" + "math" "reflect" "sort" "strconv" "strings" "time" + + "github.com/BurntSushi/toml/internal" ) type tomlEncodeError struct{ error } var ( - errArrayMixedElementTypes = errors.New( - "toml: cannot encode array with mixed element types") - errArrayNilElement = errors.New( - "toml: cannot encode array with nil element") - errNonString = errors.New( - "toml: cannot encode a map with non-string key type") - errAnonNonStruct = errors.New( - "toml: cannot encode an anonymous field that is not a struct") - errArrayNoTable = errors.New( - "toml: TOML array element cannot contain a table") - errNoKey = errors.New( - "toml: top-level values must be Go maps or structs") - errAnything = errors.New("") // used in testing + errArrayNilElement = errors.New("toml: cannot encode array with nil element") + errNonString = errors.New("toml: cannot encode a map with non-string key type") + errNoKey = errors.New("toml: top-level values must be Go maps or structs") + errAnything = errors.New("") // used in testing ) -var quotedReplacer = strings.NewReplacer( - "\t", "\\t", - "\n", "\\n", - "\r", "\\r", +var dblQuotedReplacer = strings.NewReplacer( "\"", "\\\"", "\\", "\\\\", + "\x00", `\u0000`, + "\x01", `\u0001`, + "\x02", `\u0002`, + "\x03", `\u0003`, + "\x04", `\u0004`, + "\x05", `\u0005`, + "\x06", `\u0006`, + "\x07", `\u0007`, + "\b", `\b`, + "\t", `\t`, + "\n", `\n`, + "\x0b", `\u000b`, + "\f", `\f`, + "\r", `\r`, + "\x0e", `\u000e`, + "\x0f", `\u000f`, + "\x10", `\u0010`, + "\x11", `\u0011`, + "\x12", `\u0012`, + "\x13", `\u0013`, + "\x14", `\u0014`, + "\x15", `\u0015`, + "\x16", `\u0016`, + "\x17", `\u0017`, + "\x18", `\u0018`, + "\x19", `\u0019`, + "\x1a", `\u001a`, + "\x1b", `\u001b`, + "\x1c", `\u001c`, + "\x1d", `\u001d`, + "\x1e", `\u001e`, + "\x1f", `\u001f`, + "\x7f", `\u007f`, ) -// Encoder controls the encoding of Go values to a TOML document to some -// io.Writer. -// -// The indentation level can be controlled with the Indent field. -type Encoder struct { - // A single indentation level. By default it is two spaces. - Indent string +var ( + marshalToml = reflect.TypeOf((*Marshaler)(nil)).Elem() + marshalText = reflect.TypeOf((*encoding.TextMarshaler)(nil)).Elem() + timeType = reflect.TypeOf((*time.Time)(nil)).Elem() +) - // hasWritten is whether we have written any output to w yet. - hasWritten bool - w *bufio.Writer +// Marshaler is the interface implemented by types that can marshal themselves +// into valid TOML. +type Marshaler interface { + MarshalTOML() ([]byte, error) } -// NewEncoder returns a TOML encoder that encodes Go values to the io.Writer -// given. By default, a single indentation level is 2 spaces. +// Encoder encodes a Go to a TOML document. +// +// The mapping between Go values and TOML values should be precisely the same as +// for the Decode* functions. +// +// time.Time is encoded as a RFC 3339 string, and time.Duration as its string +// representation. +// +// The toml.Marshaler and encoder.TextMarshaler interfaces are supported to +// encoding the value as custom TOML. +// +// If you want to write arbitrary binary data then you will need to use +// something like base64 since TOML does not have any binary types. +// +// When encoding TOML hashes (Go maps or structs), keys without any sub-hashes +// are encoded first. +// +// Go maps will be sorted alphabetically by key for deterministic output. +// +// The toml struct tag can be used to provide the key name; if omitted the +// struct field name will be used. If the "omitempty" option is present the +// following value will be skipped: +// +// - arrays, slices, maps, and string with len of 0 +// - struct with all zero values +// - bool false +// +// If omitzero is given all int and float types with a value of 0 will be +// skipped. +// +// Encoding Go values without a corresponding TOML representation will return an +// error. Examples of this includes maps with non-string keys, slices with nil +// elements, embedded non-struct types, and nested slices containing maps or +// structs. (e.g. [][]map[string]string is not allowed but []map[string]string +// is okay, as is []map[string][]string). +// +// NOTE: only exported keys are encoded due to the use of reflection. Unexported +// keys are silently discarded. +type Encoder struct { + // String to use for a single indentation level; default is two spaces. + Indent string + + w *bufio.Writer + hasWritten bool // written any output to w yet? +} + +// NewEncoder create a new Encoder. func NewEncoder(w io.Writer) *Encoder { return &Encoder{ w: bufio.NewWriter(w), @@ -60,29 +130,10 @@ func NewEncoder(w io.Writer) *Encoder { } } -// Encode writes a TOML representation of the Go value to the underlying -// io.Writer. If the value given cannot be encoded to a valid TOML document, -// then an error is returned. +// Encode writes a TOML representation of the Go value to the Encoder's writer. // -// The mapping between Go values and TOML values should be precisely the same -// as for the Decode* functions. Similarly, the TextMarshaler interface is -// supported by encoding the resulting bytes as strings. (If you want to write -// arbitrary binary data then you will need to use something like base64 since -// TOML does not have any binary types.) -// -// When encoding TOML hashes (i.e., Go maps or structs), keys without any -// sub-hashes are encoded first. -// -// If a Go map is encoded, then its keys are sorted alphabetically for -// deterministic output. More control over this behavior may be provided if -// there is demand for it. -// -// Encoding Go values without a corresponding TOML representation---like map -// types with non-string keys---will cause an error to be returned. Similarly -// for mixed arrays/slices, arrays/slices with nil elements, embedded -// non-struct types and nested slices containing maps or structs. -// (e.g., [][]map[string]string is not allowed but []map[string]string is OK -// and so is []map[string][]string.) +// An error is returned if the value given cannot be encoded to a valid TOML +// document. func (enc *Encoder) Encode(v interface{}) error { rv := eindirect(reflect.ValueOf(v)) if err := enc.safeEncode(Key([]string{}), rv); err != nil { @@ -106,13 +157,15 @@ func (enc *Encoder) safeEncode(key Key, rv reflect.Value) (err error) { } func (enc *Encoder) encode(key Key, rv reflect.Value) { - // Special case. Time needs to be in ISO8601 format. - // Special case. If we can marshal the type to text, then we used that. - // Basically, this prevents the encoder for handling these types as - // generic structs (or whatever the underlying type of a TextMarshaler is). - switch rv.Interface().(type) { - case time.Time, TextMarshaler: - enc.keyEqElement(key, rv) + // If we can marshal the type to text, then we use that. This prevents the + // encoder for handling these types as generic structs (or whatever the + // underlying type of a TextMarshaler is). + switch { + case isMarshaler(rv): + enc.writeKeyValue(key, rv, false) + return + case rv.Type() == primitiveType: // TODO: #76 would make this superfluous after implemented. + enc.encode(key, reflect.ValueOf(rv.Interface().(Primitive).undecoded)) return } @@ -123,12 +176,12 @@ func (enc *Encoder) encode(key Key, rv reflect.Value) { reflect.Uint, reflect.Uint8, reflect.Uint16, reflect.Uint32, reflect.Uint64, reflect.Float32, reflect.Float64, reflect.String, reflect.Bool: - enc.keyEqElement(key, rv) + enc.writeKeyValue(key, rv, false) case reflect.Array, reflect.Slice: if typeEqual(tomlArrayHash, tomlTypeOfGo(rv)) { enc.eArrayOfTables(key, rv) } else { - enc.keyEqElement(key, rv) + enc.writeKeyValue(key, rv, false) } case reflect.Interface: if rv.IsNil() { @@ -148,55 +201,114 @@ func (enc *Encoder) encode(key Key, rv reflect.Value) { case reflect.Struct: enc.eTable(key, rv) default: - panic(e("unsupported type for key '%s': %s", key, k)) + encPanic(fmt.Errorf("unsupported type for key '%s': %s", key, k)) } } -// eElement encodes any value that can be an array element (primitives and -// arrays). +// eElement encodes any value that can be an array element. func (enc *Encoder) eElement(rv reflect.Value) { switch v := rv.Interface().(type) { - case time.Time: - // Special case time.Time as a primitive. Has to come before - // TextMarshaler below because time.Time implements - // encoding.TextMarshaler, but we need to always use UTC. - enc.wf(v.UTC().Format("2006-01-02T15:04:05Z")) - return - case TextMarshaler: - // Special case. Use text marshaler if it's available for this value. - if s, err := v.MarshalText(); err != nil { - encPanic(err) - } else { - enc.writeQuoted(string(s)) + case time.Time: // Using TextMarshaler adds extra quotes, which we don't want. + format := time.RFC3339Nano + switch v.Location() { + case internal.LocalDatetime: + format = "2006-01-02T15:04:05.999999999" + case internal.LocalDate: + format = "2006-01-02" + case internal.LocalTime: + format = "15:04:05.999999999" + } + switch v.Location() { + default: + enc.wf(v.Format(format)) + case internal.LocalDatetime, internal.LocalDate, internal.LocalTime: + enc.wf(v.In(time.UTC).Format(format)) } return + case Marshaler: + s, err := v.MarshalTOML() + if err != nil { + encPanic(err) + } + if s == nil { + encPanic(errors.New("MarshalTOML returned nil and no error")) + } + enc.w.Write(s) + return + case encoding.TextMarshaler: + s, err := v.MarshalText() + if err != nil { + encPanic(err) + } + if s == nil { + encPanic(errors.New("MarshalText returned nil and no error")) + } + enc.writeQuoted(string(s)) + return + case time.Duration: + enc.writeQuoted(v.String()) + return + case json.Number: + n, _ := rv.Interface().(json.Number) + + if n == "" { /// Useful zero value. + enc.w.WriteByte('0') + return + } else if v, err := n.Int64(); err == nil { + enc.eElement(reflect.ValueOf(v)) + return + } else if v, err := n.Float64(); err == nil { + enc.eElement(reflect.ValueOf(v)) + return + } + encPanic(errors.New(fmt.Sprintf("Unable to convert \"%s\" to neither int64 nor float64", n))) } + switch rv.Kind() { - case reflect.Bool: - enc.wf(strconv.FormatBool(rv.Bool())) - case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, - reflect.Int64: - enc.wf(strconv.FormatInt(rv.Int(), 10)) - case reflect.Uint, reflect.Uint8, reflect.Uint16, - reflect.Uint32, reflect.Uint64: - enc.wf(strconv.FormatUint(rv.Uint(), 10)) - case reflect.Float32: - enc.wf(floatAddDecimal(strconv.FormatFloat(rv.Float(), 'f', -1, 32))) - case reflect.Float64: - enc.wf(floatAddDecimal(strconv.FormatFloat(rv.Float(), 'f', -1, 64))) - case reflect.Array, reflect.Slice: - enc.eArrayOrSliceElement(rv) - case reflect.Interface: + case reflect.Ptr: enc.eElement(rv.Elem()) + return case reflect.String: enc.writeQuoted(rv.String()) + case reflect.Bool: + enc.wf(strconv.FormatBool(rv.Bool())) + case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64: + enc.wf(strconv.FormatInt(rv.Int(), 10)) + case reflect.Uint, reflect.Uint8, reflect.Uint16, reflect.Uint32, reflect.Uint64: + enc.wf(strconv.FormatUint(rv.Uint(), 10)) + case reflect.Float32: + f := rv.Float() + if math.IsNaN(f) { + enc.wf("nan") + } else if math.IsInf(f, 0) { + enc.wf("%cinf", map[bool]byte{true: '-', false: '+'}[math.Signbit(f)]) + } else { + enc.wf(floatAddDecimal(strconv.FormatFloat(f, 'f', -1, 32))) + } + case reflect.Float64: + f := rv.Float() + if math.IsNaN(f) { + enc.wf("nan") + } else if math.IsInf(f, 0) { + enc.wf("%cinf", map[bool]byte{true: '-', false: '+'}[math.Signbit(f)]) + } else { + enc.wf(floatAddDecimal(strconv.FormatFloat(f, 'f', -1, 64))) + } + case reflect.Array, reflect.Slice: + enc.eArrayOrSliceElement(rv) + case reflect.Struct: + enc.eStruct(nil, rv, true) + case reflect.Map: + enc.eMap(nil, rv, true) + case reflect.Interface: + enc.eElement(rv.Elem()) default: - panic(e("unexpected primitive type: %s", rv.Kind())) + encPanic(fmt.Errorf("unexpected type: %T", rv.Interface())) } } -// By the TOML spec, all floats must have a decimal with at least one -// number on either side. +// By the TOML spec, all floats must have a decimal with at least one number on +// either side. func floatAddDecimal(fstr string) string { if !strings.Contains(fstr, ".") { return fstr + ".0" @@ -205,14 +317,14 @@ func floatAddDecimal(fstr string) string { } func (enc *Encoder) writeQuoted(s string) { - enc.wf("\"%s\"", quotedReplacer.Replace(s)) + enc.wf("\"%s\"", dblQuotedReplacer.Replace(s)) } func (enc *Encoder) eArrayOrSliceElement(rv reflect.Value) { length := rv.Len() enc.wf("[") for i := 0; i < length; i++ { - elem := rv.Index(i) + elem := eindirect(rv.Index(i)) enc.eElement(elem) if i != length-1 { enc.wf(", ") @@ -226,44 +338,43 @@ func (enc *Encoder) eArrayOfTables(key Key, rv reflect.Value) { encPanic(errNoKey) } for i := 0; i < rv.Len(); i++ { - trv := rv.Index(i) + trv := eindirect(rv.Index(i)) if isNil(trv) { continue } - panicIfInvalidKey(key) enc.newline() - enc.wf("%s[[%s]]", enc.indentStr(key), key.maybeQuotedAll()) + enc.wf("%s[[%s]]", enc.indentStr(key), key) enc.newline() - enc.eMapOrStruct(key, trv) + enc.eMapOrStruct(key, trv, false) } } func (enc *Encoder) eTable(key Key, rv reflect.Value) { - panicIfInvalidKey(key) if len(key) == 1 { // Output an extra newline between top-level tables. // (The newline isn't written if nothing else has been written though.) enc.newline() } if len(key) > 0 { - enc.wf("%s[%s]", enc.indentStr(key), key.maybeQuotedAll()) + enc.wf("%s[%s]", enc.indentStr(key), key) enc.newline() } - enc.eMapOrStruct(key, rv) + enc.eMapOrStruct(key, rv, false) } -func (enc *Encoder) eMapOrStruct(key Key, rv reflect.Value) { - switch rv := eindirect(rv); rv.Kind() { +func (enc *Encoder) eMapOrStruct(key Key, rv reflect.Value, inline bool) { + switch rv.Kind() { case reflect.Map: - enc.eMap(key, rv) + enc.eMap(key, rv, inline) case reflect.Struct: - enc.eStruct(key, rv) + enc.eStruct(key, rv, inline) default: + // Should never happen? panic("eTable: unhandled reflect.Value Kind: " + rv.Kind().String()) } } -func (enc *Encoder) eMap(key Key, rv reflect.Value) { +func (enc *Encoder) eMap(key Key, rv reflect.Value, inline bool) { rt := rv.Type() if rt.Key().Kind() != reflect.String { encPanic(errNonString) @@ -274,118 +385,179 @@ func (enc *Encoder) eMap(key Key, rv reflect.Value) { var mapKeysDirect, mapKeysSub []string for _, mapKey := range rv.MapKeys() { k := mapKey.String() - if typeIsHash(tomlTypeOfGo(rv.MapIndex(mapKey))) { + if typeIsTable(tomlTypeOfGo(eindirect(rv.MapIndex(mapKey)))) { mapKeysSub = append(mapKeysSub, k) } else { mapKeysDirect = append(mapKeysDirect, k) } } - var writeMapKeys = func(mapKeys []string) { + var writeMapKeys = func(mapKeys []string, trailC bool) { sort.Strings(mapKeys) - for _, mapKey := range mapKeys { - mrv := rv.MapIndex(reflect.ValueOf(mapKey)) - if isNil(mrv) { - // Don't write anything for nil fields. + for i, mapKey := range mapKeys { + val := eindirect(rv.MapIndex(reflect.ValueOf(mapKey))) + if isNil(val) { continue } - enc.encode(key.add(mapKey), mrv) + + if inline { + enc.writeKeyValue(Key{mapKey}, val, true) + if trailC || i != len(mapKeys)-1 { + enc.wf(", ") + } + } else { + enc.encode(key.add(mapKey), val) + } } } - writeMapKeys(mapKeysDirect) - writeMapKeys(mapKeysSub) + + if inline { + enc.wf("{") + } + writeMapKeys(mapKeysDirect, len(mapKeysSub) > 0) + writeMapKeys(mapKeysSub, false) + if inline { + enc.wf("}") + } } -func (enc *Encoder) eStruct(key Key, rv reflect.Value) { +const is32Bit = (32 << (^uint(0) >> 63)) == 32 + +func pointerTo(t reflect.Type) reflect.Type { + if t.Kind() == reflect.Ptr { + return pointerTo(t.Elem()) + } + return t +} + +func (enc *Encoder) eStruct(key Key, rv reflect.Value, inline bool) { // Write keys for fields directly under this key first, because if we write - // a field that creates a new table, then all keys under it will be in that + // a field that creates a new table then all keys under it will be in that // table (not the one we're writing here). - rt := rv.Type() - var fieldsDirect, fieldsSub [][]int - var addFields func(rt reflect.Type, rv reflect.Value, start []int) + // + // Fields is a [][]int: for fieldsDirect this always has one entry (the + // struct index). For fieldsSub it contains two entries: the parent field + // index from tv, and the field indexes for the fields of the sub. + var ( + rt = rv.Type() + fieldsDirect, fieldsSub [][]int + addFields func(rt reflect.Type, rv reflect.Value, start []int) + ) addFields = func(rt reflect.Type, rv reflect.Value, start []int) { for i := 0; i < rt.NumField(); i++ { f := rt.Field(i) - // skip unexported fields - if f.PkgPath != "" && !f.Anonymous { + isEmbed := f.Anonymous && pointerTo(f.Type).Kind() == reflect.Struct + if f.PkgPath != "" && !isEmbed { /// Skip unexported fields. continue } - frv := rv.Field(i) - if f.Anonymous { - t := f.Type - switch t.Kind() { - case reflect.Struct: - // Treat anonymous struct fields with - // tag names as though they are not - // anonymous, like encoding/json does. - if getOptions(f.Tag).name == "" { - addFields(t, frv, f.Index) - continue - } - case reflect.Ptr: - if t.Elem().Kind() == reflect.Struct && - getOptions(f.Tag).name == "" { - if !frv.IsNil() { - addFields(t.Elem(), frv.Elem(), f.Index) - } - continue - } - // Fall through to the normal field encoding logic below - // for non-struct anonymous fields. + opts := getOptions(f.Tag) + if opts.skip { + continue + } + + frv := eindirect(rv.Field(i)) + + // Treat anonymous struct fields with tag names as though they are + // not anonymous, like encoding/json does. + // + // Non-struct anonymous fields use the normal encoding logic. + if isEmbed { + if getOptions(f.Tag).name == "" && frv.Kind() == reflect.Struct { + addFields(frv.Type(), frv, append(start, f.Index...)) + continue } } - if typeIsHash(tomlTypeOfGo(frv)) { + if typeIsTable(tomlTypeOfGo(frv)) { fieldsSub = append(fieldsSub, append(start, f.Index...)) } else { - fieldsDirect = append(fieldsDirect, append(start, f.Index...)) + // Copy so it works correct on 32bit archs; not clear why this + // is needed. See #314, and https://www.reddit.com/r/golang/comments/pnx8v4 + // This also works fine on 64bit, but 32bit archs are somewhat + // rare and this is a wee bit faster. + if is32Bit { + copyStart := make([]int, len(start)) + copy(copyStart, start) + fieldsDirect = append(fieldsDirect, append(copyStart, f.Index...)) + } else { + fieldsDirect = append(fieldsDirect, append(start, f.Index...)) + } } } } addFields(rt, rv, nil) - var writeFields = func(fields [][]int) { + writeFields := func(fields [][]int) { for _, fieldIndex := range fields { - sft := rt.FieldByIndex(fieldIndex) - sf := rv.FieldByIndex(fieldIndex) - if isNil(sf) { - // Don't write anything for nil fields. + fieldType := rt.FieldByIndex(fieldIndex) + fieldVal := eindirect(rv.FieldByIndex(fieldIndex)) + + if isNil(fieldVal) { /// Don't write anything for nil fields. continue } - opts := getOptions(sft.Tag) + opts := getOptions(fieldType.Tag) if opts.skip { continue } - keyName := sft.Name + keyName := fieldType.Name if opts.name != "" { keyName = opts.name } - if opts.omitempty && isEmpty(sf) { + if opts.omitempty && isEmpty(fieldVal) { continue } - if opts.omitzero && isZero(sf) { + if opts.omitzero && isZero(fieldVal) { continue } - enc.encode(key.add(keyName), sf) + if inline { + enc.writeKeyValue(Key{keyName}, fieldVal, true) + if fieldIndex[0] != len(fields)-1 { + enc.wf(", ") + } + } else { + enc.encode(key.add(keyName), fieldVal) + } } } + + if inline { + enc.wf("{") + } writeFields(fieldsDirect) writeFields(fieldsSub) + if inline { + enc.wf("}") + } } -// tomlTypeName returns the TOML type name of the Go value's type. It is -// used to determine whether the types of array elements are mixed (which is -// forbidden). If the Go value is nil, then it is illegal for it to be an array -// element, and valueIsNil is returned as true. - -// Returns the TOML type of a Go value. The type may be `nil`, which means -// no concrete TOML type could be found. +// tomlTypeOfGo returns the TOML type name of the Go value's type. +// +// It is used to determine whether the types of array elements are mixed (which +// is forbidden). If the Go value is nil, then it is illegal for it to be an +// array element, and valueIsNil is returned as true. +// +// The type may be `nil`, which means no concrete TOML type could be found. func tomlTypeOfGo(rv reflect.Value) tomlType { if isNil(rv) || !rv.IsValid() { return nil } + + if rv.Kind() == reflect.Struct { + if rv.Type() == timeType { + return tomlDatetime + } + if isMarshaler(rv) { + return tomlString + } + return tomlHash + } + + if isMarshaler(rv) { + return tomlString + } + switch rv.Kind() { case reflect.Bool: return tomlBool @@ -397,7 +569,7 @@ func tomlTypeOfGo(rv reflect.Value) tomlType { case reflect.Float32, reflect.Float64: return tomlFloat case reflect.Array, reflect.Slice: - if typeEqual(tomlHash, tomlArrayType(rv)) { + if isTableArray(rv) { return tomlArrayHash } return tomlArray @@ -407,54 +579,35 @@ func tomlTypeOfGo(rv reflect.Value) tomlType { return tomlString case reflect.Map: return tomlHash - case reflect.Struct: - switch rv.Interface().(type) { - case time.Time: - return tomlDatetime - case TextMarshaler: - return tomlString - default: - return tomlHash - } default: - panic("unexpected reflect.Kind: " + rv.Kind().String()) + encPanic(errors.New("unsupported type: " + rv.Kind().String())) + panic("unreachable") } } -// tomlArrayType returns the element type of a TOML array. The type returned -// may be nil if it cannot be determined (e.g., a nil slice or a zero length -// slize). This function may also panic if it finds a type that cannot be -// expressed in TOML (such as nil elements, heterogeneous arrays or directly -// nested arrays of tables). -func tomlArrayType(rv reflect.Value) tomlType { - if isNil(rv) || !rv.IsValid() || rv.Len() == 0 { - return nil - } - firstType := tomlTypeOfGo(rv.Index(0)) - if firstType == nil { - encPanic(errArrayNilElement) +func isMarshaler(rv reflect.Value) bool { + return rv.Type().Implements(marshalText) || rv.Type().Implements(marshalToml) +} + +// isTableArray reports if all entries in the array or slice are a table. +func isTableArray(arr reflect.Value) bool { + if isNil(arr) || !arr.IsValid() || arr.Len() == 0 { + return false } - rvlen := rv.Len() - for i := 1; i < rvlen; i++ { - elem := rv.Index(i) - switch elemType := tomlTypeOfGo(elem); { - case elemType == nil: + ret := true + for i := 0; i < arr.Len(); i++ { + tt := tomlTypeOfGo(eindirect(arr.Index(i))) + // Don't allow nil. + if tt == nil { encPanic(errArrayNilElement) - case !typeEqual(firstType, elemType): - encPanic(errArrayMixedElementTypes) + } + + if ret && !typeEqual(tomlHash, tt) { + ret = false } } - // If we have a nested array, then we must make sure that the nested - // array contains ONLY primitives. - // This checks arbitrarily nested arrays. - if typeEqual(firstType, tomlArray) || typeEqual(firstType, tomlArrayHash) { - nest := tomlArrayType(eindirect(rv.Index(0))) - if typeEqual(nest, tomlHash) || typeEqual(nest, tomlArrayHash) { - encPanic(errArrayNoTable) - } - } - return firstType + return ret } type tagOptions struct { @@ -499,6 +652,8 @@ func isEmpty(rv reflect.Value) bool { switch rv.Kind() { case reflect.Array, reflect.Slice, reflect.Map, reflect.String: return rv.Len() == 0 + case reflect.Struct: + return reflect.Zero(rv.Type()).Interface() == rv.Interface() case reflect.Bool: return !rv.Bool() } @@ -511,18 +666,32 @@ func (enc *Encoder) newline() { } } -func (enc *Encoder) keyEqElement(key Key, val reflect.Value) { +// Write a key/value pair: +// +// key = +// +// This is also used for "k = v" in inline tables; so something like this will +// be written in three calls: +// +// ┌────────────────────┐ +// │ ┌───┐ ┌─────┐│ +// v v v v vv +// key = {k = v, k2 = v2} +// +func (enc *Encoder) writeKeyValue(key Key, val reflect.Value, inline bool) { if len(key) == 0 { encPanic(errNoKey) } - panicIfInvalidKey(key) enc.wf("%s%s = ", enc.indentStr(key), key.maybeQuoted(len(key)-1)) enc.eElement(val) - enc.newline() + if !inline { + enc.newline() + } } func (enc *Encoder) wf(format string, v ...interface{}) { - if _, err := fmt.Fprintf(enc.w, format, v...); err != nil { + _, err := fmt.Fprintf(enc.w, format, v...) + if err != nil { encPanic(err) } enc.hasWritten = true @@ -536,13 +705,25 @@ func encPanic(err error) { panic(tomlEncodeError{err}) } +// Resolve any level of pointers to the actual value (e.g. **string → string). func eindirect(v reflect.Value) reflect.Value { - switch v.Kind() { - case reflect.Ptr, reflect.Interface: - return eindirect(v.Elem()) - default: + if v.Kind() != reflect.Ptr && v.Kind() != reflect.Interface { + if isMarshaler(v) { + return v + } + if v.CanAddr() { /// Special case for marshalers; see #358. + if pv := v.Addr(); isMarshaler(pv) { + return pv + } + } return v } + + if v.IsNil() { + return v + } + + return eindirect(v.Elem()) } func isNil(rv reflect.Value) bool { @@ -553,16 +734,3 @@ func isNil(rv reflect.Value) bool { return false } } - -func panicIfInvalidKey(key Key) { - for _, k := range key { - if len(k) == 0 { - encPanic(e("Key '%s' is not a valid table name. Key names "+ - "cannot be empty.", key.maybeQuotedAll())) - } - } -} - -func isValidKeyName(s string) bool { - return len(s) != 0 -} diff --git a/vendor/github.com/BurntSushi/toml/encoding_types.go b/vendor/github.com/BurntSushi/toml/encoding_types.go deleted file mode 100644 index d36e1dd6..00000000 --- a/vendor/github.com/BurntSushi/toml/encoding_types.go +++ /dev/null @@ -1,19 +0,0 @@ -// +build go1.2 - -package toml - -// In order to support Go 1.1, we define our own TextMarshaler and -// TextUnmarshaler types. For Go 1.2+, we just alias them with the -// standard library interfaces. - -import ( - "encoding" -) - -// TextMarshaler is a synonym for encoding.TextMarshaler. It is defined here -// so that Go 1.1 can be supported. -type TextMarshaler encoding.TextMarshaler - -// TextUnmarshaler is a synonym for encoding.TextUnmarshaler. It is defined -// here so that Go 1.1 can be supported. -type TextUnmarshaler encoding.TextUnmarshaler diff --git a/vendor/github.com/BurntSushi/toml/encoding_types_1.1.go b/vendor/github.com/BurntSushi/toml/encoding_types_1.1.go deleted file mode 100644 index e8d503d0..00000000 --- a/vendor/github.com/BurntSushi/toml/encoding_types_1.1.go +++ /dev/null @@ -1,18 +0,0 @@ -// +build !go1.2 - -package toml - -// These interfaces were introduced in Go 1.2, so we add them manually when -// compiling for Go 1.1. - -// TextMarshaler is a synonym for encoding.TextMarshaler. It is defined here -// so that Go 1.1 can be supported. -type TextMarshaler interface { - MarshalText() (text []byte, err error) -} - -// TextUnmarshaler is a synonym for encoding.TextUnmarshaler. It is defined -// here so that Go 1.1 can be supported. -type TextUnmarshaler interface { - UnmarshalText(text []byte) error -} diff --git a/vendor/github.com/BurntSushi/toml/error.go b/vendor/github.com/BurntSushi/toml/error.go new file mode 100644 index 00000000..2ac24e77 --- /dev/null +++ b/vendor/github.com/BurntSushi/toml/error.go @@ -0,0 +1,276 @@ +package toml + +import ( + "fmt" + "strings" +) + +// ParseError is returned when there is an error parsing the TOML syntax. +// +// For example invalid syntax, duplicate keys, etc. +// +// In addition to the error message itself, you can also print detailed location +// information with context by using ErrorWithPosition(): +// +// toml: error: Key 'fruit' was already created and cannot be used as an array. +// +// At line 4, column 2-7: +// +// 2 | fruit = [] +// 3 | +// 4 | [[fruit]] # Not allowed +// ^^^^^ +// +// Furthermore, the ErrorWithUsage() can be used to print the above with some +// more detailed usage guidance: +// +// toml: error: newlines not allowed within inline tables +// +// At line 1, column 18: +// +// 1 | x = [{ key = 42 # +// ^ +// +// Error help: +// +// Inline tables must always be on a single line: +// +// table = {key = 42, second = 43} +// +// It is invalid to split them over multiple lines like so: +// +// # INVALID +// table = { +// key = 42, +// second = 43 +// } +// +// Use regular for this: +// +// [table] +// key = 42 +// second = 43 +type ParseError struct { + Message string // Short technical message. + Usage string // Longer message with usage guidance; may be blank. + Position Position // Position of the error + LastKey string // Last parsed key, may be blank. + Line int // Line the error occurred. Deprecated: use Position. + + err error + input string +} + +// Position of an error. +type Position struct { + Line int // Line number, starting at 1. + Start int // Start of error, as byte offset starting at 0. + Len int // Lenght in bytes. +} + +func (pe ParseError) Error() string { + msg := pe.Message + if msg == "" { // Error from errorf() + msg = pe.err.Error() + } + + if pe.LastKey == "" { + return fmt.Sprintf("toml: line %d: %s", pe.Position.Line, msg) + } + return fmt.Sprintf("toml: line %d (last key %q): %s", + pe.Position.Line, pe.LastKey, msg) +} + +// ErrorWithUsage() returns the error with detailed location context. +// +// See the documentation on ParseError. +func (pe ParseError) ErrorWithPosition() string { + if pe.input == "" { // Should never happen, but just in case. + return pe.Error() + } + + var ( + lines = strings.Split(pe.input, "\n") + col = pe.column(lines) + b = new(strings.Builder) + ) + + msg := pe.Message + if msg == "" { + msg = pe.err.Error() + } + + // TODO: don't show control characters as literals? This may not show up + // well everywhere. + + if pe.Position.Len == 1 { + fmt.Fprintf(b, "toml: error: %s\n\nAt line %d, column %d:\n\n", + msg, pe.Position.Line, col+1) + } else { + fmt.Fprintf(b, "toml: error: %s\n\nAt line %d, column %d-%d:\n\n", + msg, pe.Position.Line, col, col+pe.Position.Len) + } + if pe.Position.Line > 2 { + fmt.Fprintf(b, "% 7d | %s\n", pe.Position.Line-2, lines[pe.Position.Line-3]) + } + if pe.Position.Line > 1 { + fmt.Fprintf(b, "% 7d | %s\n", pe.Position.Line-1, lines[pe.Position.Line-2]) + } + fmt.Fprintf(b, "% 7d | %s\n", pe.Position.Line, lines[pe.Position.Line-1]) + fmt.Fprintf(b, "% 10s%s%s\n", "", strings.Repeat(" ", col), strings.Repeat("^", pe.Position.Len)) + return b.String() +} + +// ErrorWithUsage() returns the error with detailed location context and usage +// guidance. +// +// See the documentation on ParseError. +func (pe ParseError) ErrorWithUsage() string { + m := pe.ErrorWithPosition() + if u, ok := pe.err.(interface{ Usage() string }); ok && u.Usage() != "" { + lines := strings.Split(strings.TrimSpace(u.Usage()), "\n") + for i := range lines { + if lines[i] != "" { + lines[i] = " " + lines[i] + } + } + return m + "Error help:\n\n" + strings.Join(lines, "\n") + "\n" + } + return m +} + +func (pe ParseError) column(lines []string) int { + var pos, col int + for i := range lines { + ll := len(lines[i]) + 1 // +1 for the removed newline + if pos+ll >= pe.Position.Start { + col = pe.Position.Start - pos + if col < 0 { // Should never happen, but just in case. + col = 0 + } + break + } + pos += ll + } + + return col +} + +type ( + errLexControl struct{ r rune } + errLexEscape struct{ r rune } + errLexUTF8 struct{ b byte } + errLexInvalidNum struct{ v string } + errLexInvalidDate struct{ v string } + errLexInlineTableNL struct{} + errLexStringNL struct{} + errParseRange struct { + i interface{} // int or float + size string // "int64", "uint16", etc. + } + errParseDuration struct{ d string } +) + +func (e errLexControl) Error() string { + return fmt.Sprintf("TOML files cannot contain control characters: '0x%02x'", e.r) +} +func (e errLexControl) Usage() string { return "" } + +func (e errLexEscape) Error() string { return fmt.Sprintf(`invalid escape in string '\%c'`, e.r) } +func (e errLexEscape) Usage() string { return usageEscape } +func (e errLexUTF8) Error() string { return fmt.Sprintf("invalid UTF-8 byte: 0x%02x", e.b) } +func (e errLexUTF8) Usage() string { return "" } +func (e errLexInvalidNum) Error() string { return fmt.Sprintf("invalid number: %q", e.v) } +func (e errLexInvalidNum) Usage() string { return "" } +func (e errLexInvalidDate) Error() string { return fmt.Sprintf("invalid date: %q", e.v) } +func (e errLexInvalidDate) Usage() string { return "" } +func (e errLexInlineTableNL) Error() string { return "newlines not allowed within inline tables" } +func (e errLexInlineTableNL) Usage() string { return usageInlineNewline } +func (e errLexStringNL) Error() string { return "strings cannot contain newlines" } +func (e errLexStringNL) Usage() string { return usageStringNewline } +func (e errParseRange) Error() string { return fmt.Sprintf("%v is out of range for %s", e.i, e.size) } +func (e errParseRange) Usage() string { return usageIntOverflow } +func (e errParseDuration) Error() string { return fmt.Sprintf("invalid duration: %q", e.d) } +func (e errParseDuration) Usage() string { return usageDuration } + +const usageEscape = ` +A '\' inside a "-delimited string is interpreted as an escape character. + +The following escape sequences are supported: +\b, \t, \n, \f, \r, \", \\, \uXXXX, and \UXXXXXXXX + +To prevent a '\' from being recognized as an escape character, use either: + +- a ' or '''-delimited string; escape characters aren't processed in them; or +- write two backslashes to get a single backslash: '\\'. + +If you're trying to add a Windows path (e.g. "C:\Users\martin") then using '/' +instead of '\' will usually also work: "C:/Users/martin". +` + +const usageInlineNewline = ` +Inline tables must always be on a single line: + + table = {key = 42, second = 43} + +It is invalid to split them over multiple lines like so: + + # INVALID + table = { + key = 42, + second = 43 + } + +Use regular for this: + + [table] + key = 42 + second = 43 +` + +const usageStringNewline = ` +Strings must always be on a single line, and cannot span more than one line: + + # INVALID + string = "Hello, + world!" + +Instead use """ or ''' to split strings over multiple lines: + + string = """Hello, + world!""" +` + +const usageIntOverflow = ` +This number is too large; this may be an error in the TOML, but it can also be a +bug in the program that uses too small of an integer. + +The maximum and minimum values are: + + size │ lowest │ highest + ───────┼────────────────┼────────── + int8 │ -128 │ 127 + int16 │ -32,768 │ 32,767 + int32 │ -2,147,483,648 │ 2,147,483,647 + int64 │ -9.2 × 10¹⁷ │ 9.2 × 10¹⁷ + uint8 │ 0 │ 255 + uint16 │ 0 │ 65535 + uint32 │ 0 │ 4294967295 + uint64 │ 0 │ 1.8 × 10¹⁸ + +int refers to int32 on 32-bit systems and int64 on 64-bit systems. +` + +const usageDuration = ` +A duration must be as "number", without any spaces. Valid units are: + + ns nanoseconds (billionth of a second) + us, µs microseconds (millionth of a second) + ms milliseconds (thousands of a second) + s seconds + m minutes + h hours + +You can combine multiple units; for example "5m10s" for 5 minutes and 10 +seconds. +` diff --git a/vendor/github.com/BurntSushi/toml/internal/tz.go b/vendor/github.com/BurntSushi/toml/internal/tz.go new file mode 100644 index 00000000..022f15bc --- /dev/null +++ b/vendor/github.com/BurntSushi/toml/internal/tz.go @@ -0,0 +1,36 @@ +package internal + +import "time" + +// Timezones used for local datetime, date, and time TOML types. +// +// The exact way times and dates without a timezone should be interpreted is not +// well-defined in the TOML specification and left to the implementation. These +// defaults to current local timezone offset of the computer, but this can be +// changed by changing these variables before decoding. +// +// TODO: +// Ideally we'd like to offer people the ability to configure the used timezone +// by setting Decoder.Timezone and Encoder.Timezone; however, this is a bit +// tricky: the reason we use three different variables for this is to support +// round-tripping – without these specific TZ names we wouldn't know which +// format to use. +// +// There isn't a good way to encode this right now though, and passing this sort +// of information also ties in to various related issues such as string format +// encoding, encoding of comments, etc. +// +// So, for the time being, just put this in internal until we can write a good +// comprehensive API for doing all of this. +// +// The reason they're exported is because they're referred from in e.g. +// internal/tag. +// +// Note that this behaviour is valid according to the TOML spec as the exact +// behaviour is left up to implementations. +var ( + localOffset = func() int { _, o := time.Now().Zone(); return o }() + LocalDatetime = time.FixedZone("datetime-local", localOffset) + LocalDate = time.FixedZone("date-local", localOffset) + LocalTime = time.FixedZone("time-local", localOffset) +) diff --git a/vendor/github.com/BurntSushi/toml/lex.go b/vendor/github.com/BurntSushi/toml/lex.go index e0a742a8..28ed4dd3 100644 --- a/vendor/github.com/BurntSushi/toml/lex.go +++ b/vendor/github.com/BurntSushi/toml/lex.go @@ -2,6 +2,8 @@ package toml import ( "fmt" + "reflect" + "runtime" "strings" "unicode" "unicode/utf8" @@ -29,33 +31,20 @@ const ( itemArrayTableStart itemArrayTableEnd itemKeyStart + itemKeyEnd itemCommentStart itemInlineTableStart itemInlineTableEnd ) -const ( - eof = 0 - comma = ',' - tableStart = '[' - tableEnd = ']' - arrayTableStart = '[' - arrayTableEnd = ']' - tableSep = '.' - keySep = '=' - arrayStart = '[' - arrayEnd = ']' - commentStart = '#' - stringStart = '"' - stringEnd = '"' - rawStringStart = '\'' - rawStringEnd = '\'' - inlineTableStart = '{' - inlineTableEnd = '}' -) +const eof = 0 type stateFn func(lx *lexer) stateFn +func (p Position) String() string { + return fmt.Sprintf("at line %d; start %d; length %d", p.Line, p.Start, p.Len) +} + type lexer struct { input string start int @@ -64,26 +53,26 @@ type lexer struct { state stateFn items chan item - // Allow for backing up up to three runes. - // This is necessary because TOML contains 3-rune tokens (""" and '''). - prevWidths [3]int - nprev int // how many of prevWidths are in use - // If we emit an eof, we can still back up, but it is not OK to call - // next again. - atEOF bool + // Allow for backing up up to 4 runes. This is necessary because TOML + // contains 3-rune tokens (""" and '''). + prevWidths [4]int + nprev int // how many of prevWidths are in use + atEOF bool // If we emit an eof, we can still back up, but it is not OK to call next again. // A stack of state functions used to maintain context. - // The idea is to reuse parts of the state machine in various places. - // For example, values can appear at the top level or within arbitrarily - // nested arrays. The last state on the stack is used after a value has - // been lexed. Similarly for comments. + // + // The idea is to reuse parts of the state machine in various places. For + // example, values can appear at the top level or within arbitrarily nested + // arrays. The last state on the stack is used after a value has been lexed. + // Similarly for comments. stack []stateFn } type item struct { - typ itemType - val string - line int + typ itemType + val string + err error + pos Position } func (lx *lexer) nextItem() item { @@ -93,6 +82,7 @@ func (lx *lexer) nextItem() item { return item default: lx.state = lx.state(lx) + //fmt.Printf(" STATE %-24s current: %-10s stack: %s\n", lx.state, lx.current(), lx.stack) } } } @@ -101,9 +91,9 @@ func lex(input string) *lexer { lx := &lexer{ input: input, state: lexTop, - line: 1, items: make(chan item, 10), stack: make([]stateFn, 0, 10), + line: 1, } return lx } @@ -125,19 +115,36 @@ func (lx *lexer) current() string { return lx.input[lx.start:lx.pos] } +func (lx lexer) getPos() Position { + p := Position{ + Line: lx.line, + Start: lx.start, + Len: lx.pos - lx.start, + } + if p.Len <= 0 { + p.Len = 1 + } + return p +} + func (lx *lexer) emit(typ itemType) { - lx.items <- item{typ, lx.current(), lx.line} + // Needed for multiline strings ending with an incomplete UTF-8 sequence. + if lx.start > lx.pos { + lx.error(errLexUTF8{lx.input[lx.pos]}) + return + } + lx.items <- item{typ: typ, pos: lx.getPos(), val: lx.current()} lx.start = lx.pos } func (lx *lexer) emitTrim(typ itemType) { - lx.items <- item{typ, strings.TrimSpace(lx.current()), lx.line} + lx.items <- item{typ: typ, pos: lx.getPos(), val: strings.TrimSpace(lx.current())} lx.start = lx.pos } func (lx *lexer) next() (r rune) { if lx.atEOF { - panic("next called after EOF") + panic("BUG in lexer: next called after EOF") } if lx.pos >= len(lx.input) { lx.atEOF = true @@ -147,12 +154,25 @@ func (lx *lexer) next() (r rune) { if lx.input[lx.pos] == '\n' { lx.line++ } + lx.prevWidths[3] = lx.prevWidths[2] lx.prevWidths[2] = lx.prevWidths[1] lx.prevWidths[1] = lx.prevWidths[0] - if lx.nprev < 3 { + if lx.nprev < 4 { lx.nprev++ } + r, w := utf8.DecodeRuneInString(lx.input[lx.pos:]) + if r == utf8.RuneError { + lx.error(errLexUTF8{lx.input[lx.pos]}) + return utf8.RuneError + } + + // Note: don't use peek() here, as this calls next(). + if isControl(r) || (r == '\r' && (len(lx.input)-1 == lx.pos || lx.input[lx.pos+1] != '\n')) { + lx.errorControlChar(r) + return utf8.RuneError + } + lx.prevWidths[0] = w lx.pos += w return r @@ -163,19 +183,21 @@ func (lx *lexer) ignore() { lx.start = lx.pos } -// backup steps back one rune. Can be called only twice between calls to next. +// backup steps back one rune. Can be called 4 times between calls to next. func (lx *lexer) backup() { if lx.atEOF { lx.atEOF = false return } if lx.nprev < 1 { - panic("backed up too far") + panic("BUG in lexer: backed up too far") } w := lx.prevWidths[0] lx.prevWidths[0] = lx.prevWidths[1] lx.prevWidths[1] = lx.prevWidths[2] + lx.prevWidths[2] = lx.prevWidths[3] lx.nprev-- + lx.pos -= w if lx.pos < len(lx.input) && lx.input[lx.pos] == '\n' { lx.line-- @@ -211,18 +233,58 @@ func (lx *lexer) skip(pred func(rune) bool) { } } -// errorf stops all lexing by emitting an error and returning `nil`. +// error stops all lexing by emitting an error and returning `nil`. +// // Note that any value that is a character is escaped if it's a special // character (newlines, tabs, etc.). -func (lx *lexer) errorf(format string, values ...interface{}) stateFn { - lx.items <- item{ - itemError, - fmt.Sprintf(format, values...), - lx.line, +func (lx *lexer) error(err error) stateFn { + if lx.atEOF { + return lx.errorPrevLine(err) } + lx.items <- item{typ: itemError, pos: lx.getPos(), err: err} return nil } +// errorfPrevline is like error(), but sets the position to the last column of +// the previous line. +// +// This is so that unexpected EOF or NL errors don't show on a new blank line. +func (lx *lexer) errorPrevLine(err error) stateFn { + pos := lx.getPos() + pos.Line-- + pos.Len = 1 + pos.Start = lx.pos - 1 + lx.items <- item{typ: itemError, pos: pos, err: err} + return nil +} + +// errorPos is like error(), but allows explicitly setting the position. +func (lx *lexer) errorPos(start, length int, err error) stateFn { + pos := lx.getPos() + pos.Start = start + pos.Len = length + lx.items <- item{typ: itemError, pos: pos, err: err} + return nil +} + +// errorf is like error, and creates a new error. +func (lx *lexer) errorf(format string, values ...interface{}) stateFn { + if lx.atEOF { + pos := lx.getPos() + pos.Line-- + pos.Len = 1 + pos.Start = lx.pos - 1 + lx.items <- item{typ: itemError, pos: pos, err: fmt.Errorf(format, values...)} + return nil + } + lx.items <- item{typ: itemError, pos: lx.getPos(), err: fmt.Errorf(format, values...)} + return nil +} + +func (lx *lexer) errorControlChar(cc rune) stateFn { + return lx.errorPos(lx.pos-1, 1, errLexControl{cc}) +} + // lexTop consumes elements at the top level of TOML data. func lexTop(lx *lexer) stateFn { r := lx.next() @@ -230,10 +292,10 @@ func lexTop(lx *lexer) stateFn { return lexSkip(lx, lexTop) } switch r { - case commentStart: + case '#': lx.push(lexTop) return lexCommentStart - case tableStart: + case '[': return lexTableStart case eof: if lx.pos > lx.start { @@ -256,7 +318,7 @@ func lexTop(lx *lexer) stateFn { func lexTopEnd(lx *lexer) stateFn { r := lx.next() switch { - case r == commentStart: + case r == '#': // a comment will read to a newline for us. lx.push(lexTop) return lexCommentStart @@ -269,8 +331,9 @@ func lexTopEnd(lx *lexer) stateFn { lx.emit(itemEOF) return nil } - return lx.errorf("expected a top-level item to end with a newline, "+ - "comment, or EOF, but got %q instead", r) + return lx.errorf( + "expected a top-level item to end with a newline, comment, or EOF, but got %q instead", + r) } // lexTable lexes the beginning of a table. Namely, it makes sure that @@ -279,7 +342,7 @@ func lexTopEnd(lx *lexer) stateFn { // It also handles the case that this is an item in an array of tables. // e.g., '[[name]]'. func lexTableStart(lx *lexer) stateFn { - if lx.peek() == arrayTableStart { + if lx.peek() == '[' { lx.next() lx.emit(itemArrayTableStart) lx.push(lexArrayTableEnd) @@ -296,9 +359,8 @@ func lexTableEnd(lx *lexer) stateFn { } func lexArrayTableEnd(lx *lexer) stateFn { - if r := lx.next(); r != arrayTableEnd { - return lx.errorf("expected end of table array name delimiter %q, "+ - "but got %q instead", arrayTableEnd, r) + if r := lx.next(); r != ']' { + return lx.errorf("expected end of table array name delimiter ']', but got %q instead", r) } lx.emit(itemArrayTableEnd) return lexTopEnd @@ -307,33 +369,20 @@ func lexArrayTableEnd(lx *lexer) stateFn { func lexTableNameStart(lx *lexer) stateFn { lx.skip(isWhitespace) switch r := lx.peek(); { - case r == tableEnd || r == eof: - return lx.errorf("unexpected end of table name " + - "(table names cannot be empty)") - case r == tableSep: - return lx.errorf("unexpected table separator " + - "(table names cannot be empty)") - case r == stringStart || r == rawStringStart: + case r == ']' || r == eof: + return lx.errorf("unexpected end of table name (table names cannot be empty)") + case r == '.': + return lx.errorf("unexpected table separator (table names cannot be empty)") + case r == '"' || r == '\'': lx.ignore() lx.push(lexTableNameEnd) - return lexValue // reuse string lexing + return lexQuotedName default: - return lexBareTableName + lx.push(lexTableNameEnd) + return lexBareName } } -// lexBareTableName lexes the name of a table. It assumes that at least one -// valid character for the table has already been read. -func lexBareTableName(lx *lexer) stateFn { - r := lx.next() - if isBareKeyChar(r) { - return lexBareTableName - } - lx.backup() - lx.emit(itemText) - return lexTableNameEnd -} - // lexTableNameEnd reads the end of a piece of a table name, optionally // consuming whitespace. func lexTableNameEnd(lx *lexer) stateFn { @@ -341,69 +390,107 @@ func lexTableNameEnd(lx *lexer) stateFn { switch r := lx.next(); { case isWhitespace(r): return lexTableNameEnd - case r == tableSep: + case r == '.': lx.ignore() return lexTableNameStart - case r == tableEnd: + case r == ']': return lx.pop() default: - return lx.errorf("expected '.' or ']' to end table name, "+ - "but got %q instead", r) + return lx.errorf("expected '.' or ']' to end table name, but got %q instead", r) } } -// lexKeyStart consumes a key name up until the first non-whitespace character. -// lexKeyStart will ignore whitespace. -func lexKeyStart(lx *lexer) stateFn { - r := lx.peek() +// lexBareName lexes one part of a key or table. +// +// It assumes that at least one valid character for the table has already been +// read. +// +// Lexes only one part, e.g. only 'a' inside 'a.b'. +func lexBareName(lx *lexer) stateFn { + r := lx.next() + if isBareKeyChar(r) { + return lexBareName + } + lx.backup() + lx.emit(itemText) + return lx.pop() +} + +// lexBareName lexes one part of a key or table. +// +// It assumes that at least one valid character for the table has already been +// read. +// +// Lexes only one part, e.g. only '"a"' inside '"a".b'. +func lexQuotedName(lx *lexer) stateFn { + r := lx.next() switch { - case r == keySep: - return lx.errorf("unexpected key separator %q", keySep) - case isWhitespace(r) || isNL(r): - lx.next() - return lexSkip(lx, lexKeyStart) - case r == stringStart || r == rawStringStart: - lx.ignore() - lx.emit(itemKeyStart) - lx.push(lexKeyEnd) - return lexValue // reuse string lexing + case isWhitespace(r): + return lexSkip(lx, lexValue) + case r == '"': + lx.ignore() // ignore the '"' + return lexString + case r == '\'': + lx.ignore() // ignore the "'" + return lexRawString + case r == eof: + return lx.errorf("unexpected EOF; expected value") default: - lx.ignore() - lx.emit(itemKeyStart) - return lexBareKey + return lx.errorf("expected value but found %q instead", r) } } -// lexBareKey consumes the text of a bare key. Assumes that the first character -// (which is not whitespace) has not yet been consumed. -func lexBareKey(lx *lexer) stateFn { - switch r := lx.next(); { - case isBareKeyChar(r): - return lexBareKey - case isWhitespace(r): - lx.backup() - lx.emit(itemText) - return lexKeyEnd - case r == keySep: - lx.backup() - lx.emit(itemText) - return lexKeyEnd +// lexKeyStart consumes all key parts until a '='. +func lexKeyStart(lx *lexer) stateFn { + lx.skip(isWhitespace) + switch r := lx.peek(); { + case r == '=' || r == eof: + return lx.errorf("unexpected '=': key name appears blank") + case r == '.': + return lx.errorf("unexpected '.': keys cannot start with a '.'") + case r == '"' || r == '\'': + lx.ignore() + fallthrough + default: // Bare key + lx.emit(itemKeyStart) + return lexKeyNameStart + } +} + +func lexKeyNameStart(lx *lexer) stateFn { + lx.skip(isWhitespace) + switch r := lx.peek(); { + case r == '=' || r == eof: + return lx.errorf("unexpected '='") + case r == '.': + return lx.errorf("unexpected '.'") + case r == '"' || r == '\'': + lx.ignore() + lx.push(lexKeyEnd) + return lexQuotedName default: - return lx.errorf("bare keys cannot contain %q", r) + lx.push(lexKeyEnd) + return lexBareName } } // lexKeyEnd consumes the end of a key and trims whitespace (up to the key // separator). func lexKeyEnd(lx *lexer) stateFn { + lx.skip(isWhitespace) switch r := lx.next(); { - case r == keySep: - return lexSkip(lx, lexValue) case isWhitespace(r): return lexSkip(lx, lexKeyEnd) + case r == eof: + return lx.errorf("unexpected EOF; expected key separator '='") + case r == '.': + lx.ignore() + return lexKeyNameStart + case r == '=': + lx.emit(itemKeyEnd) + return lexSkip(lx, lexValue) default: - return lx.errorf("expected key separator %q, but got %q instead", - keySep, r) + return lx.errorf("expected '.' or '=', but got %q instead", r) } } @@ -422,17 +509,17 @@ func lexValue(lx *lexer) stateFn { return lexNumberOrDateStart } switch r { - case arrayStart: + case '[': lx.ignore() lx.emit(itemArray) return lexArrayValue - case inlineTableStart: + case '{': lx.ignore() lx.emit(itemInlineTableStart) return lexInlineTableValue - case stringStart: - if lx.accept(stringStart) { - if lx.accept(stringStart) { + case '"': + if lx.accept('"') { + if lx.accept('"') { lx.ignore() // Ignore """ return lexMultilineString } @@ -440,9 +527,9 @@ func lexValue(lx *lexer) stateFn { } lx.ignore() // ignore the '"' return lexString - case rawStringStart: - if lx.accept(rawStringStart) { - if lx.accept(rawStringStart) { + case '\'': + if lx.accept('\'') { + if lx.accept('\'') { lx.ignore() // Ignore """ return lexMultilineRawString } @@ -450,10 +537,15 @@ func lexValue(lx *lexer) stateFn { } lx.ignore() // ignore the "'" return lexRawString - case '+', '-': - return lexNumberStart case '.': // special error case, be kind to users return lx.errorf("floats must start with a digit, not '.'") + case 'i', 'n': + if (lx.accept('n') && lx.accept('f')) || (lx.accept('a') && lx.accept('n')) { + lx.emit(itemFloat) + return lx.pop() + } + case '-', '+': + return lexDecimalNumberStart } if unicode.IsLetter(r) { // Be permissive here; lexBool will give a nice error if the @@ -463,6 +555,9 @@ func lexValue(lx *lexer) stateFn { lx.backup() return lexBool } + if r == eof { + return lx.errorf("unexpected EOF; expected value") + } return lx.errorf("expected value but found %q instead", r) } @@ -473,14 +568,12 @@ func lexArrayValue(lx *lexer) stateFn { switch { case isWhitespace(r) || isNL(r): return lexSkip(lx, lexArrayValue) - case r == commentStart: + case r == '#': lx.push(lexArrayValue) return lexCommentStart - case r == comma: + case r == ',': return lx.errorf("unexpected comma") - case r == arrayEnd: - // NOTE(caleb): The spec isn't clear about whether you can have - // a trailing comma or not, so we'll allow it. + case r == ']': return lexArrayEnd } @@ -493,23 +586,20 @@ func lexArrayValue(lx *lexer) stateFn { // the next value (or the end of the array): it ignores whitespace and newlines // and expects either a ',' or a ']'. func lexArrayValueEnd(lx *lexer) stateFn { - r := lx.next() - switch { + switch r := lx.next(); { case isWhitespace(r) || isNL(r): return lexSkip(lx, lexArrayValueEnd) - case r == commentStart: + case r == '#': lx.push(lexArrayValueEnd) return lexCommentStart - case r == comma: + case r == ',': lx.ignore() return lexArrayValue // move on to the next value - case r == arrayEnd: + case r == ']': return lexArrayEnd + default: + return lx.errorf("expected a comma (',') or array terminator (']'), but got %s", runeOrEOF(r)) } - return lx.errorf( - "expected a comma or array terminator %q, but got %q instead", - arrayEnd, r, - ) } // lexArrayEnd finishes the lexing of an array. @@ -528,13 +618,13 @@ func lexInlineTableValue(lx *lexer) stateFn { case isWhitespace(r): return lexSkip(lx, lexInlineTableValue) case isNL(r): - return lx.errorf("newlines not allowed within inline tables") - case r == commentStart: + return lx.errorPrevLine(errLexInlineTableNL{}) + case r == '#': lx.push(lexInlineTableValue) return lexCommentStart - case r == comma: + case r == ',': return lx.errorf("unexpected comma") - case r == inlineTableEnd: + case r == '}': return lexInlineTableEnd } lx.backup() @@ -546,23 +636,33 @@ func lexInlineTableValue(lx *lexer) stateFn { // key/value pair and the next pair (or the end of the table): // it ignores whitespace and expects either a ',' or a '}'. func lexInlineTableValueEnd(lx *lexer) stateFn { - r := lx.next() - switch { + switch r := lx.next(); { case isWhitespace(r): return lexSkip(lx, lexInlineTableValueEnd) case isNL(r): - return lx.errorf("newlines not allowed within inline tables") - case r == commentStart: + return lx.errorPrevLine(errLexInlineTableNL{}) + case r == '#': lx.push(lexInlineTableValueEnd) return lexCommentStart - case r == comma: + case r == ',': lx.ignore() + lx.skip(isWhitespace) + if lx.peek() == '}' { + return lx.errorf("trailing comma not allowed in inline tables") + } return lexInlineTableValue - case r == inlineTableEnd: + case r == '}': return lexInlineTableEnd + default: + return lx.errorf("expected a comma or an inline table terminator '}', but got %s instead", runeOrEOF(r)) } - return lx.errorf("expected a comma or an inline table terminator %q, "+ - "but got %q instead", inlineTableEnd, r) +} + +func runeOrEOF(r rune) string { + if r == eof { + return "end of file" + } + return "'" + string(r) + "'" } // lexInlineTableEnd finishes the lexing of an inline table. @@ -579,13 +679,13 @@ func lexString(lx *lexer) stateFn { r := lx.next() switch { case r == eof: - return lx.errorf("unexpected EOF") + return lx.errorf(`unexpected EOF; expected '"'`) case isNL(r): - return lx.errorf("strings cannot contain newlines") + return lx.errorPrevLine(errLexStringNL{}) case r == '\\': lx.push(lexString) return lexStringEscape - case r == stringEnd: + case r == '"': lx.backup() lx.emit(itemString) lx.next() @@ -598,19 +698,47 @@ func lexString(lx *lexer) stateFn { // lexMultilineString consumes the inner contents of a string. It assumes that // the beginning '"""' has already been consumed and ignored. func lexMultilineString(lx *lexer) stateFn { - switch lx.next() { + r := lx.next() + switch r { + default: + return lexMultilineString case eof: - return lx.errorf("unexpected EOF") + return lx.errorf(`unexpected EOF; expected '"""'`) case '\\': return lexMultilineStringEscape - case stringEnd: - if lx.accept(stringEnd) { - if lx.accept(stringEnd) { - lx.backup() + case '"': + /// Found " → try to read two more "". + if lx.accept('"') { + if lx.accept('"') { + /// Peek ahead: the string can contain " and "", including at the + /// end: """str""""" + /// 6 or more at the end, however, is an error. + if lx.peek() == '"' { + /// Check if we already lexed 5 's; if so we have 6 now, and + /// that's just too many man! + /// + /// Second check is for the edge case: + /// + /// two quotes allowed. + /// vv + /// """lol \"""""" + /// ^^ ^^^---- closing three + /// escaped + /// + /// But ugly, but it works + if strings.HasSuffix(lx.current(), `"""""`) && !strings.HasSuffix(lx.current(), `\"""""`) { + return lx.errorf(`unexpected '""""""'`) + } + lx.backup() + lx.backup() + return lexMultilineString + } + + lx.backup() /// backup: don't include the """ in the item. lx.backup() lx.backup() lx.emit(itemMultilineString) - lx.next() + lx.next() /// Read over ''' again and discard it. lx.next() lx.next() lx.ignore() @@ -618,8 +746,8 @@ func lexMultilineString(lx *lexer) stateFn { } lx.backup() } + return lexMultilineString } - return lexMultilineString } // lexRawString consumes a raw string. Nothing can be escaped in such a string. @@ -627,35 +755,54 @@ func lexMultilineString(lx *lexer) stateFn { func lexRawString(lx *lexer) stateFn { r := lx.next() switch { + default: + return lexRawString case r == eof: - return lx.errorf("unexpected EOF") + return lx.errorf(`unexpected EOF; expected "'"`) case isNL(r): - return lx.errorf("strings cannot contain newlines") - case r == rawStringEnd: + return lx.errorPrevLine(errLexStringNL{}) + case r == '\'': lx.backup() lx.emit(itemRawString) lx.next() lx.ignore() return lx.pop() } - return lexRawString } // lexMultilineRawString consumes a raw string. Nothing can be escaped in such // a string. It assumes that the beginning "'''" has already been consumed and // ignored. func lexMultilineRawString(lx *lexer) stateFn { - switch lx.next() { + r := lx.next() + switch r { + default: + return lexMultilineRawString case eof: - return lx.errorf("unexpected EOF") - case rawStringEnd: - if lx.accept(rawStringEnd) { - if lx.accept(rawStringEnd) { - lx.backup() + return lx.errorf(`unexpected EOF; expected "'''"`) + case '\'': + /// Found ' → try to read two more ''. + if lx.accept('\'') { + if lx.accept('\'') { + /// Peek ahead: the string can contain ' and '', including at the + /// end: '''str''''' + /// 6 or more at the end, however, is an error. + if lx.peek() == '\'' { + /// Check if we already lexed 5 's; if so we have 6 now, and + /// that's just too many man! + if strings.HasSuffix(lx.current(), "'''''") { + return lx.errorf(`unexpected "''''''"`) + } + lx.backup() + lx.backup() + return lexMultilineRawString + } + + lx.backup() /// backup: don't include the ''' in the item. lx.backup() lx.backup() lx.emit(itemRawMultilineString) - lx.next() + lx.next() /// Read over ''' again and discard it. lx.next() lx.next() lx.ignore() @@ -663,15 +810,14 @@ func lexMultilineRawString(lx *lexer) stateFn { } lx.backup() } + return lexMultilineRawString } - return lexMultilineRawString } // lexMultilineStringEscape consumes an escaped character. It assumes that the // preceding '\\' has already been consumed. func lexMultilineStringEscape(lx *lexer) stateFn { - // Handle the special case first: - if isNL(lx.next()) { + if isNL(lx.next()) { /// \ escaping newline. return lexMultilineString } lx.backup() @@ -694,6 +840,10 @@ func lexStringEscape(lx *lexer) stateFn { fallthrough case '"': fallthrough + case ' ', '\t': + // Inside """ .. """ strings you can use \ to escape newlines, and any + // amount of whitespace can be between the \ and \n. + fallthrough case '\\': return lx.pop() case 'u': @@ -701,9 +851,7 @@ func lexStringEscape(lx *lexer) stateFn { case 'U': return lexLongUnicodeEscape } - return lx.errorf("invalid escape character %q; only the following "+ - "escape characters are allowed: "+ - `\b, \t, \n, \f, \r, \", \\, \uXXXX, and \UXXXXXXXX`, r) + return lx.error(errLexEscape{r}) } func lexShortUnicodeEscape(lx *lexer) stateFn { @@ -711,8 +859,9 @@ func lexShortUnicodeEscape(lx *lexer) stateFn { for i := 0; i < 4; i++ { r = lx.next() if !isHexadecimal(r) { - return lx.errorf(`expected four hexadecimal digits after '\u', `+ - "but got %q instead", lx.current()) + return lx.errorf( + `expected four hexadecimal digits after '\u', but got %q instead`, + lx.current()) } } return lx.pop() @@ -723,28 +872,33 @@ func lexLongUnicodeEscape(lx *lexer) stateFn { for i := 0; i < 8; i++ { r = lx.next() if !isHexadecimal(r) { - return lx.errorf(`expected eight hexadecimal digits after '\U', `+ - "but got %q instead", lx.current()) + return lx.errorf( + `expected eight hexadecimal digits after '\U', but got %q instead`, + lx.current()) } } return lx.pop() } -// lexNumberOrDateStart consumes either an integer, a float, or datetime. +// lexNumberOrDateStart processes the first character of a value which begins +// with a digit. It exists to catch values starting with '0', so that +// lexBaseNumberOrDate can differentiate base prefixed integers from other +// types. func lexNumberOrDateStart(lx *lexer) stateFn { r := lx.next() - if isDigit(r) { - return lexNumberOrDate - } switch r { - case '_': - return lexNumber - case 'e', 'E': - return lexFloat - case '.': - return lx.errorf("floats must start with a digit, not '.'") + case '0': + return lexBaseNumberOrDate } - return lx.errorf("expected a digit but got %q", r) + + if !isDigit(r) { + // The only way to reach this state is if the value starts + // with a digit, so specifically treat anything else as an + // error. + return lx.errorf("expected a digit but got %q", r) + } + + return lexNumberOrDate } // lexNumberOrDate consumes either an integer, float or datetime. @@ -754,10 +908,10 @@ func lexNumberOrDate(lx *lexer) stateFn { return lexNumberOrDate } switch r { - case '-': + case '-', ':': return lexDatetime case '_': - return lexNumber + return lexDecimalNumber case '.', 'e', 'E': return lexFloat } @@ -775,41 +929,156 @@ func lexDatetime(lx *lexer) stateFn { return lexDatetime } switch r { - case '-', 'T', ':', '.', 'Z', '+': + case '-', ':', 'T', 't', ' ', '.', 'Z', 'z', '+': return lexDatetime } lx.backup() - lx.emit(itemDatetime) + lx.emitTrim(itemDatetime) return lx.pop() } -// lexNumberStart consumes either an integer or a float. It assumes that a sign -// has already been read, but that *no* digits have been consumed. -// lexNumberStart will move to the appropriate integer or float states. -func lexNumberStart(lx *lexer) stateFn { - // We MUST see a digit. Even floats have to start with a digit. +// lexHexInteger consumes a hexadecimal integer after seeing the '0x' prefix. +func lexHexInteger(lx *lexer) stateFn { r := lx.next() - if !isDigit(r) { - if r == '.' { - return lx.errorf("floats must start with a digit, not '.'") - } - return lx.errorf("expected a digit but got %q", r) - } - return lexNumber -} - -// lexNumber consumes an integer or a float after seeing the first digit. -func lexNumber(lx *lexer) stateFn { - r := lx.next() - if isDigit(r) { - return lexNumber + if isHexadecimal(r) { + return lexHexInteger } switch r { case '_': - return lexNumber + return lexHexInteger + } + + lx.backup() + lx.emit(itemInteger) + return lx.pop() +} + +// lexOctalInteger consumes an octal integer after seeing the '0o' prefix. +func lexOctalInteger(lx *lexer) stateFn { + r := lx.next() + if isOctal(r) { + return lexOctalInteger + } + switch r { + case '_': + return lexOctalInteger + } + + lx.backup() + lx.emit(itemInteger) + return lx.pop() +} + +// lexBinaryInteger consumes a binary integer after seeing the '0b' prefix. +func lexBinaryInteger(lx *lexer) stateFn { + r := lx.next() + if isBinary(r) { + return lexBinaryInteger + } + switch r { + case '_': + return lexBinaryInteger + } + + lx.backup() + lx.emit(itemInteger) + return lx.pop() +} + +// lexDecimalNumber consumes a decimal float or integer. +func lexDecimalNumber(lx *lexer) stateFn { + r := lx.next() + if isDigit(r) { + return lexDecimalNumber + } + switch r { case '.', 'e', 'E': return lexFloat + case '_': + return lexDecimalNumber + } + + lx.backup() + lx.emit(itemInteger) + return lx.pop() +} + +// lexDecimalNumber consumes the first digit of a number beginning with a sign. +// It assumes the sign has already been consumed. Values which start with a sign +// are only allowed to be decimal integers or floats. +// +// The special "nan" and "inf" values are also recognized. +func lexDecimalNumberStart(lx *lexer) stateFn { + r := lx.next() + + // Special error cases to give users better error messages + switch r { + case 'i': + if !lx.accept('n') || !lx.accept('f') { + return lx.errorf("invalid float: '%s'", lx.current()) + } + lx.emit(itemFloat) + return lx.pop() + case 'n': + if !lx.accept('a') || !lx.accept('n') { + return lx.errorf("invalid float: '%s'", lx.current()) + } + lx.emit(itemFloat) + return lx.pop() + case '0': + p := lx.peek() + switch p { + case 'b', 'o', 'x': + return lx.errorf("cannot use sign with non-decimal numbers: '%s%c'", lx.current(), p) + } + case '.': + return lx.errorf("floats must start with a digit, not '.'") + } + + if isDigit(r) { + return lexDecimalNumber + } + + return lx.errorf("expected a digit but got %q", r) +} + +// lexBaseNumberOrDate differentiates between the possible values which +// start with '0'. It assumes that before reaching this state, the initial '0' +// has been consumed. +func lexBaseNumberOrDate(lx *lexer) stateFn { + r := lx.next() + // Note: All datetimes start with at least two digits, so we don't + // handle date characters (':', '-', etc.) here. + if isDigit(r) { + return lexNumberOrDate + } + switch r { + case '_': + // Can only be decimal, because there can't be an underscore + // between the '0' and the base designator, and dates can't + // contain underscores. + return lexDecimalNumber + case '.', 'e', 'E': + return lexFloat + case 'b': + r = lx.peek() + if !isBinary(r) { + lx.errorf("not a binary number: '%s%c'", lx.current(), r) + } + return lexBinaryInteger + case 'o': + r = lx.peek() + if !isOctal(r) { + lx.errorf("not an octal number: '%s%c'", lx.current(), r) + } + return lexOctalInteger + case 'x': + r = lx.peek() + if !isHexadecimal(r) { + lx.errorf("not a hexidecimal number: '%s%c'", lx.current(), r) + } + return lexHexInteger } lx.backup() @@ -867,49 +1136,31 @@ func lexCommentStart(lx *lexer) stateFn { // It will consume *up to* the first newline character, and pass control // back to the last state on the stack. func lexComment(lx *lexer) stateFn { - r := lx.peek() - if isNL(r) || r == eof { + switch r := lx.next(); { + case isNL(r) || r == eof: + lx.backup() lx.emit(itemText) return lx.pop() + default: + return lexComment } - lx.next() - return lexComment } // lexSkip ignores all slurped input and moves on to the next state. func lexSkip(lx *lexer, nextState stateFn) stateFn { - return func(lx *lexer) stateFn { - lx.ignore() - return nextState + lx.ignore() + return nextState +} + +func (s stateFn) String() string { + name := runtime.FuncForPC(reflect.ValueOf(s).Pointer()).Name() + if i := strings.LastIndexByte(name, '.'); i > -1 { + name = name[i+1:] } -} - -// isWhitespace returns true if `r` is a whitespace character according -// to the spec. -func isWhitespace(r rune) bool { - return r == '\t' || r == ' ' -} - -func isNL(r rune) bool { - return r == '\n' || r == '\r' -} - -func isDigit(r rune) bool { - return r >= '0' && r <= '9' -} - -func isHexadecimal(r rune) bool { - return (r >= '0' && r <= '9') || - (r >= 'a' && r <= 'f') || - (r >= 'A' && r <= 'F') -} - -func isBareKeyChar(r rune) bool { - return (r >= 'A' && r <= 'Z') || - (r >= 'a' && r <= 'z') || - (r >= '0' && r <= '9') || - r == '_' || - r == '-' + if s == nil { + name = "" + } + return name + "()" } func (itype itemType) String() string { @@ -938,12 +1189,18 @@ func (itype itemType) String() string { return "TableEnd" case itemKeyStart: return "KeyStart" + case itemKeyEnd: + return "KeyEnd" case itemArray: return "Array" case itemArrayEnd: return "ArrayEnd" case itemCommentStart: return "CommentStart" + case itemInlineTableStart: + return "InlineTableStart" + case itemInlineTableEnd: + return "InlineTableEnd" } panic(fmt.Sprintf("BUG: Unknown type '%d'.", int(itype))) } @@ -951,3 +1208,26 @@ func (itype itemType) String() string { func (item item) String() string { return fmt.Sprintf("(%s, %s)", item.typ.String(), item.val) } + +func isWhitespace(r rune) bool { return r == '\t' || r == ' ' } +func isNL(r rune) bool { return r == '\n' || r == '\r' } +func isControl(r rune) bool { // Control characters except \t, \r, \n + switch r { + case '\t', '\r', '\n': + return false + default: + return (r >= 0x00 && r <= 0x1f) || r == 0x7f + } +} +func isDigit(r rune) bool { return r >= '0' && r <= '9' } +func isBinary(r rune) bool { return r == '0' || r == '1' } +func isOctal(r rune) bool { return r >= '0' && r <= '7' } +func isHexadecimal(r rune) bool { + return (r >= '0' && r <= '9') || (r >= 'a' && r <= 'f') || (r >= 'A' && r <= 'F') +} +func isBareKeyChar(r rune) bool { + return (r >= 'A' && r <= 'Z') || + (r >= 'a' && r <= 'z') || + (r >= '0' && r <= '9') || + r == '_' || r == '-' +} diff --git a/vendor/github.com/BurntSushi/toml/decode_meta.go b/vendor/github.com/BurntSushi/toml/meta.go similarity index 62% rename from vendor/github.com/BurntSushi/toml/decode_meta.go rename to vendor/github.com/BurntSushi/toml/meta.go index b9914a67..d284f2a0 100644 --- a/vendor/github.com/BurntSushi/toml/decode_meta.go +++ b/vendor/github.com/BurntSushi/toml/meta.go @@ -1,33 +1,40 @@ package toml -import "strings" +import ( + "strings" +) -// MetaData allows access to meta information about TOML data that may not -// be inferrable via reflection. In particular, whether a key has been defined -// and the TOML type of a key. +// MetaData allows access to meta information about TOML data that's not +// accessible otherwise. +// +// It allows checking if a key is defined in the TOML data, whether any keys +// were undecoded, and the TOML type of a key. type MetaData struct { - mapping map[string]interface{} - types map[string]tomlType - keys []Key - decoded map[string]bool context Key // Used only during decoding. + + keyInfo map[string]keyInfo + mapping map[string]interface{} + keys []Key + decoded map[string]struct{} + data []byte // Input file; for errors. } -// IsDefined returns true if the key given exists in the TOML data. The key -// should be specified hierarchially. e.g., +// IsDefined reports if the key exists in the TOML data. // -// // access the TOML key 'a.b.c' -// IsDefined("a", "b", "c") +// The key should be specified hierarchically, for example to access the TOML +// key "a.b.c" you would use IsDefined("a", "b", "c"). Keys are case sensitive. // -// IsDefined will return false if an empty key given. Keys are case sensitive. +// Returns false for an empty key. func (md *MetaData) IsDefined(key ...string) bool { if len(key) == 0 { return false } - var hash map[string]interface{} - var ok bool - var hashOrVal interface{} = md.mapping + var ( + hash map[string]interface{} + ok bool + hashOrVal interface{} = md.mapping + ) for _, k := range key { if hash, ok = hashOrVal.(map[string]interface{}); !ok { return false @@ -41,58 +48,20 @@ func (md *MetaData) IsDefined(key ...string) bool { // Type returns a string representation of the type of the key specified. // -// Type will return the empty string if given an empty key or a key that -// does not exist. Keys are case sensitive. +// Type will return the empty string if given an empty key or a key that does +// not exist. Keys are case sensitive. func (md *MetaData) Type(key ...string) string { - fullkey := strings.Join(key, ".") - if typ, ok := md.types[fullkey]; ok { - return typ.typeString() + if ki, ok := md.keyInfo[Key(key).String()]; ok { + return ki.tomlType.typeString() } return "" } -// Key is the type of any TOML key, including key groups. Use (MetaData).Keys -// to get values of this type. -type Key []string - -func (k Key) String() string { - return strings.Join(k, ".") -} - -func (k Key) maybeQuotedAll() string { - var ss []string - for i := range k { - ss = append(ss, k.maybeQuoted(i)) - } - return strings.Join(ss, ".") -} - -func (k Key) maybeQuoted(i int) string { - quote := false - for _, c := range k[i] { - if !isBareKeyChar(c) { - quote = true - break - } - } - if quote { - return "\"" + strings.Replace(k[i], "\"", "\\\"", -1) + "\"" - } - return k[i] -} - -func (k Key) add(piece string) Key { - newKey := make(Key, len(k)+1) - copy(newKey, k) - newKey[len(k)] = piece - return newKey -} - // Keys returns a slice of every key in the TOML data, including key groups. -// Each key is itself a slice, where the first element is the top of the -// hierarchy and the last is the most specific. // -// The list will have the same order as the keys appeared in the TOML data. +// Each key is itself a slice, where the first element is the top of the +// hierarchy and the last is the most specific. The list will have the same +// order as the keys appeared in the TOML data. // // All keys returned are non-empty. func (md *MetaData) Keys() []Key { @@ -113,9 +82,40 @@ func (md *MetaData) Keys() []Key { func (md *MetaData) Undecoded() []Key { undecoded := make([]Key, 0, len(md.keys)) for _, key := range md.keys { - if !md.decoded[key.String()] { + if _, ok := md.decoded[key.String()]; !ok { undecoded = append(undecoded, key) } } return undecoded } + +// Key represents any TOML key, including key groups. Use (MetaData).Keys to get +// values of this type. +type Key []string + +func (k Key) String() string { + ss := make([]string, len(k)) + for i := range k { + ss[i] = k.maybeQuoted(i) + } + return strings.Join(ss, ".") +} + +func (k Key) maybeQuoted(i int) string { + if k[i] == "" { + return `""` + } + for _, c := range k[i] { + if !isBareKeyChar(c) { + return `"` + dblQuotedReplacer.Replace(k[i]) + `"` + } + } + return k[i] +} + +func (k Key) add(piece string) Key { + newKey := make(Key, len(k)+1) + copy(newKey, k) + newKey[len(k)] = piece + return newKey +} diff --git a/vendor/github.com/BurntSushi/toml/parse.go b/vendor/github.com/BurntSushi/toml/parse.go index 50869ef9..d2542d6f 100644 --- a/vendor/github.com/BurntSushi/toml/parse.go +++ b/vendor/github.com/BurntSushi/toml/parse.go @@ -5,54 +5,69 @@ import ( "strconv" "strings" "time" - "unicode" "unicode/utf8" + + "github.com/BurntSushi/toml/internal" ) type parser struct { - mapping map[string]interface{} - types map[string]tomlType - lx *lexer + lx *lexer + context Key // Full key for the current hash in scope. + currentKey string // Base key name for everything except hashes. + pos Position // Current position in the TOML file. - // A list of keys in the order that they appear in the TOML data. - ordered []Key + ordered []Key // List of keys in the order that they appear in the TOML data. - // the full key for the current hash in scope - context Key - - // the base key name for everything except hashes - currentKey string - - // rough approximation of line number - approxLine int - - // A map of 'key.group.names' to whether they were created implicitly. - implicits map[string]bool + keyInfo map[string]keyInfo // Map keyname → info about the TOML key. + mapping map[string]interface{} // Map keyname → key value. + implicits map[string]struct{} // Record implicit keys (e.g. "key.group.names"). } -type parseError string - -func (pe parseError) Error() string { - return string(pe) +type keyInfo struct { + pos Position + tomlType tomlType } func parse(data string) (p *parser, err error) { defer func() { if r := recover(); r != nil { - var ok bool - if err, ok = r.(parseError); ok { + if pErr, ok := r.(ParseError); ok { + pErr.input = data + err = pErr return } panic(r) } }() + // Read over BOM; do this here as the lexer calls utf8.DecodeRuneInString() + // which mangles stuff. + if strings.HasPrefix(data, "\xff\xfe") || strings.HasPrefix(data, "\xfe\xff") { + data = data[2:] + } + + // Examine first few bytes for NULL bytes; this probably means it's a UTF-16 + // file (second byte in surrogate pair being NULL). Again, do this here to + // avoid having to deal with UTF-8/16 stuff in the lexer. + ex := 6 + if len(data) < 6 { + ex = len(data) + } + if i := strings.IndexRune(data[:ex], 0); i > -1 { + return nil, ParseError{ + Message: "files cannot contain NULL bytes; probably using UTF-16; TOML files must be UTF-8", + Position: Position{Line: 1, Start: i, Len: 1}, + Line: 1, + input: data, + } + } + p = &parser{ + keyInfo: make(map[string]keyInfo), mapping: make(map[string]interface{}), - types: make(map[string]tomlType), lx: lex(data), ordered: make([]Key, 0), - implicits: make(map[string]bool), + implicits: make(map[string]struct{}), } for { item := p.next() @@ -65,20 +80,57 @@ func parse(data string) (p *parser, err error) { return p, nil } +func (p *parser) panicErr(it item, err error) { + panic(ParseError{ + err: err, + Position: it.pos, + Line: it.pos.Len, + LastKey: p.current(), + }) +} + +func (p *parser) panicItemf(it item, format string, v ...interface{}) { + panic(ParseError{ + Message: fmt.Sprintf(format, v...), + Position: it.pos, + Line: it.pos.Len, + LastKey: p.current(), + }) +} + func (p *parser) panicf(format string, v ...interface{}) { - msg := fmt.Sprintf("Near line %d (last key parsed '%s'): %s", - p.approxLine, p.current(), fmt.Sprintf(format, v...)) - panic(parseError(msg)) + panic(ParseError{ + Message: fmt.Sprintf(format, v...), + Position: p.pos, + Line: p.pos.Line, + LastKey: p.current(), + }) } func (p *parser) next() item { it := p.lx.nextItem() + //fmt.Printf("ITEM %-18s line %-3d │ %q\n", it.typ, it.pos.Line, it.val) if it.typ == itemError { - p.panicf("%s", it.val) + if it.err != nil { + panic(ParseError{ + Position: it.pos, + Line: it.pos.Line, + LastKey: p.current(), + err: it.err, + }) + } + + p.panicItemf(it, "%s", it.val) } return it } +func (p *parser) nextPos() item { + it := p.next() + p.pos = it.pos + return it +} + func (p *parser) bug(format string, v ...interface{}) { panic(fmt.Sprintf("BUG: "+format+"\n\n", v...)) } @@ -97,44 +149,60 @@ func (p *parser) assertEqual(expected, got itemType) { func (p *parser) topLevel(item item) { switch item.typ { - case itemCommentStart: - p.approxLine = item.line + case itemCommentStart: // # .. p.expect(itemText) - case itemTableStart: - kg := p.next() - p.approxLine = kg.line + case itemTableStart: // [ .. ] + name := p.nextPos() var key Key - for ; kg.typ != itemTableEnd && kg.typ != itemEOF; kg = p.next() { - key = append(key, p.keyString(kg)) + for ; name.typ != itemTableEnd && name.typ != itemEOF; name = p.next() { + key = append(key, p.keyString(name)) } - p.assertEqual(itemTableEnd, kg.typ) + p.assertEqual(itemTableEnd, name.typ) - p.establishContext(key, false) - p.setType("", tomlHash) + p.addContext(key, false) + p.setType("", tomlHash, item.pos) p.ordered = append(p.ordered, key) - case itemArrayTableStart: - kg := p.next() - p.approxLine = kg.line + case itemArrayTableStart: // [[ .. ]] + name := p.nextPos() var key Key - for ; kg.typ != itemArrayTableEnd && kg.typ != itemEOF; kg = p.next() { - key = append(key, p.keyString(kg)) + for ; name.typ != itemArrayTableEnd && name.typ != itemEOF; name = p.next() { + key = append(key, p.keyString(name)) } - p.assertEqual(itemArrayTableEnd, kg.typ) + p.assertEqual(itemArrayTableEnd, name.typ) - p.establishContext(key, true) - p.setType("", tomlArrayHash) + p.addContext(key, true) + p.setType("", tomlArrayHash, item.pos) p.ordered = append(p.ordered, key) - case itemKeyStart: - kname := p.next() - p.approxLine = kname.line - p.currentKey = p.keyString(kname) + case itemKeyStart: // key = .. + outerContext := p.context + /// Read all the key parts (e.g. 'a' and 'b' in 'a.b') + k := p.nextPos() + var key Key + for ; k.typ != itemKeyEnd && k.typ != itemEOF; k = p.next() { + key = append(key, p.keyString(k)) + } + p.assertEqual(itemKeyEnd, k.typ) - val, typ := p.value(p.next()) - p.setValue(p.currentKey, val) - p.setType(p.currentKey, typ) + /// The current key is the last part. + p.currentKey = key[len(key)-1] + + /// All the other parts (if any) are the context; need to set each part + /// as implicit. + context := key[:len(key)-1] + for i := range context { + p.addImplicitContext(append(p.context, context[i:i+1]...)) + } + + /// Set value. + vItem := p.next() + val, typ := p.value(vItem, false) + p.set(p.currentKey, val, typ, vItem.pos) p.ordered = append(p.ordered, p.context.add(p.currentKey)) + + /// Remove the context we added (preserving any context from [tbl] lines). + p.context = outerContext p.currentKey = "" default: p.bug("Unexpected type at top level: %s", item.typ) @@ -148,180 +216,261 @@ func (p *parser) keyString(it item) string { return it.val case itemString, itemMultilineString, itemRawString, itemRawMultilineString: - s, _ := p.value(it) + s, _ := p.value(it, false) return s.(string) default: p.bug("Unexpected key type: %s", it.typ) - panic("unreachable") } + panic("unreachable") } +var datetimeRepl = strings.NewReplacer( + "z", "Z", + "t", "T", + " ", "T") + // value translates an expected value from the lexer into a Go value wrapped // as an empty interface. -func (p *parser) value(it item) (interface{}, tomlType) { +func (p *parser) value(it item, parentIsArray bool) (interface{}, tomlType) { switch it.typ { case itemString: - return p.replaceEscapes(it.val), p.typeOfPrimitive(it) + return p.replaceEscapes(it, it.val), p.typeOfPrimitive(it) case itemMultilineString: - trimmed := stripFirstNewline(stripEscapedWhitespace(it.val)) - return p.replaceEscapes(trimmed), p.typeOfPrimitive(it) + return p.replaceEscapes(it, stripFirstNewline(p.stripEscapedNewlines(it.val))), p.typeOfPrimitive(it) case itemRawString: return it.val, p.typeOfPrimitive(it) case itemRawMultilineString: return stripFirstNewline(it.val), p.typeOfPrimitive(it) + case itemInteger: + return p.valueInteger(it) + case itemFloat: + return p.valueFloat(it) case itemBool: switch it.val { case "true": return true, p.typeOfPrimitive(it) case "false": return false, p.typeOfPrimitive(it) + default: + p.bug("Expected boolean value, but got '%s'.", it.val) } - p.bug("Expected boolean value, but got '%s'.", it.val) - case itemInteger: - if !numUnderscoresOK(it.val) { - p.panicf("Invalid integer %q: underscores must be surrounded by digits", - it.val) - } - val := strings.Replace(it.val, "_", "", -1) - num, err := strconv.ParseInt(val, 10, 64) - if err != nil { - // Distinguish integer values. Normally, it'd be a bug if the lexer - // provides an invalid integer, but it's possible that the number is - // out of range of valid values (which the lexer cannot determine). - // So mark the former as a bug but the latter as a legitimate user - // error. - if e, ok := err.(*strconv.NumError); ok && - e.Err == strconv.ErrRange { - - p.panicf("Integer '%s' is out of the range of 64-bit "+ - "signed integers.", it.val) - } else { - p.bug("Expected integer value, but got '%s'.", it.val) - } - } - return num, p.typeOfPrimitive(it) - case itemFloat: - parts := strings.FieldsFunc(it.val, func(r rune) bool { - switch r { - case '.', 'e', 'E': - return true - } - return false - }) - for _, part := range parts { - if !numUnderscoresOK(part) { - p.panicf("Invalid float %q: underscores must be "+ - "surrounded by digits", it.val) - } - } - if !numPeriodsOK(it.val) { - // As a special case, numbers like '123.' or '1.e2', - // which are valid as far as Go/strconv are concerned, - // must be rejected because TOML says that a fractional - // part consists of '.' followed by 1+ digits. - p.panicf("Invalid float %q: '.' must be followed "+ - "by one or more digits", it.val) - } - val := strings.Replace(it.val, "_", "", -1) - num, err := strconv.ParseFloat(val, 64) - if err != nil { - if e, ok := err.(*strconv.NumError); ok && - e.Err == strconv.ErrRange { - - p.panicf("Float '%s' is out of the range of 64-bit "+ - "IEEE-754 floating-point numbers.", it.val) - } else { - p.panicf("Invalid float value: %q", it.val) - } - } - return num, p.typeOfPrimitive(it) case itemDatetime: - var t time.Time - var ok bool - var err error - for _, format := range []string{ - "2006-01-02T15:04:05Z07:00", - "2006-01-02T15:04:05", - "2006-01-02", - } { - t, err = time.ParseInLocation(format, it.val, time.Local) - if err == nil { - ok = true - break - } - } - if !ok { - p.panicf("Invalid TOML Datetime: %q.", it.val) - } - return t, p.typeOfPrimitive(it) + return p.valueDatetime(it) case itemArray: - array := make([]interface{}, 0) - types := make([]tomlType, 0) - - for it = p.next(); it.typ != itemArrayEnd; it = p.next() { - if it.typ == itemCommentStart { - p.expect(itemText) - continue - } - - val, typ := p.value(it) - array = append(array, val) - types = append(types, typ) - } - return array, p.typeOfArray(types) + return p.valueArray(it) case itemInlineTableStart: - var ( - hash = make(map[string]interface{}) - outerContext = p.context - outerKey = p.currentKey - ) - - p.context = append(p.context, p.currentKey) - p.currentKey = "" - for it := p.next(); it.typ != itemInlineTableEnd; it = p.next() { - if it.typ != itemKeyStart { - p.bug("Expected key start but instead found %q, around line %d", - it.val, p.approxLine) - } - if it.typ == itemCommentStart { - p.expect(itemText) - continue - } - - // retrieve key - k := p.next() - p.approxLine = k.line - kname := p.keyString(k) - - // retrieve value - p.currentKey = kname - val, typ := p.value(p.next()) - // make sure we keep metadata up to date - p.setType(kname, typ) - p.ordered = append(p.ordered, p.context.add(p.currentKey)) - hash[kname] = val - } - p.context = outerContext - p.currentKey = outerKey - return hash, tomlHash + return p.valueInlineTable(it, parentIsArray) + default: + p.bug("Unexpected value type: %s", it.typ) } - p.bug("Unexpected value type: %s", it.typ) panic("unreachable") } +func (p *parser) valueInteger(it item) (interface{}, tomlType) { + if !numUnderscoresOK(it.val) { + p.panicItemf(it, "Invalid integer %q: underscores must be surrounded by digits", it.val) + } + if numHasLeadingZero(it.val) { + p.panicItemf(it, "Invalid integer %q: cannot have leading zeroes", it.val) + } + + num, err := strconv.ParseInt(it.val, 0, 64) + if err != nil { + // Distinguish integer values. Normally, it'd be a bug if the lexer + // provides an invalid integer, but it's possible that the number is + // out of range of valid values (which the lexer cannot determine). + // So mark the former as a bug but the latter as a legitimate user + // error. + if e, ok := err.(*strconv.NumError); ok && e.Err == strconv.ErrRange { + p.panicErr(it, errParseRange{i: it.val, size: "int64"}) + } else { + p.bug("Expected integer value, but got '%s'.", it.val) + } + } + return num, p.typeOfPrimitive(it) +} + +func (p *parser) valueFloat(it item) (interface{}, tomlType) { + parts := strings.FieldsFunc(it.val, func(r rune) bool { + switch r { + case '.', 'e', 'E': + return true + } + return false + }) + for _, part := range parts { + if !numUnderscoresOK(part) { + p.panicItemf(it, "Invalid float %q: underscores must be surrounded by digits", it.val) + } + } + if len(parts) > 0 && numHasLeadingZero(parts[0]) { + p.panicItemf(it, "Invalid float %q: cannot have leading zeroes", it.val) + } + if !numPeriodsOK(it.val) { + // As a special case, numbers like '123.' or '1.e2', + // which are valid as far as Go/strconv are concerned, + // must be rejected because TOML says that a fractional + // part consists of '.' followed by 1+ digits. + p.panicItemf(it, "Invalid float %q: '.' must be followed by one or more digits", it.val) + } + val := strings.Replace(it.val, "_", "", -1) + if val == "+nan" || val == "-nan" { // Go doesn't support this, but TOML spec does. + val = "nan" + } + num, err := strconv.ParseFloat(val, 64) + if err != nil { + if e, ok := err.(*strconv.NumError); ok && e.Err == strconv.ErrRange { + p.panicErr(it, errParseRange{i: it.val, size: "float64"}) + } else { + p.panicItemf(it, "Invalid float value: %q", it.val) + } + } + return num, p.typeOfPrimitive(it) +} + +var dtTypes = []struct { + fmt string + zone *time.Location +}{ + {time.RFC3339Nano, time.Local}, + {"2006-01-02T15:04:05.999999999", internal.LocalDatetime}, + {"2006-01-02", internal.LocalDate}, + {"15:04:05.999999999", internal.LocalTime}, +} + +func (p *parser) valueDatetime(it item) (interface{}, tomlType) { + it.val = datetimeRepl.Replace(it.val) + var ( + t time.Time + ok bool + err error + ) + for _, dt := range dtTypes { + t, err = time.ParseInLocation(dt.fmt, it.val, dt.zone) + if err == nil { + ok = true + break + } + } + if !ok { + p.panicItemf(it, "Invalid TOML Datetime: %q.", it.val) + } + return t, p.typeOfPrimitive(it) +} + +func (p *parser) valueArray(it item) (interface{}, tomlType) { + p.setType(p.currentKey, tomlArray, it.pos) + + var ( + types []tomlType + + // Initialize to a non-nil empty slice. This makes it consistent with + // how S = [] decodes into a non-nil slice inside something like struct + // { S []string }. See #338 + array = []interface{}{} + ) + for it = p.next(); it.typ != itemArrayEnd; it = p.next() { + if it.typ == itemCommentStart { + p.expect(itemText) + continue + } + + val, typ := p.value(it, true) + array = append(array, val) + types = append(types, typ) + + // XXX: types isn't used here, we need it to record the accurate type + // information. + // + // Not entirely sure how to best store this; could use "key[0]", + // "key[1]" notation, or maybe store it on the Array type? + } + return array, tomlArray +} + +func (p *parser) valueInlineTable(it item, parentIsArray bool) (interface{}, tomlType) { + var ( + hash = make(map[string]interface{}) + outerContext = p.context + outerKey = p.currentKey + ) + + p.context = append(p.context, p.currentKey) + prevContext := p.context + p.currentKey = "" + + p.addImplicit(p.context) + p.addContext(p.context, parentIsArray) + + /// Loop over all table key/value pairs. + for it := p.next(); it.typ != itemInlineTableEnd; it = p.next() { + if it.typ == itemCommentStart { + p.expect(itemText) + continue + } + + /// Read all key parts. + k := p.nextPos() + var key Key + for ; k.typ != itemKeyEnd && k.typ != itemEOF; k = p.next() { + key = append(key, p.keyString(k)) + } + p.assertEqual(itemKeyEnd, k.typ) + + /// The current key is the last part. + p.currentKey = key[len(key)-1] + + /// All the other parts (if any) are the context; need to set each part + /// as implicit. + context := key[:len(key)-1] + for i := range context { + p.addImplicitContext(append(p.context, context[i:i+1]...)) + } + + /// Set the value. + val, typ := p.value(p.next(), false) + p.set(p.currentKey, val, typ, it.pos) + p.ordered = append(p.ordered, p.context.add(p.currentKey)) + hash[p.currentKey] = val + + /// Restore context. + p.context = prevContext + } + p.context = outerContext + p.currentKey = outerKey + return hash, tomlHash +} + +// numHasLeadingZero checks if this number has leading zeroes, allowing for '0', +// +/- signs, and base prefixes. +func numHasLeadingZero(s string) bool { + if len(s) > 1 && s[0] == '0' && !(s[1] == 'b' || s[1] == 'o' || s[1] == 'x') { // Allow 0b, 0o, 0x + return true + } + if len(s) > 2 && (s[0] == '-' || s[0] == '+') && s[1] == '0' { + return true + } + return false +} + // numUnderscoresOK checks whether each underscore in s is surrounded by // characters that are not underscores. func numUnderscoresOK(s string) bool { + switch s { + case "nan", "+nan", "-nan", "inf", "-inf", "+inf": + return true + } accept := false for _, r := range s { if r == '_' { if !accept { return false } - accept = false - continue } - accept = true + + // isHexadecimal is a superset of all the permissable characters + // surrounding an underscore. + accept = isHexadecimal(r) } return accept } @@ -338,13 +487,12 @@ func numPeriodsOK(s string) bool { return !period } -// establishContext sets the current context of the parser, -// where the context is either a hash or an array of hashes. Which one is -// set depends on the value of the `array` parameter. +// Set the current context of the parser, where the context is either a hash or +// an array of hashes, depending on the value of the `array` parameter. // // Establishing the context also makes sure that the key isn't a duplicate, and // will create implicit hashes automatically. -func (p *parser) establishContext(key Key, array bool) { +func (p *parser) addContext(key Key, array bool) { var ok bool // Always start at the top level and drill down for our context. @@ -383,7 +531,7 @@ func (p *parser) establishContext(key Key, array bool) { // list of tables for it. k := key[len(key)-1] if _, ok := hashContext[k]; !ok { - hashContext[k] = make([]map[string]interface{}, 0, 5) + hashContext[k] = make([]map[string]interface{}, 0, 4) } // Add a new table. But make sure the key hasn't already been used @@ -391,8 +539,7 @@ func (p *parser) establishContext(key Key, array bool) { if hash, ok := hashContext[k].([]map[string]interface{}); ok { hashContext[k] = append(hash, make(map[string]interface{})) } else { - p.panicf("Key '%s' was already created and cannot be used as "+ - "an array.", keyContext) + p.panicf("Key '%s' was already created and cannot be used as an array.", key) } } else { p.setValue(key[len(key)-1], make(map[string]interface{})) @@ -400,15 +547,23 @@ func (p *parser) establishContext(key Key, array bool) { p.context = append(p.context, key[len(key)-1]) } +// set calls setValue and setType. +func (p *parser) set(key string, val interface{}, typ tomlType, pos Position) { + p.setValue(key, val) + p.setType(key, typ, pos) + +} + // setValue sets the given key to the given value in the current context. // It will make sure that the key hasn't already been defined, account for // implicit key groups. func (p *parser) setValue(key string, value interface{}) { - var tmpHash interface{} - var ok bool - - hash := p.mapping - keyContext := make(Key, 0) + var ( + tmpHash interface{} + ok bool + hash = p.mapping + keyContext Key + ) for _, k := range p.context { keyContext = append(keyContext, k) if tmpHash, ok = hash[k]; !ok { @@ -422,24 +577,26 @@ func (p *parser) setValue(key string, value interface{}) { case map[string]interface{}: hash = t default: - p.bug("Expected hash to have type 'map[string]interface{}', but "+ - "it has '%T' instead.", tmpHash) + p.panicf("Key '%s' has already been defined.", keyContext) } } keyContext = append(keyContext, key) if _, ok := hash[key]; ok { - // Typically, if the given key has already been set, then we have - // to raise an error since duplicate keys are disallowed. However, - // it's possible that a key was previously defined implicitly. In this - // case, it is allowed to be redefined concretely. (See the - // `tests/valid/implicit-and-explicit-after.toml` test in `toml-test`.) + // Normally redefining keys isn't allowed, but the key could have been + // defined implicitly and it's allowed to be redefined concretely. (See + // the `valid/implicit-and-explicit-after.toml` in toml-test) // // But we have to make sure to stop marking it as an implicit. (So that // another redefinition provokes an error.) // // Note that since it has already been defined (as a hash), we don't // want to overwrite it. So our business is done. + if p.isArray(keyContext) { + p.removeImplicit(keyContext) + hash[key] = value + return + } if p.isImplicit(keyContext) { p.removeImplicit(keyContext) return @@ -449,40 +606,39 @@ func (p *parser) setValue(key string, value interface{}) { // key, which is *always* wrong. p.panicf("Key '%s' has already been defined.", keyContext) } + hash[key] = value } -// setType sets the type of a particular value at a given key. -// It should be called immediately AFTER setValue. +// setType sets the type of a particular value at a given key. It should be +// called immediately AFTER setValue. // // Note that if `key` is empty, then the type given will be applied to the // current context (which is either a table or an array of tables). -func (p *parser) setType(key string, typ tomlType) { +func (p *parser) setType(key string, typ tomlType, pos Position) { keyContext := make(Key, 0, len(p.context)+1) - for _, k := range p.context { - keyContext = append(keyContext, k) - } + keyContext = append(keyContext, p.context...) if len(key) > 0 { // allow type setting for hashes keyContext = append(keyContext, key) } - p.types[keyContext.String()] = typ + // Special case to make empty keys ("" = 1) work. + // Without it it will set "" rather than `""`. + // TODO: why is this needed? And why is this only needed here? + if len(keyContext) == 0 { + keyContext = Key{""} + } + p.keyInfo[keyContext.String()] = keyInfo{tomlType: typ, pos: pos} } -// addImplicit sets the given Key as having been created implicitly. -func (p *parser) addImplicit(key Key) { - p.implicits[key.String()] = true -} - -// removeImplicit stops tagging the given key as having been implicitly -// created. -func (p *parser) removeImplicit(key Key) { - p.implicits[key.String()] = false -} - -// isImplicit returns true if the key group pointed to by the key was created -// implicitly. -func (p *parser) isImplicit(key Key) bool { - return p.implicits[key.String()] +// Implicit keys need to be created when tables are implied in "a.b.c.d = 1" and +// "[a.b.c]" (the "a", "b", and "c" hashes are never created explicitly). +func (p *parser) addImplicit(key Key) { p.implicits[key.String()] = struct{}{} } +func (p *parser) removeImplicit(key Key) { delete(p.implicits, key.String()) } +func (p *parser) isImplicit(key Key) bool { _, ok := p.implicits[key.String()]; return ok } +func (p *parser) isArray(key Key) bool { return p.keyInfo[key.String()].tomlType == tomlArray } +func (p *parser) addImplicitContext(key Key) { + p.addImplicit(key) + p.addContext(key, false) } // current returns the full key name of the current context. @@ -497,24 +653,62 @@ func (p *parser) current() string { } func stripFirstNewline(s string) string { - if len(s) == 0 || s[0] != '\n' { + if len(s) > 0 && s[0] == '\n' { + return s[1:] + } + if len(s) > 1 && s[0] == '\r' && s[1] == '\n' { + return s[2:] + } + return s +} + +// Remove newlines inside triple-quoted strings if a line ends with "\". +func (p *parser) stripEscapedNewlines(s string) string { + split := strings.Split(s, "\n") + if len(split) < 1 { return s } - return s[1:] -} -func stripEscapedWhitespace(s string) string { - esc := strings.Split(s, "\\\n") - if len(esc) > 1 { - for i := 1; i < len(esc); i++ { - esc[i] = strings.TrimLeftFunc(esc[i], unicode.IsSpace) + escNL := false // Keep track of the last non-blank line was escaped. + for i, line := range split { + line = strings.TrimRight(line, " \t\r") + + if len(line) == 0 || line[len(line)-1] != '\\' { + split[i] = strings.TrimRight(split[i], "\r") + if !escNL && i != len(split)-1 { + split[i] += "\n" + } + continue + } + + escBS := true + for j := len(line) - 1; j >= 0 && line[j] == '\\'; j-- { + escBS = !escBS + } + if escNL { + line = strings.TrimLeft(line, " \t\r") + } + escNL = !escBS + + if escBS { + split[i] += "\n" + continue + } + + if i == len(split)-1 { + p.panicf("invalid escape: '\\ '") + } + + split[i] = line[:len(line)-1] // Remove \ + if len(split)-1 > i { + split[i+1] = strings.TrimLeft(split[i+1], " \t\r") } } - return strings.Join(esc, "") + return strings.Join(split, "") } -func (p *parser) replaceEscapes(str string) string { - var replaced []rune +func (p *parser) replaceEscapes(it item, str string) string { + replaced := make([]rune, 0, len(str)) s := []byte(str) r := 0 for r < len(s) { @@ -532,7 +726,8 @@ func (p *parser) replaceEscapes(str string) string { switch s[r] { default: p.bug("Expected valid escape code after \\, but got %q.", s[r]) - return "" + case ' ', '\t': + p.panicItemf(it, "invalid escape: '\\%c'", s[r]) case 'b': replaced = append(replaced, rune(0x0008)) r += 1 @@ -558,14 +753,14 @@ func (p *parser) replaceEscapes(str string) string { // At this point, we know we have a Unicode escape of the form // `uXXXX` at [r, r+5). (Because the lexer guarantees this // for us.) - escaped := p.asciiEscapeToUnicode(s[r+1 : r+5]) + escaped := p.asciiEscapeToUnicode(it, s[r+1:r+5]) replaced = append(replaced, escaped) r += 5 case 'U': // At this point, we know we have a Unicode escape of the form // `uXXXX` at [r, r+9). (Because the lexer guarantees this // for us.) - escaped := p.asciiEscapeToUnicode(s[r+1 : r+9]) + escaped := p.asciiEscapeToUnicode(it, s[r+1:r+9]) replaced = append(replaced, escaped) r += 9 } @@ -573,20 +768,14 @@ func (p *parser) replaceEscapes(str string) string { return string(replaced) } -func (p *parser) asciiEscapeToUnicode(bs []byte) rune { +func (p *parser) asciiEscapeToUnicode(it item, bs []byte) rune { s := string(bs) hex, err := strconv.ParseUint(strings.ToLower(s), 16, 32) if err != nil { - p.bug("Could not parse '%s' as a hexadecimal number, but the "+ - "lexer claims it's OK: %s", s, err) + p.bug("Could not parse '%s' as a hexadecimal number, but the lexer claims it's OK: %s", s, err) } if !utf8.ValidRune(rune(hex)) { - p.panicf("Escaped character '\\u%s' is not valid UTF-8.", s) + p.panicItemf(it, "Escaped character '\\u%s' is not valid UTF-8.", s) } return rune(hex) } - -func isStringType(ty itemType) bool { - return ty == itemString || ty == itemMultilineString || - ty == itemRawString || ty == itemRawMultilineString -} diff --git a/vendor/github.com/BurntSushi/toml/session.vim b/vendor/github.com/BurntSushi/toml/session.vim deleted file mode 100644 index 562164be..00000000 --- a/vendor/github.com/BurntSushi/toml/session.vim +++ /dev/null @@ -1 +0,0 @@ -au BufWritePost *.go silent!make tags > /dev/null 2>&1 diff --git a/vendor/github.com/BurntSushi/toml/type_fields.go b/vendor/github.com/BurntSushi/toml/type_fields.go index 608997c2..254ca82e 100644 --- a/vendor/github.com/BurntSushi/toml/type_fields.go +++ b/vendor/github.com/BurntSushi/toml/type_fields.go @@ -70,8 +70,8 @@ func typeFields(t reflect.Type) []field { next := []field{{typ: t}} // Count of queued names for current level and the next. - count := map[reflect.Type]int{} - nextCount := map[reflect.Type]int{} + var count map[reflect.Type]int + var nextCount map[reflect.Type]int // Types already visited at an earlier level. visited := map[reflect.Type]bool{} diff --git a/vendor/github.com/BurntSushi/toml/type_check.go b/vendor/github.com/BurntSushi/toml/type_toml.go similarity index 75% rename from vendor/github.com/BurntSushi/toml/type_check.go rename to vendor/github.com/BurntSushi/toml/type_toml.go index c73f8afc..4e90d773 100644 --- a/vendor/github.com/BurntSushi/toml/type_check.go +++ b/vendor/github.com/BurntSushi/toml/type_toml.go @@ -16,7 +16,7 @@ func typeEqual(t1, t2 tomlType) bool { return t1.typeString() == t2.typeString() } -func typeIsHash(t tomlType) bool { +func typeIsTable(t tomlType) bool { return typeEqual(t, tomlHash) || typeEqual(t, tomlArrayHash) } @@ -68,24 +68,3 @@ func (p *parser) typeOfPrimitive(lexItem item) tomlType { p.bug("Cannot infer primitive type of lex item '%s'.", lexItem) panic("unreachable") } - -// typeOfArray returns a tomlType for an array given a list of types of its -// values. -// -// In the current spec, if an array is homogeneous, then its type is always -// "Array". If the array is not homogeneous, an error is generated. -func (p *parser) typeOfArray(types []tomlType) tomlType { - // Empty arrays are cool. - if len(types) == 0 { - return tomlArray - } - - theType := types[0] - for _, t := range types[1:] { - if !typeEqual(theType, t) { - p.panicf("Array contains values of type '%s' and '%s', but "+ - "arrays must be homogeneous.", theType, t) - } - } - return tomlArray -} diff --git a/vendor/github.com/certifi/gocertifi/.travis.yml b/vendor/github.com/certifi/gocertifi/.travis.yml deleted file mode 100644 index c41119d5..00000000 --- a/vendor/github.com/certifi/gocertifi/.travis.yml +++ /dev/null @@ -1,13 +0,0 @@ ---- -language: go -go: -- tip -- 1.12.x -- 1.11.x -- 1.10.x -- 1.9.x -- 1.8.x -sudo: false - -# Forks will use that path for checkout -go_import_path: github.com/certifi/gocertifi diff --git a/vendor/github.com/certifi/gocertifi/README.md b/vendor/github.com/certifi/gocertifi/README.md index b392d353..9c860301 100644 --- a/vendor/github.com/certifi/gocertifi/README.md +++ b/vendor/github.com/certifi/gocertifi/README.md @@ -23,23 +23,23 @@ You can use the returned `*x509.CertPool` as part of an HTTP transport, for exam ```go import ( - "net/http" - "crypto/tls" + "net/http" + "crypto/tls" ) // Setup an HTTP client with a custom transport transport := &http.Transport{ - Proxy: ProxyFromEnvironment, - DialContext: (&net.Dialer{ - Timeout: 30 * time.Second, - KeepAlive: 30 * time.Second, - DualStack: true, - }).DialContext, - ForceAttemptHTTP2: true, - MaxIdleConns: 100, - IdleConnTimeout: 90 * time.Second, - TLSHandshakeTimeout: 10 * time.Second, - ExpectContinueTimeout: 1 * time.Second, + Proxy: ProxyFromEnvironment, + DialContext: (&net.Dialer{ + Timeout: 30 * time.Second, + KeepAlive: 30 * time.Second, + DualStack: true, + }).DialContext, + ForceAttemptHTTP2: true, + MaxIdleConns: 100, + IdleConnTimeout: 90 * time.Second, + TLSHandshakeTimeout: 10 * time.Second, + ExpectContinueTimeout: 1 * time.Second, } // or, starting with go1.13 simply use: // transport := http.DefaultTransport.(*http.Transport).Clone() @@ -59,16 +59,11 @@ Import as follows: import "github.com/certifi/gocertifi" ``` -### Errors - -```go -var ErrParseFailed = errors.New("gocertifi: error when parsing certificates") -``` - ### Functions ```go func CACerts() (*x509.CertPool, error) ``` CACerts builds an X.509 certificate pool containing the Mozilla CA Certificate -bundle. Returns nil on error along with an appropriate error code. +bundle. This can't actually error and always returns successfully with `nil` +as the error. This will be replaced in `v2` to only return the `CertPool`. diff --git a/vendor/github.com/certifi/gocertifi/certifi.go b/vendor/github.com/certifi/gocertifi/certifi.go index a43244aa..70be286d 100644 --- a/vendor/github.com/certifi/gocertifi/certifi.go +++ b/vendor/github.com/certifi/gocertifi/certifi.go @@ -1,7 +1,11 @@ // Code generated by go generate; DO NOT EDIT. -// 2020-02-11 10:00:50.717122 -0800 PST m=+0.664468880 +// 2021-05-07 14:14:36.874796853 -0700 PDT m=+0.476299993 // https://mkcert.org/generate/ +/* This Source Code Form is subject to the terms of the Mozilla Public + * License, v. 2.0. If a copy of the MPL was not distributed with this + * file, You can obtain one at https://mozilla.org/MPL/2.0/. */ + package gocertifi //go:generate go run gen.go "https://mkcert.org/generate/" @@ -9,14 +13,6 @@ package gocertifi import "crypto/x509" const pemcerts string = ` - -# Issuer: CN=GlobalSign Root CA O=GlobalSign nv-sa OU=Root CA -# Subject: CN=GlobalSign Root CA O=GlobalSign nv-sa OU=Root CA -# Label: "GlobalSign Root CA" -# Serial: 4835703278459707669005204 -# MD5 Fingerprint: 3e:45:52:15:09:51:92:e1:b7:5d:37:9f:b1:87:29:8a -# SHA1 Fingerprint: b1:bc:96:8b:d4:f4:9d:62:2a:a8:9a:81:f2:15:01:52:a4:1d:82:9c -# SHA256 Fingerprint: eb:d4:10:40:e4:bb:3e:c7:42:c9:e3:81:d3:1e:f2:a4:1a:48:b6:68:5c:96:e7:ce:f3:c1:df:6c:d4:33:1c:99 -----BEGIN CERTIFICATE----- MIIDdTCCAl2gAwIBAgILBAAAAAABFUtaw5QwDQYJKoZIhvcNAQEFBQAwVzELMAkG A1UEBhMCQkUxGTAXBgNVBAoTEEdsb2JhbFNpZ24gbnYtc2ExEDAOBgNVBAsTB1Jv @@ -38,14 +34,6 @@ AbEVtQwdpf5pLGkkeB6zpxxxYu7KyJesF12KwvhHhm4qxFYxldBniYUr+WymXUad DKqC5JlR3XC321Y9YeRq4VzW9v493kHMB65jUr9TU/Qr6cf9tveCX4XSQRjbgbME HMUfpIBvFSDJ3gyICh3WZlXi/EjJKSZp4A== -----END CERTIFICATE----- - -# Issuer: CN=GlobalSign O=GlobalSign OU=GlobalSign Root CA - R2 -# Subject: CN=GlobalSign O=GlobalSign OU=GlobalSign Root CA - R2 -# Label: "GlobalSign Root CA - R2" -# Serial: 4835703278459682885658125 -# MD5 Fingerprint: 94:14:77:7e:3e:5e:fd:8f:30:bd:41:b0:cf:e7:d0:30 -# SHA1 Fingerprint: 75:e0:ab:b6:13:85:12:27:1c:04:f8:5f:dd:de:38:e4:b7:24:2e:fe -# SHA256 Fingerprint: ca:42:dd:41:74:5f:d0:b8:1e:b9:02:36:2c:f9:d8:bf:71:9d:a1:bd:1b:1e:fc:94:6f:5b:4c:99:f4:2c:1b:9e -----BEGIN CERTIFICATE----- MIIDujCCAqKgAwIBAgILBAAAAAABD4Ym5g0wDQYJKoZIhvcNAQEFBQAwTDEgMB4G A1UECxMXR2xvYmFsU2lnbiBSb290IENBIC0gUjIxEzARBgNVBAoTCkdsb2JhbFNp @@ -68,46 +56,6 @@ ot+3i9DAgBkcRcAtjOj4LaR0VknFBbVPFd5uRHg5h6h+u/N5GJG79G+dwfCMNYxd AfvDbbnvRG15RjF+Cv6pgsH/76tuIMRQyV+dTZsXjAzlAcmgQWpzU/qlULRuJQ/7 TBj0/VLZjmmx6BEP3ojY+x1J96relc8geMJgEtslQIxq/H5COEBkEveegeGTLg== -----END CERTIFICATE----- - -# Issuer: CN=VeriSign Class 3 Public Primary Certification Authority - G3 O=VeriSign, Inc. OU=VeriSign Trust Network/(c) 1999 VeriSign, Inc. - For authorized use only -# Subject: CN=VeriSign Class 3 Public Primary Certification Authority - G3 O=VeriSign, Inc. OU=VeriSign Trust Network/(c) 1999 VeriSign, Inc. - For authorized use only -# Label: "Verisign Class 3 Public Primary Certification Authority - G3" -# Serial: 206684696279472310254277870180966723415 -# MD5 Fingerprint: cd:68:b6:a7:c7:c4:ce:75:e0:1d:4f:57:44:61:92:09 -# SHA1 Fingerprint: 13:2d:0d:45:53:4b:69:97:cd:b2:d5:c3:39:e2:55:76:60:9b:5c:c6 -# SHA256 Fingerprint: eb:04:cf:5e:b1:f3:9a:fa:76:2f:2b:b1:20:f2:96:cb:a5:20:c1:b9:7d:b1:58:95:65:b8:1c:b9:a1:7b:72:44 ------BEGIN CERTIFICATE----- -MIIEGjCCAwICEQCbfgZJoz5iudXukEhxKe9XMA0GCSqGSIb3DQEBBQUAMIHKMQsw -CQYDVQQGEwJVUzEXMBUGA1UEChMOVmVyaVNpZ24sIEluYy4xHzAdBgNVBAsTFlZl -cmlTaWduIFRydXN0IE5ldHdvcmsxOjA4BgNVBAsTMShjKSAxOTk5IFZlcmlTaWdu -LCBJbmMuIC0gRm9yIGF1dGhvcml6ZWQgdXNlIG9ubHkxRTBDBgNVBAMTPFZlcmlT -aWduIENsYXNzIDMgUHVibGljIFByaW1hcnkgQ2VydGlmaWNhdGlvbiBBdXRob3Jp -dHkgLSBHMzAeFw05OTEwMDEwMDAwMDBaFw0zNjA3MTYyMzU5NTlaMIHKMQswCQYD -VQQGEwJVUzEXMBUGA1UEChMOVmVyaVNpZ24sIEluYy4xHzAdBgNVBAsTFlZlcmlT -aWduIFRydXN0IE5ldHdvcmsxOjA4BgNVBAsTMShjKSAxOTk5IFZlcmlTaWduLCBJ -bmMuIC0gRm9yIGF1dGhvcml6ZWQgdXNlIG9ubHkxRTBDBgNVBAMTPFZlcmlTaWdu -IENsYXNzIDMgUHVibGljIFByaW1hcnkgQ2VydGlmaWNhdGlvbiBBdXRob3JpdHkg -LSBHMzCCASIwDQYJKoZIhvcNAQEBBQADggEPADCCAQoCggEBAMu6nFL8eB8aHm8b -N3O9+MlrlBIwT/A2R/XQkQr1F8ilYcEWQE37imGQ5XYgwREGfassbqb1EUGO+i2t -KmFZpGcmTNDovFJbcCAEWNF6yaRpvIMXZK0Fi7zQWM6NjPXr8EJJC52XJ2cybuGu -kxUccLwgTS8Y3pKI6GyFVxEa6X7jJhFUokWWVYPKMIno3Nij7SqAP395ZVc+FSBm -CC+Vk7+qRy+oRpfwEuL+wgorUeZ25rdGt+INpsyow0xZVYnm6FNcHOqd8GIWC6fJ -Xwzw3sJ2zq/3avL6QaaiMxTJ5Xpj055iN9WFZZ4O5lMkdBteHRJTW8cs54NJOxWu -imi5V5cCAwEAATANBgkqhkiG9w0BAQUFAAOCAQEAERSWwauSCPc/L8my/uRan2Te -2yFPhpk0djZX3dAVL8WtfxUfN2JzPtTnX84XA9s1+ivbrmAJXx5fj267Cz3qWhMe -DGBvtcC1IyIuBwvLqXTLR7sdwdela8wv0kL9Sd2nic9TutoAWii/gt/4uhMdUIaC -/Y4wjylGsB49Ndo4YhYYSq3mtlFs3q9i6wHQHiT+eo8SGhJouPtmmRQURVyu565p -F4ErWjfJXir0xuKhXFSbplQAz/DxwceYMBo7Nhbbo27q/a2ywtrvAkcTisDxszGt -TxzhT5yvDwyd93gN2PQ1VoDat20Xj50egWTh/sVFuq1ruQp6Tk9LhO5L8X3dEQ== ------END CERTIFICATE----- - -# Issuer: CN=Entrust.net Certification Authority (2048) O=Entrust.net OU=www.entrust.net/CPS_2048 incorp. by ref. (limits liab.)/(c) 1999 Entrust.net Limited -# Subject: CN=Entrust.net Certification Authority (2048) O=Entrust.net OU=www.entrust.net/CPS_2048 incorp. by ref. (limits liab.)/(c) 1999 Entrust.net Limited -# Label: "Entrust.net Premium 2048 Secure Server CA" -# Serial: 946069240 -# MD5 Fingerprint: ee:29:31:bc:32:7e:9a:e6:e8:b5:f7:51:b4:34:71:90 -# SHA1 Fingerprint: 50:30:06:09:1d:97:d4:f5:ae:39:f7:cb:e7:92:7d:7d:65:2d:34:31 -# SHA256 Fingerprint: 6d:c4:71:72:e0:1c:bc:b0:bf:62:58:0d:89:5f:e2:b8:ac:9a:d4:f8:73:80:1e:0c:10:b9:c8:37:d2:1e:b1:77 -----BEGIN CERTIFICATE----- MIIEKjCCAxKgAwIBAgIEOGPe+DANBgkqhkiG9w0BAQUFADCBtDEUMBIGA1UEChML RW50cnVzdC5uZXQxQDA+BgNVBAsUN3d3dy5lbnRydXN0Lm5ldC9DUFNfMjA0OCBp @@ -133,14 +81,6 @@ u/8j72gZyxKTJ1wDLW8w0B62GqzeWvfRqqgnpv55gcR5mTNXuhKwqeBCbJPKVt7+ bYQLCIt+jerXmCHG8+c8eS9enNFMFY3h7CI3zJpDC5fcgJCNs2ebb0gIFVbPv/Er fF6adulZkMV8gzURZVE= -----END CERTIFICATE----- - -# Issuer: CN=Baltimore CyberTrust Root O=Baltimore OU=CyberTrust -# Subject: CN=Baltimore CyberTrust Root O=Baltimore OU=CyberTrust -# Label: "Baltimore CyberTrust Root" -# Serial: 33554617 -# MD5 Fingerprint: ac:b6:94:a5:9c:17:e0:d7:91:52:9b:b1:97:06:a6:e4 -# SHA1 Fingerprint: d4:de:20:d0:5e:66:fc:53:fe:1a:50:88:2c:78:db:28:52:ca:e4:74 -# SHA256 Fingerprint: 16:af:57:a9:f6:76:b0:ab:12:60:95:aa:5e:ba:de:f2:2a:b3:11:19:d6:44:ac:95:cd:4b:93:db:f3:f2:6a:eb -----BEGIN CERTIFICATE----- MIIDdzCCAl+gAwIBAgIEAgAAuTANBgkqhkiG9w0BAQUFADBaMQswCQYDVQQGEwJJ RTESMBAGA1UEChMJQmFsdGltb3JlMRMwEQYDVQQLEwpDeWJlclRydXN0MSIwIAYD @@ -162,47 +102,6 @@ Epn3o0WC4zxe9Z2etciefC7IpJ5OCBRLbf1wbWsaY71k5h+3zvDyny67G7fyUIhz ksLi4xaNmjICq44Y3ekQEe5+NauQrz4wlHrQMz2nZQ/1/I6eYs9HRCwBXbsdtTLS R9I4LtD+gdwyah617jzV/OeBHRnDJELqYzmp -----END CERTIFICATE----- - -# Issuer: CN=AddTrust External CA Root O=AddTrust AB OU=AddTrust External TTP Network -# Subject: CN=AddTrust External CA Root O=AddTrust AB OU=AddTrust External TTP Network -# Label: "AddTrust External Root" -# Serial: 1 -# MD5 Fingerprint: 1d:35:54:04:85:78:b0:3f:42:42:4d:bf:20:73:0a:3f -# SHA1 Fingerprint: 02:fa:f3:e2:91:43:54:68:60:78:57:69:4d:f5:e4:5b:68:85:18:68 -# SHA256 Fingerprint: 68:7f:a4:51:38:22:78:ff:f0:c8:b1:1f:8d:43:d5:76:67:1c:6e:b2:bc:ea:b4:13:fb:83:d9:65:d0:6d:2f:f2 ------BEGIN CERTIFICATE----- -MIIENjCCAx6gAwIBAgIBATANBgkqhkiG9w0BAQUFADBvMQswCQYDVQQGEwJTRTEU -MBIGA1UEChMLQWRkVHJ1c3QgQUIxJjAkBgNVBAsTHUFkZFRydXN0IEV4dGVybmFs -IFRUUCBOZXR3b3JrMSIwIAYDVQQDExlBZGRUcnVzdCBFeHRlcm5hbCBDQSBSb290 -MB4XDTAwMDUzMDEwNDgzOFoXDTIwMDUzMDEwNDgzOFowbzELMAkGA1UEBhMCU0Ux -FDASBgNVBAoTC0FkZFRydXN0IEFCMSYwJAYDVQQLEx1BZGRUcnVzdCBFeHRlcm5h -bCBUVFAgTmV0d29yazEiMCAGA1UEAxMZQWRkVHJ1c3QgRXh0ZXJuYWwgQ0EgUm9v -dDCCASIwDQYJKoZIhvcNAQEBBQADggEPADCCAQoCggEBALf3GjPm8gAELTngTlvt -H7xsD821+iO2zt6bETOXpClMfZOfvUq8k+0DGuOPz+VtUFrWlymUWoCwSXrbLpX9 -uMq/NzgtHj6RQa1wVsfwTz/oMp50ysiQVOnGXw94nZpAPA6sYapeFI+eh6FqUNzX -mk6vBbOmcZSccbNQYArHE504B4YCqOmoaSYYkKtMsE8jqzpPhNjfzp/haW+710LX -a0Tkx63ubUFfclpxCDezeWWkWaCUN/cALw3CknLa0Dhy2xSoRcRdKn23tNbE7qzN -E0S3ySvdQwAl+mG5aWpYIxG3pzOPVnVZ9c0p10a3CitlttNCbxWyuHv77+ldU9U0 -WicCAwEAAaOB3DCB2TAdBgNVHQ4EFgQUrb2YejS0Jvf6xCZU7wO94CTLVBowCwYD -VR0PBAQDAgEGMA8GA1UdEwEB/wQFMAMBAf8wgZkGA1UdIwSBkTCBjoAUrb2YejS0 -Jvf6xCZU7wO94CTLVBqhc6RxMG8xCzAJBgNVBAYTAlNFMRQwEgYDVQQKEwtBZGRU -cnVzdCBBQjEmMCQGA1UECxMdQWRkVHJ1c3QgRXh0ZXJuYWwgVFRQIE5ldHdvcmsx -IjAgBgNVBAMTGUFkZFRydXN0IEV4dGVybmFsIENBIFJvb3SCAQEwDQYJKoZIhvcN -AQEFBQADggEBALCb4IUlwtYj4g+WBpKdQZic2YR5gdkeWxQHIzZlj7DYd7usQWxH -YINRsPkyPef89iYTx4AWpb9a/IfPeHmJIZriTAcKhjW88t5RxNKWt9x+Tu5w/Rw5 -6wwCURQtjr0W4MHfRnXnJK3s9EK0hZNwEGe6nQY1ShjTK3rMUUKhemPR5ruhxSvC -Nr4TDea9Y355e6cJDUCrat2PisP29owaQgVR1EX1n6diIWgVIEM8med8vSTYqZEX -c4g/VhsxOBi0cQ+azcgOno4uG+GMmIPLHzHxREzGBHNJdmAPx/i9F4BrLunMTA5a -mnkPIAou1Z5jJh5VkpTYghdae9C8x49OhgQ= ------END CERTIFICATE----- - -# Issuer: CN=Entrust Root Certification Authority O=Entrust, Inc. OU=www.entrust.net/CPS is incorporated by reference/(c) 2006 Entrust, Inc. -# Subject: CN=Entrust Root Certification Authority O=Entrust, Inc. OU=www.entrust.net/CPS is incorporated by reference/(c) 2006 Entrust, Inc. -# Label: "Entrust Root Certification Authority" -# Serial: 1164660820 -# MD5 Fingerprint: d6:a5:c3:ed:5d:dd:3e:00:c1:3d:87:92:1f:1d:3f:e4 -# SHA1 Fingerprint: b3:1e:b1:b7:40:e3:6c:84:02:da:dc:37:d4:4d:f5:d4:67:49:52:f9 -# SHA256 Fingerprint: 73:c1:76:43:4f:1b:c6:d5:ad:f4:5b:0e:76:e7:27:28:7c:8d:e5:76:16:c1:e6:e6:14:1a:2b:2c:bc:7d:8e:4c -----BEGIN CERTIFICATE----- MIIEkTCCA3mgAwIBAgIERWtQVDANBgkqhkiG9w0BAQUFADCBsDELMAkGA1UEBhMC VVMxFjAUBgNVBAoTDUVudHJ1c3QsIEluYy4xOTA3BgNVBAsTMHd3dy5lbnRydXN0 @@ -230,120 +129,6 @@ AGAT/3B+XxFNSRuzFVJ7yVTav52Vr2ua2J7p8eRDjeIRRDq/r72DQnNSi6q7pynP eu6FSqdQgPCnXEqULl8FmTxSQeDNtGPPAUO6nIPcj2A781q0tHuu2guQOHXvgR1m 0vdXcDazv/wor3ElhVsT/h5/WrQ8 -----END CERTIFICATE----- - -# Issuer: CN=GeoTrust Global CA O=GeoTrust Inc. -# Subject: CN=GeoTrust Global CA O=GeoTrust Inc. -# Label: "GeoTrust Global CA" -# Serial: 144470 -# MD5 Fingerprint: f7:75:ab:29:fb:51:4e:b7:77:5e:ff:05:3c:99:8e:f5 -# SHA1 Fingerprint: de:28:f4:a4:ff:e5:b9:2f:a3:c5:03:d1:a3:49:a7:f9:96:2a:82:12 -# SHA256 Fingerprint: ff:85:6a:2d:25:1d:cd:88:d3:66:56:f4:50:12:67:98:cf:ab:aa:de:40:79:9c:72:2d:e4:d2:b5:db:36:a7:3a ------BEGIN CERTIFICATE----- -MIIDVDCCAjygAwIBAgIDAjRWMA0GCSqGSIb3DQEBBQUAMEIxCzAJBgNVBAYTAlVT -MRYwFAYDVQQKEw1HZW9UcnVzdCBJbmMuMRswGQYDVQQDExJHZW9UcnVzdCBHbG9i -YWwgQ0EwHhcNMDIwNTIxMDQwMDAwWhcNMjIwNTIxMDQwMDAwWjBCMQswCQYDVQQG -EwJVUzEWMBQGA1UEChMNR2VvVHJ1c3QgSW5jLjEbMBkGA1UEAxMSR2VvVHJ1c3Qg -R2xvYmFsIENBMIIBIjANBgkqhkiG9w0BAQEFAAOCAQ8AMIIBCgKCAQEA2swYYzD9 -9BcjGlZ+W988bDjkcbd4kdS8odhM+KhDtgPpTSEHCIjaWC9mOSm9BXiLnTjoBbdq -fnGk5sRgprDvgOSJKA+eJdbtg/OtppHHmMlCGDUUna2YRpIuT8rxh0PBFpVXLVDv -iS2Aelet8u5fa9IAjbkU+BQVNdnARqN7csiRv8lVK83Qlz6cJmTM386DGXHKTubU -1XupGc1V3sjs0l44U+VcT4wt/lAjNvxm5suOpDkZALeVAjmRCw7+OC7RHQWa9k0+ -bw8HHa8sHo9gOeL6NlMTOdReJivbPagUvTLrGAMoUgRx5aszPeE4uwc2hGKceeoW -MPRfwCvocWvk+QIDAQABo1MwUTAPBgNVHRMBAf8EBTADAQH/MB0GA1UdDgQWBBTA -ephojYn7qwVkDBF9qn1luMrMTjAfBgNVHSMEGDAWgBTAephojYn7qwVkDBF9qn1l -uMrMTjANBgkqhkiG9w0BAQUFAAOCAQEANeMpauUvXVSOKVCUn5kaFOSPeCpilKIn -Z57QzxpeR+nBsqTP3UEaBU6bS+5Kb1VSsyShNwrrZHYqLizz/Tt1kL/6cdjHPTfS -tQWVYrmm3ok9Nns4d0iXrKYgjy6myQzCsplFAMfOEVEiIuCl6rYVSAlk6l5PdPcF -PseKUgzbFbS9bZvlxrFUaKnjaZC2mqUPuLk/IH2uSrW4nOQdtqvmlKXBx4Ot2/Un -hw4EbNX/3aBd7YdStysVAq45pmp06drE57xNNB6pXE0zX5IJL4hmXXeXxx12E6nV -5fEWCRE11azbJHFwLJhWC9kXtNHjUStedejV0NxPNO3CBWaAocvmMw== ------END CERTIFICATE----- - -# Issuer: CN=GeoTrust Universal CA O=GeoTrust Inc. -# Subject: CN=GeoTrust Universal CA O=GeoTrust Inc. -# Label: "GeoTrust Universal CA" -# Serial: 1 -# MD5 Fingerprint: 92:65:58:8b:a2:1a:31:72:73:68:5c:b4:a5:7a:07:48 -# SHA1 Fingerprint: e6:21:f3:35:43:79:05:9a:4b:68:30:9d:8a:2f:74:22:15:87:ec:79 -# SHA256 Fingerprint: a0:45:9b:9f:63:b2:25:59:f5:fa:5d:4c:6d:b3:f9:f7:2f:f1:93:42:03:35:78:f0:73:bf:1d:1b:46:cb:b9:12 ------BEGIN CERTIFICATE----- -MIIFaDCCA1CgAwIBAgIBATANBgkqhkiG9w0BAQUFADBFMQswCQYDVQQGEwJVUzEW -MBQGA1UEChMNR2VvVHJ1c3QgSW5jLjEeMBwGA1UEAxMVR2VvVHJ1c3QgVW5pdmVy -c2FsIENBMB4XDTA0MDMwNDA1MDAwMFoXDTI5MDMwNDA1MDAwMFowRTELMAkGA1UE -BhMCVVMxFjAUBgNVBAoTDUdlb1RydXN0IEluYy4xHjAcBgNVBAMTFUdlb1RydXN0 -IFVuaXZlcnNhbCBDQTCCAiIwDQYJKoZIhvcNAQEBBQADggIPADCCAgoCggIBAKYV -VaCjxuAfjJ0hUNfBvitbtaSeodlyWL0AG0y/YckUHUWCq8YdgNY96xCcOq9tJPi8 -cQGeBvV8Xx7BDlXKg5pZMK4ZyzBIle0iN430SppyZj6tlcDgFgDgEB8rMQ7XlFTT -QjOgNB0eRXbdT8oYN+yFFXoZCPzVx5zw8qkuEKmS5j1YPakWaDwvdSEYfyh3peFh -F7em6fgemdtzbvQKoiFs7tqqhZJmr/Z6a4LauiIINQ/PQvE1+mrufislzDoR5G2v -c7J2Ha3QsnhnGqQ5HFELZ1aD/ThdDc7d8Lsrlh/eezJS/R27tQahsiFepdaVaH/w -mZ7cRQg+59IJDTWU3YBOU5fXtQlEIGQWFwMCTFMNaN7VqnJNk22CDtucvc+081xd -VHppCZbW2xHBjXWotM85yM48vCR85mLK4b19p71XZQvk/iXttmkQ3CgaRr0BHdCX -teGYO8A3ZNY9lO4L4fUorgtWv3GLIylBjobFS1J72HGrH4oVpjuDWtdYAVHGTEHZ -f9hBZ3KiKN9gg6meyHv8U3NyWfWTehd2Ds735VzZC1U0oqpbtWpU5xPKV+yXbfRe -Bi9Fi1jUIxaS5BZuKGNZMN9QAZxjiRqf2xeUgnA3wySemkfWWspOqGmJch+RbNt+ -nhutxx9z3SxPGWX9f5NAEC7S8O08ni4oPmkmM8V7AgMBAAGjYzBhMA8GA1UdEwEB -/wQFMAMBAf8wHQYDVR0OBBYEFNq7LqqwDLiIJlF0XG0D08DYj3rWMB8GA1UdIwQY -MBaAFNq7LqqwDLiIJlF0XG0D08DYj3rWMA4GA1UdDwEB/wQEAwIBhjANBgkqhkiG -9w0BAQUFAAOCAgEAMXjmx7XfuJRAyXHEqDXsRh3ChfMoWIawC/yOsjmPRFWrZIRc -aanQmjg8+uUfNeVE44B5lGiku8SfPeE0zTBGi1QrlaXv9z+ZhP015s8xxtxqv6fX -IwjhmF7DWgh2qaavdy+3YL1ERmrvl/9zlcGO6JP7/TG37FcREUWbMPEaiDnBTzyn -ANXH/KttgCJwpQzgXQQpAvvLoJHRfNbDflDVnVi+QTjruXU8FdmbyUqDWcDaU/0z -uzYYm4UPFd3uLax2k7nZAY1IEKj79TiG8dsKxr2EoyNB3tZ3b4XUhRxQ4K5RirqN -Pnbiucon8l+f725ZDQbYKxek0nxru18UGkiPGkzns0ccjkxFKyDuSN/n3QmOGKja -QI2SJhFTYXNd673nxE0pN2HrrDktZy4W1vUAg4WhzH92xH3kt0tm7wNFYGm2DFKW -koRepqO1pD4r2czYG0eq8kTaT/kD6PAUyz/zg97QwVTjt+gKN02LIFkDMBmhLMi9 -ER/frslKxfMnZmaGrGiR/9nmUxwPi1xpZQomyB40w11Re9epnAahNt3ViZS82eQt -DF4JbAiXfKM9fJP/P6EUp8+1Xevb2xzEdt+Iub1FBZUbrvxGakyvSOPOrg/Sfuvm -bJxPgWp6ZKy7PtXny3YuxadIwVyQD8vIP/rmMuGNG2+k5o7Y+SlIis5z/iw= ------END CERTIFICATE----- - -# Issuer: CN=GeoTrust Universal CA 2 O=GeoTrust Inc. -# Subject: CN=GeoTrust Universal CA 2 O=GeoTrust Inc. -# Label: "GeoTrust Universal CA 2" -# Serial: 1 -# MD5 Fingerprint: 34:fc:b8:d0:36:db:9e:14:b3:c2:f2:db:8f:e4:94:c7 -# SHA1 Fingerprint: 37:9a:19:7b:41:85:45:35:0c:a6:03:69:f3:3c:2e:af:47:4f:20:79 -# SHA256 Fingerprint: a0:23:4f:3b:c8:52:7c:a5:62:8e:ec:81:ad:5d:69:89:5d:a5:68:0d:c9:1d:1c:b8:47:7f:33:f8:78:b9:5b:0b ------BEGIN CERTIFICATE----- -MIIFbDCCA1SgAwIBAgIBATANBgkqhkiG9w0BAQUFADBHMQswCQYDVQQGEwJVUzEW -MBQGA1UEChMNR2VvVHJ1c3QgSW5jLjEgMB4GA1UEAxMXR2VvVHJ1c3QgVW5pdmVy -c2FsIENBIDIwHhcNMDQwMzA0MDUwMDAwWhcNMjkwMzA0MDUwMDAwWjBHMQswCQYD -VQQGEwJVUzEWMBQGA1UEChMNR2VvVHJ1c3QgSW5jLjEgMB4GA1UEAxMXR2VvVHJ1 -c3QgVW5pdmVyc2FsIENBIDIwggIiMA0GCSqGSIb3DQEBAQUAA4ICDwAwggIKAoIC -AQCzVFLByT7y2dyxUxpZKeexw0Uo5dfR7cXFS6GqdHtXr0om/Nj1XqduGdt0DE81 -WzILAePb63p3NeqqWuDW6KFXlPCQo3RWlEQwAx5cTiuFJnSCegx2oG9NzkEtoBUG -FF+3Qs17j1hhNNwqCPkuwwGmIkQcTAeC5lvO0Ep8BNMZcyfwqph/Lq9O64ceJHdq -XbboW0W63MOhBW9Wjo8QJqVJwy7XQYci4E+GymC16qFjwAGXEHm9ADwSbSsVsaxL -se4YuU6W3Nx2/zu+z18DwPw76L5GG//aQMJS9/7jOvdqdzXQ2o3rXhhqMcceujwb -KNZrVMaqW9eiLBsZzKIC9ptZvTdrhrVtgrrY6slWvKk2WP0+GfPtDCapkzj4T8Fd -IgbQl+rhrcZV4IErKIM6+vR7IVEAvlI4zs1meaj0gVbi0IMJR1FbUGrP20gaXT73 -y/Zl92zxlfgCOzJWgjl6W70viRu/obTo/3+NjN8D8WBOWBFM66M/ECuDmgFz2ZRt -hAAnZqzwcEAJQpKtT5MNYQlRJNiS1QuUYbKHsu3/mjX/hVTK7URDrBs8FmtISgoc -QIgfksILAAX/8sgCSqSqqcyZlpwvWOB94b67B9xfBHJcMTTD7F8t4D1kkCLm0ey4 -Lt1ZrtmhN79UNdxzMk+MBB4zsslG8dhcyFVQyWi9qLo2CQIDAQABo2MwYTAPBgNV -HRMBAf8EBTADAQH/MB0GA1UdDgQWBBR281Xh+qQ2+/CfXGJx7Tz0RzgQKzAfBgNV -HSMEGDAWgBR281Xh+qQ2+/CfXGJx7Tz0RzgQKzAOBgNVHQ8BAf8EBAMCAYYwDQYJ -KoZIhvcNAQEFBQADggIBAGbBxiPz2eAubl/oz66wsCVNK/g7WJtAJDday6sWSf+z -dXkzoS9tcBc0kf5nfo/sm+VegqlVHy/c1FEHEv6sFj4sNcZj/NwQ6w2jqtB8zNHQ -L1EuxBRa3ugZ4T7GzKQp5y6EqgYweHZUcyiYWTjgAA1i00J9IZ+uPTqM1fp3DRgr -Fg5fNuH8KrUwJM/gYwx7WBr+mbpCErGR9Hxo4sjoryzqyX6uuyo9DRXcNJW2GHSo -ag/HtPQTxORb7QrSpJdMKu0vbBKJPfEncKpqA1Ihn0CoZ1Dy81of398j9tx4TuaY -T1U6U+Pv8vSfx3zYWK8pIpe44L2RLrB27FcRz+8pRPPphXpgY+RdM4kX2TGq2tbz -GDVyz4crL2MjhF2EjD9XoIj8mZEoJmmZ1I+XRL6O1UixpCgp8RW04eWe3fiPpm8m -1wk8OhwRDqZsN/etRIcsKMfYdIKz0G9KV7s1KSegi+ghp4dkNl3M2Basx7InQJJV -OCiNUW7dFGdTbHFcJoRNdVq2fmBWqU2t+5sel/MN2dKXVHfaPRK34B7vCAas+YWH -6aLcr34YEoP9VhdBLtUpgn2Z9DH2canPLAEnpQW5qrJITirvn5NSUZU8UnOOVkwX -QMAJKOSLakhT2+zNVVXxxvjpoixMptEmX36vWkzaH6byHCx+rgIW0lbQL1dTR+iS ------END CERTIFICATE----- - -# Issuer: CN=AAA Certificate Services O=Comodo CA Limited -# Subject: CN=AAA Certificate Services O=Comodo CA Limited -# Label: "Comodo AAA Services root" -# Serial: 1 -# MD5 Fingerprint: 49:79:04:b0:eb:87:19:ac:47:b0:bc:11:51:9b:74:d0 -# SHA1 Fingerprint: d1:eb:23:a4:6d:17:d6:8f:d9:25:64:c2:f1:f1:60:17:64:d8:e3:49 -# SHA256 Fingerprint: d7:a7:a0:fb:5d:7e:27:31:d7:71:e9:48:4e:bc:de:f7:1d:5f:0c:3e:0a:29:48:78:2b:c8:3e:e0:ea:69:9e:f4 -----BEGIN CERTIFICATE----- MIIEMjCCAxqgAwIBAgIBATANBgkqhkiG9w0BAQUFADB7MQswCQYDVQQGEwJHQjEb MBkGA1UECAwSR3JlYXRlciBNYW5jaGVzdGVyMRAwDgYDVQQHDAdTYWxmb3JkMRow @@ -369,14 +154,6 @@ G9w84FoVxp7Z8VlIMCFlA2zs6SFz7JsDoeA3raAVGI/6ugLOpyypEBMs1OUIJqsi l2D4kF501KKaU73yqWjgom7C12yxow+ev+to51byrvLjKzg6CYG1a4XXvi3tPxq3 smPi9WIsgtRqAEFQ8TmDn5XpNpaYbg== -----END CERTIFICATE----- - -# Issuer: CN=QuoVadis Root Certification Authority O=QuoVadis Limited OU=Root Certification Authority -# Subject: CN=QuoVadis Root Certification Authority O=QuoVadis Limited OU=Root Certification Authority -# Label: "QuoVadis Root CA" -# Serial: 985026699 -# MD5 Fingerprint: 27:de:36:fe:72:b7:00:03:00:9d:f4:f0:1e:6c:04:24 -# SHA1 Fingerprint: de:3f:40:bd:50:93:d3:9b:6c:60:f6:da:bc:07:62:01:00:89:76:c9 -# SHA256 Fingerprint: a4:5e:de:3b:bb:f0:9c:8a:e1:5c:72:ef:c0:72:68:d6:93:a2:1c:99:6f:d5:1e:67:ca:07:94:60:fd:6d:88:73 -----BEGIN CERTIFICATE----- MIIF0DCCBLigAwIBAgIEOrZQizANBgkqhkiG9w0BAQUFADB/MQswCQYDVQQGEwJC TTEZMBcGA1UEChMQUXVvVmFkaXMgTGltaXRlZDElMCMGA1UECxMcUm9vdCBDZXJ0 @@ -411,14 +188,6 @@ mQM6isxUJTkxgXsTIlG6Rmyhu576BGxJJnSP0nPrzDCi5upZIof4l/UO/erMkqQW xFIY6iHOsfHmhIHluqmGKPJDWl0Snawe2ajlCmqnf6CHKc/yiU3U7MXi5nrQNiOK SnQ2+Q== -----END CERTIFICATE----- - -# Issuer: CN=QuoVadis Root CA 2 O=QuoVadis Limited -# Subject: CN=QuoVadis Root CA 2 O=QuoVadis Limited -# Label: "QuoVadis Root CA 2" -# Serial: 1289 -# MD5 Fingerprint: 5e:39:7b:dd:f8:ba:ec:82:e9:ac:62:ba:0c:54:00:2b -# SHA1 Fingerprint: ca:3a:fb:cf:12:40:36:4b:44:b2:16:20:88:80:48:39:19:93:7c:f7 -# SHA256 Fingerprint: 85:a0:dd:7d:d7:20:ad:b7:ff:05:f8:3d:54:2b:20:9d:c7:ff:45:28:f7:d6:77:b1:83:89:fe:a5:e5:c4:9e:86 -----BEGIN CERTIFICATE----- MIIFtzCCA5+gAwIBAgICBQkwDQYJKoZIhvcNAQEFBQAwRTELMAkGA1UEBhMCQk0x GTAXBgNVBAoTEFF1b1ZhZGlzIExpbWl0ZWQxGzAZBgNVBAMTElF1b1ZhZGlzIFJv @@ -452,14 +221,6 @@ ohEUGW6yhhtoPkg3Goi3XZZenMfvJ2II4pEZXNLxId26F0KCl3GBUzGpn/Z9Yr9y 4aOTHcyKJloJONDO1w2AFrR4pTqHTI2KpdVGl/IsELm8VCLAAVBpQ570su9t+Oza 8eOx79+Rj1QqCyXBJhnEUhAFZdWCEOrCMc0u -----END CERTIFICATE----- - -# Issuer: CN=QuoVadis Root CA 3 O=QuoVadis Limited -# Subject: CN=QuoVadis Root CA 3 O=QuoVadis Limited -# Label: "QuoVadis Root CA 3" -# Serial: 1478 -# MD5 Fingerprint: 31:85:3c:62:94:97:63:b9:aa:fd:89:4e:af:6f:e0:cf -# SHA1 Fingerprint: 1f:49:14:f7:d8:74:95:1d:dd:ae:02:c0:be:fd:3a:2d:82:75:51:85 -# SHA256 Fingerprint: 18:f1:fc:7f:20:5d:f8:ad:dd:eb:7f:e0:07:dd:57:e3:af:37:5a:9c:4d:8d:73:54:6b:f4:f1:fe:d1:e1:8d:35 -----BEGIN CERTIFICATE----- MIIGnTCCBIWgAwIBAgICBcYwDQYJKoZIhvcNAQEFBQAwRTELMAkGA1UEBhMCQk0x GTAXBgNVBAoTEFF1b1ZhZGlzIExpbWl0ZWQxGzAZBgNVBAMTElF1b1ZhZGlzIFJv @@ -498,14 +259,6 @@ Wy10QJLZYxkNc91pvGJHvOB0K7Lrfb5BG7XARsWhIstfTsEokt4YutUqKLsRixeT mJlglFwjz1onl14LBQaTNx47aTbrqZ5hHY8y2o4M1nQ+ewkk2gF3R8Q7zTSMmfXK 4SVhM7JZG+Ju1zdXtg2pEto= -----END CERTIFICATE----- - -# Issuer: O=SECOM Trust.net OU=Security Communication RootCA1 -# Subject: O=SECOM Trust.net OU=Security Communication RootCA1 -# Label: "Security Communication Root CA" -# Serial: 0 -# MD5 Fingerprint: f1:bc:63:6a:54:e0:b5:27:f5:cd:e7:1a:e3:4d:6e:4a -# SHA1 Fingerprint: 36:b1:2b:49:f9:81:9e:d7:4c:9e:bc:38:0f:c6:56:8f:5d:ac:b2:f7 -# SHA256 Fingerprint: e7:5e:72:ed:9f:56:0e:ec:6e:b4:80:00:73:a4:3f:c3:ad:19:19:5a:39:22:82:01:78:95:97:4a:99:02:6b:6c -----BEGIN CERTIFICATE----- MIIDWjCCAkKgAwIBAgIBADANBgkqhkiG9w0BAQUFADBQMQswCQYDVQQGEwJKUDEY MBYGA1UEChMPU0VDT00gVHJ1c3QubmV0MScwJQYDVQQLEx5TZWN1cml0eSBDb21t @@ -526,14 +279,6 @@ Bw+SUEmK3TGXX8npN6o7WWWXlDLJs58+OmJYxUmtYg5xpTKqL8aJdkNAExNnPaJU JRDL8Try2frbSVa7pv6nQTXD4IhhyYjH3zYQIphZ6rBK+1YWc26sTfcioU+tHXot RSflMMFe8toTyyVCUZVHA4xsIcx0Qu1T/zOLjw9XARYvz6buyXAiFL39vmwLAw== -----END CERTIFICATE----- - -# Issuer: CN=Sonera Class2 CA O=Sonera -# Subject: CN=Sonera Class2 CA O=Sonera -# Label: "Sonera Class 2 Root CA" -# Serial: 29 -# MD5 Fingerprint: a3:ec:75:0f:2e:88:df:fa:48:01:4e:0b:5c:48:6f:fb -# SHA1 Fingerprint: 37:f7:6d:e6:07:7c:90:c5:b1:3e:93:1a:b7:41:10:b4:f2:e4:9a:27 -# SHA256 Fingerprint: 79:08:b4:03:14:c1:38:10:0b:51:8d:07:35:80:7f:fb:fc:f8:51:8a:00:95:33:71:05:ba:38:6b:15:3d:d9:27 -----BEGIN CERTIFICATE----- MIIDIDCCAgigAwIBAgIBHTANBgkqhkiG9w0BAQUFADA5MQswCQYDVQQGEwJGSTEP MA0GA1UEChMGU29uZXJhMRkwFwYDVQQDExBTb25lcmEgQ2xhc3MyIENBMB4XDTAx @@ -553,14 +298,6 @@ FNr450kkkdAdavphOe9r5yF1BgfYErQhIHBCcYHaPJo2vqZbDWpsmh+Re/n570K6 Tk6ezAyNlNzZRZxe7EJQY670XcSxEtzKO6gunRRaBXW37Ndj4ro1tgQIkejanZz2 ZrUYrAqmVCY0M9IbwdR/GjqOC6oybtv8TyWf2TLHllpwrN9M -----END CERTIFICATE----- - -# Issuer: CN=XRamp Global Certification Authority O=XRamp Security Services Inc OU=www.xrampsecurity.com -# Subject: CN=XRamp Global Certification Authority O=XRamp Security Services Inc OU=www.xrampsecurity.com -# Label: "XRamp Global CA Root" -# Serial: 107108908803651509692980124233745014957 -# MD5 Fingerprint: a1:0b:44:b3:ca:10:d8:00:6e:9d:0f:d8:0f:92:0a:d1 -# SHA1 Fingerprint: b8:01:86:d1:eb:9c:86:a5:41:04:cf:30:54:f3:4c:52:b7:e5:58:c6 -# SHA256 Fingerprint: ce:cd:dc:90:50:99:d8:da:df:c5:b1:d2:09:b7:37:cb:e2:c1:8c:fb:2c:10:c0:ff:0b:cf:0d:32:86:fc:1a:a2 -----BEGIN CERTIFICATE----- MIIEMDCCAxigAwIBAgIQUJRs7Bjq1ZxN1ZfvdY+grTANBgkqhkiG9w0BAQUFADCB gjELMAkGA1UEBhMCVVMxHjAcBgNVBAsTFXd3dy54cmFtcHNlY3VyaXR5LmNvbTEk @@ -586,14 +323,6 @@ IR9NmXmd4c8nnxCbHIgNsIpkQTG4DmyQJKSbXHGPurt+HBvbaoAPIbzp26a3QPSy i6mx5O+aGtA9aZnuqCij4Tyz8LIRnM98QObd50N9otg6tamN8jSZxNQQ4Qb9CYQQ O+7ETPTsJ3xCwnR8gooJybQDJbw= -----END CERTIFICATE----- - -# Issuer: O=The Go Daddy Group, Inc. OU=Go Daddy Class 2 Certification Authority -# Subject: O=The Go Daddy Group, Inc. OU=Go Daddy Class 2 Certification Authority -# Label: "Go Daddy Class 2 CA" -# Serial: 0 -# MD5 Fingerprint: 91:de:06:25:ab:da:fd:32:17:0c:bb:25:17:2a:84:67 -# SHA1 Fingerprint: 27:96:ba:e6:3f:18:01:e2:77:26:1b:a0:d7:77:70:02:8f:20:ee:e4 -# SHA256 Fingerprint: c3:84:6b:f2:4b:9e:93:ca:64:27:4c:0e:c6:7c:1e:cc:5e:02:4f:fc:ac:d2:d7:40:19:35:0e:81:fe:54:6a:e4 -----BEGIN CERTIFICATE----- MIIEADCCAuigAwIBAgIBADANBgkqhkiG9w0BAQUFADBjMQswCQYDVQQGEwJVUzEh MB8GA1UEChMYVGhlIEdvIERhZGR5IEdyb3VwLCBJbmMuMTEwLwYDVQQLEyhHbyBE @@ -618,14 +347,6 @@ HmyW74cNxA9hi63ugyuV+I6ShHI56yDqg+2DzZduCLzrTia2cyvk0/ZM/iZx4mER dEr/VxqHD3VILs9RaRegAhJhldXRQLIQTO7ErBBDpqWeCtWVYpoNz4iCxTIM5Cuf ReYNnyicsbkqWletNw+vHX/bvZ8= -----END CERTIFICATE----- - -# Issuer: O=Starfield Technologies, Inc. OU=Starfield Class 2 Certification Authority -# Subject: O=Starfield Technologies, Inc. OU=Starfield Class 2 Certification Authority -# Label: "Starfield Class 2 CA" -# Serial: 0 -# MD5 Fingerprint: 32:4a:4b:bb:c8:63:69:9b:be:74:9a:c6:dd:1d:46:24 -# SHA1 Fingerprint: ad:7e:1c:28:b0:64:ef:8f:60:03:40:20:14:c3:d0:e3:37:0e:b5:8a -# SHA256 Fingerprint: 14:65:fa:20:53:97:b8:76:fa:a6:f0:a9:95:8e:55:90:e4:0f:cc:7f:aa:4f:b7:c2:c8:67:75:21:fb:5f:b6:58 -----BEGIN CERTIFICATE----- MIIEDzCCAvegAwIBAgIBADANBgkqhkiG9w0BAQUFADBoMQswCQYDVQQGEwJVUzEl MCMGA1UEChMcU3RhcmZpZWxkIFRlY2hub2xvZ2llcywgSW5jLjEyMDAGA1UECxMp @@ -650,54 +371,6 @@ xy16paq8U4Zt3VekyvggQQto8PT7dL5WXXp59fkdheMtlb71cZBDzI0fmgAKhynp VSJYACPq4xJDKVtHCN2MQWplBqjlIapBtJUhlbl90TSrE9atvNziPTnNvT51cKEY WQPJIrSPnNVeKtelttQKbfi3QBFGmh95DmK/D5fs4C8fF5Q= -----END CERTIFICATE----- - -# Issuer: O=Government Root Certification Authority -# Subject: O=Government Root Certification Authority -# Label: "Taiwan GRCA" -# Serial: 42023070807708724159991140556527066870 -# MD5 Fingerprint: 37:85:44:53:32:45:1f:20:f0:f3:95:e1:25:c4:43:4e -# SHA1 Fingerprint: f4:8b:11:bf:de:ab:be:94:54:20:71:e6:41:de:6b:be:88:2b:40:b9 -# SHA256 Fingerprint: 76:00:29:5e:ef:e8:5b:9e:1f:d6:24:db:76:06:2a:aa:ae:59:81:8a:54:d2:77:4c:d4:c0:b2:c0:11:31:e1:b3 ------BEGIN CERTIFICATE----- -MIIFcjCCA1qgAwIBAgIQH51ZWtcvwgZEpYAIaeNe9jANBgkqhkiG9w0BAQUFADA/ -MQswCQYDVQQGEwJUVzEwMC4GA1UECgwnR292ZXJubWVudCBSb290IENlcnRpZmlj -YXRpb24gQXV0aG9yaXR5MB4XDTAyMTIwNTEzMjMzM1oXDTMyMTIwNTEzMjMzM1ow -PzELMAkGA1UEBhMCVFcxMDAuBgNVBAoMJ0dvdmVybm1lbnQgUm9vdCBDZXJ0aWZp -Y2F0aW9uIEF1dGhvcml0eTCCAiIwDQYJKoZIhvcNAQEBBQADggIPADCCAgoCggIB -AJoluOzMonWoe/fOW1mKydGGEghU7Jzy50b2iPN86aXfTEc2pBsBHH8eV4qNw8XR -IePaJD9IK/ufLqGU5ywck9G/GwGHU5nOp/UKIXZ3/6m3xnOUT0b3EEk3+qhZSV1q -gQdW8or5BtD3cCJNtLdBuTK4sfCxw5w/cP1T3YGq2GN49thTbqGsaoQkclSGxtKy -yhwOeYHWtXBiCAEuTk8O1RGvqa/lmr/czIdtJuTJV6L7lvnM4T9TjGxMfptTCAts -F/tnyMKtsc2AtJfcdgEWFelq16TheEfOhtX7MfP6Mb40qij7cEwdScevLJ1tZqa2 -jWR+tSBqnTuBto9AAGdLiYa4zGX+FVPpBMHWXx1E1wovJ5pGfaENda1UhhXcSTvx -ls4Pm6Dso3pdvtUqdULle96ltqqvKKyskKw4t9VoNSZ63Pc78/1Fm9G7Q3hub/FC -VGqY8A2tl+lSXunVanLeavcbYBT0peS2cWeqH+riTcFCQP5nRhc4L0c/cZyu5SHK -YS1tB6iEfC3uUSXxY5Ce/eFXiGvviiNtsea9P63RPZYLhY3Naye7twWb7LuRqQoH -EgKXTiCQ8P8NHuJBO9NAOueNXdpm5AKwB1KYXA6OM5zCppX7VRluTI6uSw+9wThN -Xo+EHWbNxWCWtFJaBYmOlXqYwZE8lSOyDvR5tMl8wUohAgMBAAGjajBoMB0GA1Ud -DgQWBBTMzO/MKWCkO7GStjz6MmKPrCUVOzAMBgNVHRMEBTADAQH/MDkGBGcqBwAE -MTAvMC0CAQAwCQYFKw4DAhoFADAHBgVnKgMAAAQUA5vwIhP/lSg209yewDL7MTqK -UWUwDQYJKoZIhvcNAQEFBQADggIBAECASvomyc5eMN1PhnR2WPWus4MzeKR6dBcZ -TulStbngCnRiqmjKeKBMmo4sIy7VahIkv9Ro04rQ2JyftB8M3jh+Vzj8jeJPXgyf -qzvS/3WXy6TjZwj/5cAWtUgBfen5Cv8b5Wppv3ghqMKnI6mGq3ZW6A4M9hPdKmaK -ZEk9GhiHkASfQlK3T8v+R0F2Ne//AHY2RTKbxkaFXeIksB7jSJaYV0eUVXoPQbFE -JPPB/hprv4j9wabak2BegUqZIJxIZhm1AHlUD7gsL0u8qV1bYH+Mh6XgUmMqvtg7 -hUAV/h62ZT/FS9p+tXo1KaMuephgIqP0fSdOLeq0dDzpD6QzDxARvBMB1uUO07+1 -EqLhRSPAzAhuYbeJq4PjJB7mXQfnHyA+z2fI56wwbSdLaG5LKlwCCDTb+HbkZ6Mm -nD+iMsJKxYEYMRBWqoTvLQr/uB930r+lWKBi5NdLkXWNiYCYfm3LU05er/ayl4WX -udpVBrkk7tfGOB5jGxI7leFYrPLfhNVfmS8NVVvmONsuP3LpSIXLuykTjx44Vbnz -ssQwmSNOXfJIoRIM3BKQCZBUkQM8R+XVyWXgt0t97EfTsws+rZ7QdAAO671RrcDe -LMDDav7v3Aun+kbfYNucpllQdSNpc5Oy+fwC00fmcc4QAu4njIT/rEUNE1yDMuAl -pYYsfPQS ------END CERTIFICATE----- - -# Issuer: CN=DigiCert Assured ID Root CA O=DigiCert Inc OU=www.digicert.com -# Subject: CN=DigiCert Assured ID Root CA O=DigiCert Inc OU=www.digicert.com -# Label: "DigiCert Assured ID Root CA" -# Serial: 17154717934120587862167794914071425081 -# MD5 Fingerprint: 87:ce:0b:7b:2a:0e:49:00:e1:58:71:9b:37:a8:93:72 -# SHA1 Fingerprint: 05:63:b8:63:0d:62:d7:5a:bb:c8:ab:1e:4b:df:b5:a8:99:b2:4d:43 -# SHA256 Fingerprint: 3e:90:99:b5:01:5e:8f:48:6c:00:bc:ea:9d:11:1e:e7:21:fa:ba:35:5a:89:bc:f1:df:69:56:1e:3d:c6:32:5c -----BEGIN CERTIFICATE----- MIIDtzCCAp+gAwIBAgIQDOfg5RfYRv6P5WD8G/AwOTANBgkqhkiG9w0BAQUFADBl MQswCQYDVQQGEwJVUzEVMBMGA1UEChMMRGlnaUNlcnQgSW5jMRkwFwYDVQQLExB3 @@ -720,14 +393,6 @@ NW1fiQG2SVufAQWbqz0lwcy2f8Lxb4bG+mRo64EtlOtCt/qMHt1i8b5QZ7dsvfPx H2sMNgcWfzd8qVttevESRmCD1ycEvkvOl77DZypoEd+A5wwzZr8TDRRu838fYxAe +o0bJW1sj6W3YQGx0qMmoRBxna3iw/nDmVG3KwcIzi7mULKn+gpFL6Lw8g== -----END CERTIFICATE----- - -# Issuer: CN=DigiCert Global Root CA O=DigiCert Inc OU=www.digicert.com -# Subject: CN=DigiCert Global Root CA O=DigiCert Inc OU=www.digicert.com -# Label: "DigiCert Global Root CA" -# Serial: 10944719598952040374951832963794454346 -# MD5 Fingerprint: 79:e4:a9:84:0d:7d:3a:96:d7:c0:4f:e2:43:4c:89:2e -# SHA1 Fingerprint: a8:98:5d:3a:65:e5:e5:c4:b2:d7:d6:6d:40:c6:dd:2f:b1:9c:54:36 -# SHA256 Fingerprint: 43:48:a0:e9:44:4c:78:cb:26:5e:05:8d:5e:89:44:b4:d8:4f:96:62:bd:26:db:25:7f:89:34:a4:43:c7:01:61 -----BEGIN CERTIFICATE----- MIIDrzCCApegAwIBAgIQCDvgVpBCRrGhdWrJWZHHSjANBgkqhkiG9w0BAQUFADBh MQswCQYDVQQGEwJVUzEVMBMGA1UEChMMRGlnaUNlcnQgSW5jMRkwFwYDVQQLExB3 @@ -750,14 +415,6 @@ PnlUkiaY4IBIqDfv8NZ5YBberOgOzW6sRBc4L0na4UU+Krk2U886UAb3LujEV0ls YSEY1QSteDwsOoBrp+uvFRTp2InBuThs4pFsiv9kuXclVzDAGySj4dzp30d8tbQk CAUw7C29C79Fv1C5qfPrmAESrciIxpg0X40KPMbp1ZWVbd4= -----END CERTIFICATE----- - -# Issuer: CN=DigiCert High Assurance EV Root CA O=DigiCert Inc OU=www.digicert.com -# Subject: CN=DigiCert High Assurance EV Root CA O=DigiCert Inc OU=www.digicert.com -# Label: "DigiCert High Assurance EV Root CA" -# Serial: 3553400076410547919724730734378100087 -# MD5 Fingerprint: d4:74:de:57:5c:39:b2:d3:9c:85:83:c5:c0:65:49:8a -# SHA1 Fingerprint: 5f:b7:ee:06:33:e2:59:db:ad:0c:4c:9a:e6:d3:8f:1a:61:c7:dc:25 -# SHA256 Fingerprint: 74:31:e5:f4:c3:c1:ce:46:90:77:4f:0b:61:e0:54:40:88:3b:a9:a0:1e:d0:0b:a6:ab:d7:80:6e:d3:b1:18:cf -----BEGIN CERTIFICATE----- MIIDxTCCAq2gAwIBAgIQAqxcJmoLQJuPC3nyrkYldzANBgkqhkiG9w0BAQUFADBs MQswCQYDVQQGEwJVUzEVMBMGA1UEChMMRGlnaUNlcnQgSW5jMRkwFwYDVQQLExB3 @@ -781,14 +438,6 @@ Yzi9RKR/5CYrCsSXaQ3pjOLAEFe4yHYSkVXySGnYvCoCWw9E1CAx2/S6cCZdkGCe vEsXCS+0yx5DaMkHJ8HSXPfqIbloEpw8nL+e/IBcm2PN7EeqJSdnoDfzAIJ9VNep +OkuE6N36B9K -----END CERTIFICATE----- - -# Issuer: CN=DST Root CA X3 O=Digital Signature Trust Co. -# Subject: CN=DST Root CA X3 O=Digital Signature Trust Co. -# Label: "DST Root CA X3" -# Serial: 91299735575339953335919266965803778155 -# MD5 Fingerprint: 41:03:52:dc:0f:f7:50:1b:16:f0:02:8e:ba:6f:45:c5 -# SHA1 Fingerprint: da:c9:02:4f:54:d8:f6:df:94:93:5f:b1:73:26:38:ca:6a:d7:7c:13 -# SHA256 Fingerprint: 06:87:26:03:31:a7:24:03:d9:09:f1:05:e6:9b:cf:0d:32:e1:bd:24:93:ff:c6:d9:20:6d:11:bc:d6:77:07:39 -----BEGIN CERTIFICATE----- MIIDSjCCAjKgAwIBAgIQRK+wgNajJ7qJMDmGLvhAazANBgkqhkiG9w0BAQUFADA/ MSQwIgYDVQQKExtEaWdpdGFsIFNpZ25hdHVyZSBUcnVzdCBDby4xFzAVBgNVBAMT @@ -809,14 +458,6 @@ R8srzJmwN0jP41ZL9c8PDHIyh8bwRLtTcm1D9SZImlJnt1ir/md2cXjbDaJWFBM5 JDGFoqgCWjBH4d1QB7wCCZAA62RjYJsWvIjJEubSfZGL+T0yjWW06XyxV3bqxbYo Ob8VZRzI9neWagqNdwvYkQsEjgfbKbYK7p2CNTUQ -----END CERTIFICATE----- - -# Issuer: CN=SwissSign Gold CA - G2 O=SwissSign AG -# Subject: CN=SwissSign Gold CA - G2 O=SwissSign AG -# Label: "SwissSign Gold CA - G2" -# Serial: 13492815561806991280 -# MD5 Fingerprint: 24:77:d9:a8:91:d1:3b:fa:88:2d:c2:ff:f8:cd:33:93 -# SHA1 Fingerprint: d8:c5:38:8a:b7:30:1b:1b:6e:d4:7a:e6:45:25:3a:6f:9f:1a:27:61 -# SHA256 Fingerprint: 62:dd:0b:e9:b9:f5:0a:16:3e:a0:f8:e7:5c:05:3b:1e:ca:57:ea:55:c8:68:8f:64:7c:68:81:f2:c8:35:7b:95 -----BEGIN CERTIFICATE----- MIIFujCCA6KgAwIBAgIJALtAHEP1Xk+wMA0GCSqGSIb3DQEBBQUAMEUxCzAJBgNV BAYTAkNIMRUwEwYDVQQKEwxTd2lzc1NpZ24gQUcxHzAdBgNVBAMTFlN3aXNzU2ln @@ -850,14 +491,6 @@ Ld6leNcG2mqeSz53OiATIgHQv2ieY2BrNU0LbbqhPcCT4H8js1WtciVORvnSFu+w ZMEBnunKoGqYDs/YYPIvSbjkQuE4NRb0yG5P94FW6LqjviOvrv1vA+ACOzB2+htt Qc8Bsem4yWb02ybzOqR08kkkW8mw0FfB+j564ZfJ -----END CERTIFICATE----- - -# Issuer: CN=SwissSign Silver CA - G2 O=SwissSign AG -# Subject: CN=SwissSign Silver CA - G2 O=SwissSign AG -# Label: "SwissSign Silver CA - G2" -# Serial: 5700383053117599563 -# MD5 Fingerprint: e0:06:a1:c9:7d:cf:c9:fc:0d:c0:56:75:96:d8:62:13 -# SHA1 Fingerprint: 9b:aa:e5:9f:56:ee:21:cb:43:5a:be:25:93:df:a7:f0:40:d1:1d:cb -# SHA256 Fingerprint: be:6c:4d:a2:bb:b9:ba:59:b6:f3:93:97:68:37:42:46:c3:c0:05:99:3f:a9:8f:02:0d:1d:ed:be:d4:8a:81:d5 -----BEGIN CERTIFICATE----- MIIFvTCCA6WgAwIBAgIITxvUL1S7L0swDQYJKoZIhvcNAQEFBQAwRzELMAkGA1UE BhMCQ0gxFTATBgNVBAoTDFN3aXNzU2lnbiBBRzEhMB8GA1UEAxMYU3dpc3NTaWdu @@ -891,112 +524,6 @@ OMpXEA29MC/HpeZBoNquBYeaoKRlbEwJDIm6uNO5wJOKMPqN5ZprFQFOZ6raYlY+ hAhm0sQ2fac+EPyI4NSA5QC9qvNOBqN6avlicuMJT+ubDgEj8Z+7fNzcbBGXJbLy tGMU0gYqZ4yD9c7qB9iaah7s5Aq7KkzrCWA5zspi2C5u -----END CERTIFICATE----- - -# Issuer: CN=GeoTrust Primary Certification Authority O=GeoTrust Inc. -# Subject: CN=GeoTrust Primary Certification Authority O=GeoTrust Inc. -# Label: "GeoTrust Primary Certification Authority" -# Serial: 32798226551256963324313806436981982369 -# MD5 Fingerprint: 02:26:c3:01:5e:08:30:37:43:a9:d0:7d:cf:37:e6:bf -# SHA1 Fingerprint: 32:3c:11:8e:1b:f7:b8:b6:52:54:e2:e2:10:0d:d6:02:90:37:f0:96 -# SHA256 Fingerprint: 37:d5:10:06:c5:12:ea:ab:62:64:21:f1:ec:8c:92:01:3f:c5:f8:2a:e9:8e:e5:33:eb:46:19:b8:de:b4:d0:6c ------BEGIN CERTIFICATE----- -MIIDfDCCAmSgAwIBAgIQGKy1av1pthU6Y2yv2vrEoTANBgkqhkiG9w0BAQUFADBY -MQswCQYDVQQGEwJVUzEWMBQGA1UEChMNR2VvVHJ1c3QgSW5jLjExMC8GA1UEAxMo -R2VvVHJ1c3QgUHJpbWFyeSBDZXJ0aWZpY2F0aW9uIEF1dGhvcml0eTAeFw0wNjEx -MjcwMDAwMDBaFw0zNjA3MTYyMzU5NTlaMFgxCzAJBgNVBAYTAlVTMRYwFAYDVQQK -Ew1HZW9UcnVzdCBJbmMuMTEwLwYDVQQDEyhHZW9UcnVzdCBQcmltYXJ5IENlcnRp -ZmljYXRpb24gQXV0aG9yaXR5MIIBIjANBgkqhkiG9w0BAQEFAAOCAQ8AMIIBCgKC -AQEAvrgVe//UfH1nrYNke8hCUy3f9oQIIGHWAVlqnEQRr+92/ZV+zmEwu3qDXwK9 -AWbK7hWNb6EwnL2hhZ6UOvNWiAAxz9juapYC2e0DjPt1befquFUWBRaa9OBesYjA -ZIVcFU2Ix7e64HXprQU9nceJSOC7KMgD4TCTZF5SwFlwIjVXiIrxlQqD17wxcwE0 -7e9GceBrAqg1cmuXm2bgyxx5X9gaBGgeRwLmnWDiNpcB3841kt++Z8dtd1k7j53W -kBWUvEI0EME5+bEnPn7WinXFsq+W06Lem+SYvn3h6YGttm/81w7a4DSwDRp35+MI -mO9Y+pyEtzavwt+s0vQQBnBxNQIDAQABo0IwQDAPBgNVHRMBAf8EBTADAQH/MA4G -A1UdDwEB/wQEAwIBBjAdBgNVHQ4EFgQULNVQQZcVi/CPNmFbSvtr2ZnJM5IwDQYJ -KoZIhvcNAQEFBQADggEBAFpwfyzdtzRP9YZRqSa+S7iq8XEN3GHHoOo0Hnp3DwQ1 -6CePbJC/kRYkRj5KTs4rFtULUh38H2eiAkUxT87z+gOneZ1TatnaYzr4gNfTmeGl -4b7UVXGYNTq+k+qurUKykG/g/CFNNWMziUnWm07Kx+dOCQD32sfvmWKZd7aVIl6K -oKv0uHiYyjgZmclynnjNS6yvGaBzEi38wkG6gZHaFloxt/m0cYASSJlyc1pZU8Fj -UjPtp8nSOQJw+uCxQmYpqptR7TBUIhRf2asdweSU8Pj1K/fqynhG1riR/aYNKxoU -AT6A8EKglQdebc3MS6RFjasS6LPeWuWgfOgPIh1a6Vk= ------END CERTIFICATE----- - -# Issuer: CN=thawte Primary Root CA O=thawte, Inc. OU=Certification Services Division/(c) 2006 thawte, Inc. - For authorized use only -# Subject: CN=thawte Primary Root CA O=thawte, Inc. OU=Certification Services Division/(c) 2006 thawte, Inc. - For authorized use only -# Label: "thawte Primary Root CA" -# Serial: 69529181992039203566298953787712940909 -# MD5 Fingerprint: 8c:ca:dc:0b:22:ce:f5:be:72:ac:41:1a:11:a8:d8:12 -# SHA1 Fingerprint: 91:c6:d6:ee:3e:8a:c8:63:84:e5:48:c2:99:29:5c:75:6c:81:7b:81 -# SHA256 Fingerprint: 8d:72:2f:81:a9:c1:13:c0:79:1d:f1:36:a2:96:6d:b2:6c:95:0a:97:1d:b4:6b:41:99:f4:ea:54:b7:8b:fb:9f ------BEGIN CERTIFICATE----- -MIIEIDCCAwigAwIBAgIQNE7VVyDV7exJ9C/ON9srbTANBgkqhkiG9w0BAQUFADCB -qTELMAkGA1UEBhMCVVMxFTATBgNVBAoTDHRoYXd0ZSwgSW5jLjEoMCYGA1UECxMf -Q2VydGlmaWNhdGlvbiBTZXJ2aWNlcyBEaXZpc2lvbjE4MDYGA1UECxMvKGMpIDIw -MDYgdGhhd3RlLCBJbmMuIC0gRm9yIGF1dGhvcml6ZWQgdXNlIG9ubHkxHzAdBgNV -BAMTFnRoYXd0ZSBQcmltYXJ5IFJvb3QgQ0EwHhcNMDYxMTE3MDAwMDAwWhcNMzYw -NzE2MjM1OTU5WjCBqTELMAkGA1UEBhMCVVMxFTATBgNVBAoTDHRoYXd0ZSwgSW5j -LjEoMCYGA1UECxMfQ2VydGlmaWNhdGlvbiBTZXJ2aWNlcyBEaXZpc2lvbjE4MDYG -A1UECxMvKGMpIDIwMDYgdGhhd3RlLCBJbmMuIC0gRm9yIGF1dGhvcml6ZWQgdXNl -IG9ubHkxHzAdBgNVBAMTFnRoYXd0ZSBQcmltYXJ5IFJvb3QgQ0EwggEiMA0GCSqG -SIb3DQEBAQUAA4IBDwAwggEKAoIBAQCsoPD7gFnUnMekz52hWXMJEEUMDSxuaPFs -W0hoSVk3/AszGcJ3f8wQLZU0HObrTQmnHNK4yZc2AreJ1CRfBsDMRJSUjQJib+ta -3RGNKJpchJAQeg29dGYvajig4tVUROsdB58Hum/u6f1OCyn1PoSgAfGcq/gcfomk -6KHYcWUNo1F77rzSImANuVud37r8UVsLr5iy6S7pBOhih94ryNdOwUxkHt3Ph1i6 -Sk/KaAcdHJ1KxtUvkcx8cXIcxcBn6zL9yZJclNqFwJu/U30rCfSMnZEfl2pSy94J -NqR32HuHUETVPm4pafs5SSYeCaWAe0At6+gnhcn+Yf1+5nyXHdWdAgMBAAGjQjBA -MA8GA1UdEwEB/wQFMAMBAf8wDgYDVR0PAQH/BAQDAgEGMB0GA1UdDgQWBBR7W0XP -r87Lev0xkhpqtvNG61dIUDANBgkqhkiG9w0BAQUFAAOCAQEAeRHAS7ORtvzw6WfU -DW5FvlXok9LOAz/t2iWwHVfLHjp2oEzsUHboZHIMpKnxuIvW1oeEuzLlQRHAd9mz -YJ3rG9XRbkREqaYB7FViHXe4XI5ISXycO1cRrK1zN44veFyQaEfZYGDm/Ac9IiAX -xPcW6cTYcvnIc3zfFi8VqT79aie2oetaupgf1eNNZAqdE8hhuvU5HIe6uL17In/2 -/qxAeeWsEG89jxt5dovEN7MhGITlNgDrYyCZuen+MwS7QcjBAvlEYyCegc5C09Y/ -LHbTY5xZ3Y+m4Q6gLkH3LpVHz7z9M/P2C2F+fpErgUfCJzDupxBdN49cOSvkBPB7 -jVaMaA== ------END CERTIFICATE----- - -# Issuer: CN=VeriSign Class 3 Public Primary Certification Authority - G5 O=VeriSign, Inc. OU=VeriSign Trust Network/(c) 2006 VeriSign, Inc. - For authorized use only -# Subject: CN=VeriSign Class 3 Public Primary Certification Authority - G5 O=VeriSign, Inc. OU=VeriSign Trust Network/(c) 2006 VeriSign, Inc. - For authorized use only -# Label: "VeriSign Class 3 Public Primary Certification Authority - G5" -# Serial: 33037644167568058970164719475676101450 -# MD5 Fingerprint: cb:17:e4:31:67:3e:e2:09:fe:45:57:93:f3:0a:fa:1c -# SHA1 Fingerprint: 4e:b6:d5:78:49:9b:1c:cf:5f:58:1e:ad:56:be:3d:9b:67:44:a5:e5 -# SHA256 Fingerprint: 9a:cf:ab:7e:43:c8:d8:80:d0:6b:26:2a:94:de:ee:e4:b4:65:99:89:c3:d0:ca:f1:9b:af:64:05:e4:1a:b7:df ------BEGIN CERTIFICATE----- -MIIE0zCCA7ugAwIBAgIQGNrRniZ96LtKIVjNzGs7SjANBgkqhkiG9w0BAQUFADCB -yjELMAkGA1UEBhMCVVMxFzAVBgNVBAoTDlZlcmlTaWduLCBJbmMuMR8wHQYDVQQL -ExZWZXJpU2lnbiBUcnVzdCBOZXR3b3JrMTowOAYDVQQLEzEoYykgMjAwNiBWZXJp -U2lnbiwgSW5jLiAtIEZvciBhdXRob3JpemVkIHVzZSBvbmx5MUUwQwYDVQQDEzxW -ZXJpU2lnbiBDbGFzcyAzIFB1YmxpYyBQcmltYXJ5IENlcnRpZmljYXRpb24gQXV0 -aG9yaXR5IC0gRzUwHhcNMDYxMTA4MDAwMDAwWhcNMzYwNzE2MjM1OTU5WjCByjEL -MAkGA1UEBhMCVVMxFzAVBgNVBAoTDlZlcmlTaWduLCBJbmMuMR8wHQYDVQQLExZW -ZXJpU2lnbiBUcnVzdCBOZXR3b3JrMTowOAYDVQQLEzEoYykgMjAwNiBWZXJpU2ln -biwgSW5jLiAtIEZvciBhdXRob3JpemVkIHVzZSBvbmx5MUUwQwYDVQQDEzxWZXJp -U2lnbiBDbGFzcyAzIFB1YmxpYyBQcmltYXJ5IENlcnRpZmljYXRpb24gQXV0aG9y -aXR5IC0gRzUwggEiMA0GCSqGSIb3DQEBAQUAA4IBDwAwggEKAoIBAQCvJAgIKXo1 -nmAMqudLO07cfLw8RRy7K+D+KQL5VwijZIUVJ/XxrcgxiV0i6CqqpkKzj/i5Vbex -t0uz/o9+B1fs70PbZmIVYc9gDaTY3vjgw2IIPVQT60nKWVSFJuUrjxuf6/WhkcIz -SdhDY2pSS9KP6HBRTdGJaXvHcPaz3BJ023tdS1bTlr8Vd6Gw9KIl8q8ckmcY5fQG -BO+QueQA5N06tRn/Arr0PO7gi+s3i+z016zy9vA9r911kTMZHRxAy3QkGSGT2RT+ -rCpSx4/VBEnkjWNHiDxpg8v+R70rfk/Fla4OndTRQ8Bnc+MUCH7lP59zuDMKz10/ -NIeWiu5T6CUVAgMBAAGjgbIwga8wDwYDVR0TAQH/BAUwAwEB/zAOBgNVHQ8BAf8E -BAMCAQYwbQYIKwYBBQUHAQwEYTBfoV2gWzBZMFcwVRYJaW1hZ2UvZ2lmMCEwHzAH -BgUrDgMCGgQUj+XTGoasjY5rw8+AatRIGCx7GS4wJRYjaHR0cDovL2xvZ28udmVy -aXNpZ24uY29tL3ZzbG9nby5naWYwHQYDVR0OBBYEFH/TZafC3ey78DAJ80M5+gKv -MzEzMA0GCSqGSIb3DQEBBQUAA4IBAQCTJEowX2LP2BqYLz3q3JktvXf2pXkiOOzE -p6B4Eq1iDkVwZMXnl2YtmAl+X6/WzChl8gGqCBpH3vn5fJJaCGkgDdk+bW48DW7Y -5gaRQBi5+MHt39tBquCWIMnNZBU4gcmU7qKEKQsTb47bDN0lAtukixlE0kF6BWlK -WE9gyn6CagsCqiUXObXbf+eEZSqVir2G3l6BFoMtEMze/aiCKm0oHw0LxOXnGiYZ -4fQRbxC1lfznQgUy286dUV4otp6F01vvpX1FQHKOtw5rDgb7MzVIcbidJ4vEZV8N -hnacRHr2lVz2XTIIM6RUthg/aFzyQkqFOFSDX9HoLPKsEdao7WNq ------END CERTIFICATE----- - -# Issuer: CN=SecureTrust CA O=SecureTrust Corporation -# Subject: CN=SecureTrust CA O=SecureTrust Corporation -# Label: "SecureTrust CA" -# Serial: 17199774589125277788362757014266862032 -# MD5 Fingerprint: dc:32:c3:a7:6d:25:57:c7:68:09:9d:ea:2d:a9:a2:d1 -# SHA1 Fingerprint: 87:82:c6:c3:04:35:3b:cf:d2:96:92:d2:59:3e:7d:44:d9:34:ff:11 -# SHA256 Fingerprint: f1:c1:b5:0a:e5:a2:0d:d8:03:0e:c9:f6:bc:24:82:3d:d3:67:b5:25:57:59:b4:e7:1b:61:fc:e9:f7:37:5d:73 -----BEGIN CERTIFICATE----- MIIDuDCCAqCgAwIBAgIQDPCOXAgWpa1Cf/DrJxhZ0DANBgkqhkiG9w0BAQUFADBI MQswCQYDVQQGEwJVUzEgMB4GA1UEChMXU2VjdXJlVHJ1c3QgQ29ycG9yYXRpb24x @@ -1019,14 +546,6 @@ D5kuCLDv/WnPmRoJjeOnnyvJNjR7JLN4TJUXpAYmHrZkUjZfYGfZnMUFdAvnZyPS CPyI6a6Lf+Ew9Dd+/cYy2i2eRDAwbO4H3tI0/NL/QPZL9GZGBlSm8jIKYyYwa5vR 3ItHuuG51WLQoqD0ZwV4KWMabwTW+MZMo5qxN7SN5ShLHZ4swrhovO0C7jE= -----END CERTIFICATE----- - -# Issuer: CN=Secure Global CA O=SecureTrust Corporation -# Subject: CN=Secure Global CA O=SecureTrust Corporation -# Label: "Secure Global CA" -# Serial: 9751836167731051554232119481456978597 -# MD5 Fingerprint: cf:f4:27:0d:d4:ed:dc:65:16:49:6d:3d:da:bf:6e:de -# SHA1 Fingerprint: 3a:44:73:5a:e5:81:90:1f:24:86:61:46:1e:3b:9c:c4:5f:f5:3a:1b -# SHA256 Fingerprint: 42:00:f5:04:3a:c8:59:0e:bb:52:7d:20:9e:d1:50:30:29:fb:cb:d4:1c:a1:b5:06:ec:27:f1:5a:de:7d:ac:69 -----BEGIN CERTIFICATE----- MIIDvDCCAqSgAwIBAgIQB1YipOjUiolN9BPI8PjqpTANBgkqhkiG9w0BAQUFADBK MQswCQYDVQQGEwJVUzEgMB4GA1UEChMXU2VjdXJlVHJ1c3QgQ29ycG9yYXRpb24x @@ -1049,14 +568,6 @@ I50mD1hp/Ed+stCNi5O/KU9DaXR2Z0vPB4zmAve14bRDtUstFJ/53CYNv6ZHdAbY iNE6KTCEztI5gGIbqMdXSbxqVVFnFUq+NQfk1XWYN3kwFNspnWzFacxHVaIw98xc f8LDmBxrThaA63p4ZUWiABqvDA1VZDRIuJK58bRQKfJPIx/abKwfROHdI3hRW8cW -----END CERTIFICATE----- - -# Issuer: CN=COMODO Certification Authority O=COMODO CA Limited -# Subject: CN=COMODO Certification Authority O=COMODO CA Limited -# Label: "COMODO Certification Authority" -# Serial: 104350513648249232941998508985834464573 -# MD5 Fingerprint: 5c:48:dc:f7:42:72:ec:56:94:6d:1c:cc:71:35:80:75 -# SHA1 Fingerprint: 66:31:bf:9e:f7:4f:9e:b6:c9:d5:a6:0c:ba:6a:be:d1:f7:bd:ef:7b -# SHA256 Fingerprint: 0c:2c:d6:3d:f7:80:6f:a3:99:ed:e8:09:11:6b:57:5b:f8:79:89:f0:65:18:f9:80:8c:86:05:03:17:8b:af:66 -----BEGIN CERTIFICATE----- MIIEHTCCAwWgAwIBAgIQToEtioJl4AsC7j41AkblPTANBgkqhkiG9w0BAQUFADCB gTELMAkGA1UEBhMCR0IxGzAZBgNVBAgTEkdyZWF0ZXIgTWFuY2hlc3RlcjEQMA4G @@ -1082,14 +593,6 @@ zJVSk/BwJVmcIGfE7vmLV2H0knZ9P4SNVbfo5azV8fUZVqZa+5Acr5Pr5RzUZ5dd BA6+C4OmF4O5MBKgxTMVBbkN+8cFduPYSo38NBejxiEovjBFMR7HeL5YYTisO+IB ZQ== -----END CERTIFICATE----- - -# Issuer: CN=Network Solutions Certificate Authority O=Network Solutions L.L.C. -# Subject: CN=Network Solutions Certificate Authority O=Network Solutions L.L.C. -# Label: "Network Solutions Certificate Authority" -# Serial: 116697915152937497490437556386812487904 -# MD5 Fingerprint: d3:f3:a6:16:c0:fa:6b:1d:59:b1:2d:96:4d:0e:11:2e -# SHA1 Fingerprint: 74:f8:a3:c3:ef:e7:b3:90:06:4b:83:90:3c:21:64:60:20:e5:df:ce -# SHA256 Fingerprint: 15:f0:ba:00:a3:ac:7a:f3:ac:88:4c:07:2b:10:11:a0:77:bd:77:c0:97:f4:01:64:b2:f8:59:8a:bd:83:86:0c -----BEGIN CERTIFICATE----- MIID5jCCAs6gAwIBAgIQV8szb8JcFuZHFhfjkDFo4DANBgkqhkiG9w0BAQUFADBi MQswCQYDVQQGEwJVUzEhMB8GA1UEChMYTmV0d29yayBTb2x1dGlvbnMgTC5MLkMu @@ -1113,14 +616,6 @@ h1AcgsLj4DKAv6ALR8jDMe+ZZzKATxcheQxpXN5eNK4CtSbqUN9/GGUsyfJj4akH wKeI8lN3s2Berq4o2jUsbzRF0ybh3uxbTydrFny9RAQYgrOJeRcQcT16ohZO9QHN pGxlaKFJdlxDydi8NmdspZS11My5vWo1ViHe2MPr+8ukYEywVaCge1ey -----END CERTIFICATE----- - -# Issuer: CN=COMODO ECC Certification Authority O=COMODO CA Limited -# Subject: CN=COMODO ECC Certification Authority O=COMODO CA Limited -# Label: "COMODO ECC Certification Authority" -# Serial: 41578283867086692638256921589707938090 -# MD5 Fingerprint: 7c:62:ff:74:9d:31:53:5e:68:4a:d5:78:aa:1e:bf:23 -# SHA1 Fingerprint: 9f:74:4e:9f:2b:4d:ba:ec:0f:31:2c:50:b6:56:3b:8e:2d:93:c3:11 -# SHA256 Fingerprint: 17:93:92:7a:06:14:54:97:89:ad:ce:2f:8f:34:f7:f0:b6:6d:0f:3a:e3:a3:b8:4d:21:ec:15:db:ba:4f:ad:c7 -----BEGIN CERTIFICATE----- MIICiTCCAg+gAwIBAgIQH0evqmIAcFBUTAGem2OZKjAKBggqhkjOPQQDAzCBhTEL MAkGA1UEBhMCR0IxGzAZBgNVBAgTEkdyZWF0ZXIgTWFuY2hlc3RlcjEQMA4GA1UE @@ -1137,46 +632,6 @@ BAUwAwEB/zAKBggqhkjOPQQDAwNoADBlAjEA7wNbeqy3eApyt4jf/7VGFAkK+qDm fQjGGoe9GKhzvSbKYAydzpmfz1wPMOG+FDHqAjAU9JM8SaczepBGR7NjfRObTrdv GDeAU/7dIOA1mjbRxwG55tzd8/8dLDoWV9mSOdY= -----END CERTIFICATE----- - -# Issuer: CN=OISTE WISeKey Global Root GA CA O=WISeKey OU=Copyright (c) 2005/OISTE Foundation Endorsed -# Subject: CN=OISTE WISeKey Global Root GA CA O=WISeKey OU=Copyright (c) 2005/OISTE Foundation Endorsed -# Label: "OISTE WISeKey Global Root GA CA" -# Serial: 86718877871133159090080555911823548314 -# MD5 Fingerprint: bc:6c:51:33:a7:e9:d3:66:63:54:15:72:1b:21:92:93 -# SHA1 Fingerprint: 59:22:a1:e1:5a:ea:16:35:21:f8:98:39:6a:46:46:b0:44:1b:0f:a9 -# SHA256 Fingerprint: 41:c9:23:86:6a:b4:ca:d6:b7:ad:57:80:81:58:2e:02:07:97:a6:cb:df:4f:ff:78:ce:83:96:b3:89:37:d7:f5 ------BEGIN CERTIFICATE----- -MIID8TCCAtmgAwIBAgIQQT1yx/RrH4FDffHSKFTfmjANBgkqhkiG9w0BAQUFADCB -ijELMAkGA1UEBhMCQ0gxEDAOBgNVBAoTB1dJU2VLZXkxGzAZBgNVBAsTEkNvcHly -aWdodCAoYykgMjAwNTEiMCAGA1UECxMZT0lTVEUgRm91bmRhdGlvbiBFbmRvcnNl -ZDEoMCYGA1UEAxMfT0lTVEUgV0lTZUtleSBHbG9iYWwgUm9vdCBHQSBDQTAeFw0w -NTEyMTExNjAzNDRaFw0zNzEyMTExNjA5NTFaMIGKMQswCQYDVQQGEwJDSDEQMA4G -A1UEChMHV0lTZUtleTEbMBkGA1UECxMSQ29weXJpZ2h0IChjKSAyMDA1MSIwIAYD -VQQLExlPSVNURSBGb3VuZGF0aW9uIEVuZG9yc2VkMSgwJgYDVQQDEx9PSVNURSBX -SVNlS2V5IEdsb2JhbCBSb290IEdBIENBMIIBIjANBgkqhkiG9w0BAQEFAAOCAQ8A -MIIBCgKCAQEAy0+zAJs9Nt350UlqaxBJH+zYK7LG+DKBKUOVTJoZIyEVRd7jyBxR -VVuuk+g3/ytr6dTqvirdqFEr12bDYVxgAsj1znJ7O7jyTmUIms2kahnBAbtzptf2 -w93NvKSLtZlhuAGio9RN1AU9ka34tAhxZK9w8RxrfvbDd50kc3vkDIzh2TbhmYsF -mQvtRTEJysIA2/dyoJaqlYfQjse2YXMNdmaM3Bu0Y6Kff5MTMPGhJ9vZ/yxViJGg -4E8HsChWjBgbl0SOid3gF27nKu+POQoxhILYQBRJLnpB5Kf+42TMwVlxSywhp1t9 -4B3RLoGbw9ho972WG6xwsRYUC9tguSYBBQIDAQABo1EwTzALBgNVHQ8EBAMCAYYw -DwYDVR0TAQH/BAUwAwEB/zAdBgNVHQ4EFgQUswN+rja8sHnR3JQmthG+IbJphpQw -EAYJKwYBBAGCNxUBBAMCAQAwDQYJKoZIhvcNAQEFBQADggEBAEuh/wuHbrP5wUOx -SPMowB0uyQlB+pQAHKSkq0lPjz0e701vvbyk9vImMMkQyh2I+3QZH4VFvbBsUfk2 -ftv1TDI6QU9bR8/oCy22xBmddMVHxjtqD6wU2zz0c5ypBd8A3HR4+vg1YFkCExh8 -vPtNsCBtQ7tgMHpnM1zFmdH4LTlSc/uMqpclXHLZCB6rTjzjgTGfA6b7wP4piFXa -hNVQA7bihKOmNqoROgHhGEvWRGizPflTdISzRpFGlgC3gCy24eMQ4tui5yiPAZZi -Fj4A4xylNoEYokxSdsARo27mHbrjWr42U8U+dY+GaSlYU7Wcu2+fXMUY7N0v4ZjJ -/L7fCg0= ------END CERTIFICATE----- - -# Issuer: CN=Certigna O=Dhimyotis -# Subject: CN=Certigna O=Dhimyotis -# Label: "Certigna" -# Serial: 18364802974209362175 -# MD5 Fingerprint: ab:57:a6:5b:7d:42:82:19:b5:d8:58:26:28:5e:fd:ff -# SHA1 Fingerprint: b1:2e:13:63:45:86:a4:6f:1a:b2:60:68:37:58:2d:c4:ac:fd:94:97 -# SHA256 Fingerprint: e3:b6:a2:db:2e:d7:ce:48:84:2f:7a:c5:32:41:c7:b7:1d:54:14:4b:fb:40:c1:1f:3f:1d:0b:42:f5:ee:a1:2d -----BEGIN CERTIFICATE----- MIIDqDCCApCgAwIBAgIJAP7c4wEPyUj/MA0GCSqGSIb3DQEBBQUAMDQxCzAJBgNV BAYTAkZSMRIwEAYDVQQKDAlEaGlteW90aXMxETAPBgNVBAMMCENlcnRpZ25hMB4X @@ -1199,14 +654,6 @@ HWhBp6pX6FOqB9IG9tUUBguRA3UsbHK1YZWaDYu5Def131TN3ubY1gkIl2PlwS6w t0QmwCbAr1UwnjvVNioZBPRcHv/PLLf/0P2HQBHVESO7SMAhqaQoLf0V+LBOK/Qw WyH8EZE0vkHve52Xdf+XlcCWWC/qu0bXu+TZLg== -----END CERTIFICATE----- - -# Issuer: CN=Cybertrust Global Root O=Cybertrust, Inc -# Subject: CN=Cybertrust Global Root O=Cybertrust, Inc -# Label: "Cybertrust Global Root" -# Serial: 4835703278459682877484360 -# MD5 Fingerprint: 72:e4:4a:87:e3:69:40:80:77:ea:bc:e3:f4:ff:f0:e1 -# SHA1 Fingerprint: 5f:43:e5:b1:bf:f8:78:8c:ac:1c:c7:ca:4a:9a:c6:22:2b:cc:34:c6 -# SHA256 Fingerprint: 96:0a:df:00:63:e9:63:56:75:0c:29:65:dd:0a:08:67:da:0b:9c:bd:6e:77:71:4a:ea:fb:23:49:ab:39:3d:a3 -----BEGIN CERTIFICATE----- MIIDoTCCAomgAwIBAgILBAAAAAABD4WqLUgwDQYJKoZIhvcNAQEFBQAwOzEYMBYG A1UEChMPQ3liZXJ0cnVzdCwgSW5jMR8wHQYDVQQDExZDeWJlcnRydXN0IEdsb2Jh @@ -1229,14 +676,6 @@ omcrUtW3ZfA5TGOgkXmTUg9U3YO7n9GPp1Nzw8v/MOx8BLjYRB+TX3EJIrduPuoc A06dGiBh+4E37F78CkWr1+cXVdCg6mCbpvbjjFspwgZgFJ0tl0ypkxWdYcQBX0jW WL1WMRJOEcgh4LMRkWXbtKaIOM5V -----END CERTIFICATE----- - -# Issuer: O=Chunghwa Telecom Co., Ltd. OU=ePKI Root Certification Authority -# Subject: O=Chunghwa Telecom Co., Ltd. OU=ePKI Root Certification Authority -# Label: "ePKI Root Certification Authority" -# Serial: 28956088682735189655030529057352760477 -# MD5 Fingerprint: 1b:2e:00:ca:26:06:90:3d:ad:fe:6f:15:68:d3:6b:b3 -# SHA1 Fingerprint: 67:65:0d:f1:7e:8e:7e:5b:82:40:a4:f4:56:4b:cf:e2:3d:69:c6:f0 -# SHA256 Fingerprint: c0:a6:f4:dc:63:a2:4b:fd:cf:54:ef:2a:6a:08:2a:0a:72:de:35:80:3e:2f:f5:ff:52:7a:e5:d8:72:06:df:d5 -----BEGIN CERTIFICATE----- MIIFsDCCA5igAwIBAgIQFci9ZUdcr7iXAF7kBtK8nTANBgkqhkiG9w0BAQUFADBe MQswCQYDVQQGEwJUVzEjMCEGA1UECgwaQ2h1bmdod2EgVGVsZWNvbSBDby4sIEx0 @@ -1270,14 +709,6 @@ Gp1iro2C6pSe3VkQw63d4k3jMdXH7OjysP6SHhYKGvzZ8/gntsm+HbRsZJB/9OTE W9c3rkIO3aQab3yIVMUWbuF6aC74Or8NpDyJO3inTmODBCEIZ43ygknQW/2xzQ+D hNQ+IIX3Sj0rnP0qCglN6oH4EZw= -----END CERTIFICATE----- - -# Issuer: O=certSIGN OU=certSIGN ROOT CA -# Subject: O=certSIGN OU=certSIGN ROOT CA -# Label: "certSIGN ROOT CA" -# Serial: 35210227249154 -# MD5 Fingerprint: 18:98:c0:d6:e9:3a:fc:f9:b0:f5:0c:f7:4b:01:44:17 -# SHA1 Fingerprint: fa:b7:ee:36:97:26:62:fb:2d:b0:2a:f6:bf:03:fd:e8:7c:4b:2f:9b -# SHA256 Fingerprint: ea:a9:62:c4:fa:4a:6b:af:eb:e4:15:19:6d:35:1c:cd:88:8d:4f:53:f3:fa:8a:e6:d7:c4:66:a9:4e:60:42:bb -----BEGIN CERTIFICATE----- MIIDODCCAiCgAwIBAgIGIAYFFnACMA0GCSqGSIb3DQEBBQUAMDsxCzAJBgNVBAYT AlJPMREwDwYDVQQKEwhjZXJ0U0lHTjEZMBcGA1UECxMQY2VydFNJR04gUk9PVCBD @@ -1298,193 +729,6 @@ Jd1hJyMctTEHBDa0GpC9oHRxUIltvBTjD4au8as+x6AJzKNI0eDbZOeStc+vckNw i/nDhDwTqn6Sm1dTk/pwwpEOMfmbZ13pljheX7NzTogVZ96edhBiIL5VaZVDADlN 9u6wWk5JRFRYX0KD -----END CERTIFICATE----- - -# Issuer: CN=GeoTrust Primary Certification Authority - G3 O=GeoTrust Inc. OU=(c) 2008 GeoTrust Inc. - For authorized use only -# Subject: CN=GeoTrust Primary Certification Authority - G3 O=GeoTrust Inc. OU=(c) 2008 GeoTrust Inc. - For authorized use only -# Label: "GeoTrust Primary Certification Authority - G3" -# Serial: 28809105769928564313984085209975885599 -# MD5 Fingerprint: b5:e8:34:36:c9:10:44:58:48:70:6d:2e:83:d4:b8:05 -# SHA1 Fingerprint: 03:9e:ed:b8:0b:e7:a0:3c:69:53:89:3b:20:d2:d9:32:3a:4c:2a:fd -# SHA256 Fingerprint: b4:78:b8:12:25:0d:f8:78:63:5c:2a:a7:ec:7d:15:5e:aa:62:5e:e8:29:16:e2:cd:29:43:61:88:6c:d1:fb:d4 ------BEGIN CERTIFICATE----- -MIID/jCCAuagAwIBAgIQFaxulBmyeUtB9iepwxgPHzANBgkqhkiG9w0BAQsFADCB -mDELMAkGA1UEBhMCVVMxFjAUBgNVBAoTDUdlb1RydXN0IEluYy4xOTA3BgNVBAsT -MChjKSAyMDA4IEdlb1RydXN0IEluYy4gLSBGb3IgYXV0aG9yaXplZCB1c2Ugb25s -eTE2MDQGA1UEAxMtR2VvVHJ1c3QgUHJpbWFyeSBDZXJ0aWZpY2F0aW9uIEF1dGhv -cml0eSAtIEczMB4XDTA4MDQwMjAwMDAwMFoXDTM3MTIwMTIzNTk1OVowgZgxCzAJ -BgNVBAYTAlVTMRYwFAYDVQQKEw1HZW9UcnVzdCBJbmMuMTkwNwYDVQQLEzAoYykg -MjAwOCBHZW9UcnVzdCBJbmMuIC0gRm9yIGF1dGhvcml6ZWQgdXNlIG9ubHkxNjA0 -BgNVBAMTLUdlb1RydXN0IFByaW1hcnkgQ2VydGlmaWNhdGlvbiBBdXRob3JpdHkg -LSBHMzCCASIwDQYJKoZIhvcNAQEBBQADggEPADCCAQoCggEBANziXmJYHTNXOTIz -+uvLh4yn1ErdBojqZI4xmKU4kB6Yzy5jK/BGvESyiaHAKAxJcCGVn2TAppMSAmUm -hsalifD614SgcK9PGpc/BkTVyetyEH3kMSj7HGHmKAdEc5IiaacDiGydY8hS2pgn -5whMcD60yRLBxWeDXTPzAxHsatBT4tG6NmCUgLthY2xbF37fQJQeqw3CIShwiP/W -JmxsYAQlTlV+fe+/lEjetx3dcI0FX4ilm/LC7urRQEFtYjgdVgbFA0dRIBn8exAL -DmKudlW/X3e+PkkBUz2YJQN2JFodtNuJ6nnltrM7P7pMKEF/BqxqjsHQ9gUdfeZC -huOl1UcCAwEAAaNCMEAwDwYDVR0TAQH/BAUwAwEB/zAOBgNVHQ8BAf8EBAMCAQYw -HQYDVR0OBBYEFMR5yo6hTgMdHNxr2zFblD4/MH8tMA0GCSqGSIb3DQEBCwUAA4IB -AQAtxRPPVoB7eni9n64smefv2t+UXglpp+duaIy9cr5HqQ6XErhK8WTTOd8lNNTB -zU6B8A8ExCSzNJbGpqow32hhc9f5joWJ7w5elShKKiePEI4ufIbEAp7aDHdlDkQN -kv39sxY2+hENHYwOB4lqKVb3cvTdFZx3NWZXqxNT2I7BQMXXExZacse3aQHEerGD -AWh9jUGhlBjBJVz88P6DAod8DQ3PLghcSkANPuyBYeYk28rgDi0Hsj5W3I31QYUH -SJsMC8tJP33st/3LjWeJGqvtux6jAAgIFyqCXDFdRootD4abdNlF+9RAsXqqaC2G -spki4cErx5z481+oghLrGREt ------END CERTIFICATE----- - -# Issuer: CN=thawte Primary Root CA - G2 O=thawte, Inc. OU=(c) 2007 thawte, Inc. - For authorized use only -# Subject: CN=thawte Primary Root CA - G2 O=thawte, Inc. OU=(c) 2007 thawte, Inc. - For authorized use only -# Label: "thawte Primary Root CA - G2" -# Serial: 71758320672825410020661621085256472406 -# MD5 Fingerprint: 74:9d:ea:60:24:c4:fd:22:53:3e:cc:3a:72:d9:29:4f -# SHA1 Fingerprint: aa:db:bc:22:23:8f:c4:01:a1:27:bb:38:dd:f4:1d:db:08:9e:f0:12 -# SHA256 Fingerprint: a4:31:0d:50:af:18:a6:44:71:90:37:2a:86:af:af:8b:95:1f:fb:43:1d:83:7f:1e:56:88:b4:59:71:ed:15:57 ------BEGIN CERTIFICATE----- -MIICiDCCAg2gAwIBAgIQNfwmXNmET8k9Jj1Xm67XVjAKBggqhkjOPQQDAzCBhDEL -MAkGA1UEBhMCVVMxFTATBgNVBAoTDHRoYXd0ZSwgSW5jLjE4MDYGA1UECxMvKGMp -IDIwMDcgdGhhd3RlLCBJbmMuIC0gRm9yIGF1dGhvcml6ZWQgdXNlIG9ubHkxJDAi -BgNVBAMTG3RoYXd0ZSBQcmltYXJ5IFJvb3QgQ0EgLSBHMjAeFw0wNzExMDUwMDAw -MDBaFw0zODAxMTgyMzU5NTlaMIGEMQswCQYDVQQGEwJVUzEVMBMGA1UEChMMdGhh -d3RlLCBJbmMuMTgwNgYDVQQLEy8oYykgMjAwNyB0aGF3dGUsIEluYy4gLSBGb3Ig -YXV0aG9yaXplZCB1c2Ugb25seTEkMCIGA1UEAxMbdGhhd3RlIFByaW1hcnkgUm9v -dCBDQSAtIEcyMHYwEAYHKoZIzj0CAQYFK4EEACIDYgAEotWcgnuVnfFSeIf+iha/ -BebfowJPDQfGAFG6DAJSLSKkQjnE/o/qycG+1E3/n3qe4rF8mq2nhglzh9HnmuN6 -papu+7qzcMBniKI11KOasf2twu8x+qi58/sIxpHR+ymVo0IwQDAPBgNVHRMBAf8E -BTADAQH/MA4GA1UdDwEB/wQEAwIBBjAdBgNVHQ4EFgQUmtgAMADna3+FGO6Lts6K -DPgR4bswCgYIKoZIzj0EAwMDaQAwZgIxAN344FdHW6fmCsO99YCKlzUNG4k8VIZ3 -KMqh9HneteY4sPBlcIx/AlTCv//YoT7ZzwIxAMSNlPzcU9LcnXgWHxUzI1NS41ox -XZ3Krr0TKUQNJ1uo52icEvdYPy5yAlejj6EULg== ------END CERTIFICATE----- - -# Issuer: CN=thawte Primary Root CA - G3 O=thawte, Inc. OU=Certification Services Division/(c) 2008 thawte, Inc. - For authorized use only -# Subject: CN=thawte Primary Root CA - G3 O=thawte, Inc. OU=Certification Services Division/(c) 2008 thawte, Inc. - For authorized use only -# Label: "thawte Primary Root CA - G3" -# Serial: 127614157056681299805556476275995414779 -# MD5 Fingerprint: fb:1b:5d:43:8a:94:cd:44:c6:76:f2:43:4b:47:e7:31 -# SHA1 Fingerprint: f1:8b:53:8d:1b:e9:03:b6:a6:f0:56:43:5b:17:15:89:ca:f3:6b:f2 -# SHA256 Fingerprint: 4b:03:f4:58:07:ad:70:f2:1b:fc:2c:ae:71:c9:fd:e4:60:4c:06:4c:f5:ff:b6:86:ba:e5:db:aa:d7:fd:d3:4c ------BEGIN CERTIFICATE----- -MIIEKjCCAxKgAwIBAgIQYAGXt0an6rS0mtZLL/eQ+zANBgkqhkiG9w0BAQsFADCB -rjELMAkGA1UEBhMCVVMxFTATBgNVBAoTDHRoYXd0ZSwgSW5jLjEoMCYGA1UECxMf -Q2VydGlmaWNhdGlvbiBTZXJ2aWNlcyBEaXZpc2lvbjE4MDYGA1UECxMvKGMpIDIw -MDggdGhhd3RlLCBJbmMuIC0gRm9yIGF1dGhvcml6ZWQgdXNlIG9ubHkxJDAiBgNV -BAMTG3RoYXd0ZSBQcmltYXJ5IFJvb3QgQ0EgLSBHMzAeFw0wODA0MDIwMDAwMDBa -Fw0zNzEyMDEyMzU5NTlaMIGuMQswCQYDVQQGEwJVUzEVMBMGA1UEChMMdGhhd3Rl -LCBJbmMuMSgwJgYDVQQLEx9DZXJ0aWZpY2F0aW9uIFNlcnZpY2VzIERpdmlzaW9u -MTgwNgYDVQQLEy8oYykgMjAwOCB0aGF3dGUsIEluYy4gLSBGb3IgYXV0aG9yaXpl -ZCB1c2Ugb25seTEkMCIGA1UEAxMbdGhhd3RlIFByaW1hcnkgUm9vdCBDQSAtIEcz -MIIBIjANBgkqhkiG9w0BAQEFAAOCAQ8AMIIBCgKCAQEAsr8nLPvb2FvdeHsbnndm -gcs+vHyu86YnmjSjaDFxODNi5PNxZnmxqWWjpYvVj2AtP0LMqmsywCPLLEHd5N/8 -YZzic7IilRFDGF/Eth9XbAoFWCLINkw6fKXRz4aviKdEAhN0cXMKQlkC+BsUa0Lf -b1+6a4KinVvnSr0eAXLbS3ToO39/fR8EtCab4LRarEc9VbjXsCZSKAExQGbY2SS9 -9irY7CFJXJv2eul/VTV+lmuNk5Mny5K76qxAwJ/C+IDPXfRa3M50hqY+bAtTyr2S -zhkGcuYMXDhpxwTWvGzOW/b3aJzcJRVIiKHpqfiYnODz1TEoYRFsZ5aNOZnLwkUk -OQIDAQABo0IwQDAPBgNVHRMBAf8EBTADAQH/MA4GA1UdDwEB/wQEAwIBBjAdBgNV -HQ4EFgQUrWyqlGCc7eT/+j4KdCtjA/e2Wb8wDQYJKoZIhvcNAQELBQADggEBABpA -2JVlrAmSicY59BDlqQ5mU1143vokkbvnRFHfxhY0Cu9qRFHqKweKA3rD6z8KLFIW -oCtDuSWQP3CpMyVtRRooOyfPqsMpQhvfO0zAMzRbQYi/aytlryjvsvXDqmbOe1bu -t8jLZ8HJnBoYuMTDSQPxYA5QzUbF83d597YV4Djbxy8ooAw/dyZ02SUS2jHaGh7c -KUGRIjxpp7sC8rZcJwOJ9Abqm+RyguOhCcHpABnTPtRwa7pxpqpYrvS76Wy274fM -m7v/OeZWYdMKp8RcTGB7BXcmer/YB1IsYvdwY9k5vG8cwnncdimvzsUsZAReiDZu -MdRAGmI0Nj81Aa6sY6A= ------END CERTIFICATE----- - -# Issuer: CN=GeoTrust Primary Certification Authority - G2 O=GeoTrust Inc. OU=(c) 2007 GeoTrust Inc. - For authorized use only -# Subject: CN=GeoTrust Primary Certification Authority - G2 O=GeoTrust Inc. OU=(c) 2007 GeoTrust Inc. - For authorized use only -# Label: "GeoTrust Primary Certification Authority - G2" -# Serial: 80682863203381065782177908751794619243 -# MD5 Fingerprint: 01:5e:d8:6b:bd:6f:3d:8e:a1:31:f8:12:e0:98:73:6a -# SHA1 Fingerprint: 8d:17:84:d5:37:f3:03:7d:ec:70:fe:57:8b:51:9a:99:e6:10:d7:b0 -# SHA256 Fingerprint: 5e:db:7a:c4:3b:82:a0:6a:87:61:e8:d7:be:49:79:eb:f2:61:1f:7d:d7:9b:f9:1c:1c:6b:56:6a:21:9e:d7:66 ------BEGIN CERTIFICATE----- -MIICrjCCAjWgAwIBAgIQPLL0SAoA4v7rJDteYD7DazAKBggqhkjOPQQDAzCBmDEL -MAkGA1UEBhMCVVMxFjAUBgNVBAoTDUdlb1RydXN0IEluYy4xOTA3BgNVBAsTMChj -KSAyMDA3IEdlb1RydXN0IEluYy4gLSBGb3IgYXV0aG9yaXplZCB1c2Ugb25seTE2 -MDQGA1UEAxMtR2VvVHJ1c3QgUHJpbWFyeSBDZXJ0aWZpY2F0aW9uIEF1dGhvcml0 -eSAtIEcyMB4XDTA3MTEwNTAwMDAwMFoXDTM4MDExODIzNTk1OVowgZgxCzAJBgNV -BAYTAlVTMRYwFAYDVQQKEw1HZW9UcnVzdCBJbmMuMTkwNwYDVQQLEzAoYykgMjAw -NyBHZW9UcnVzdCBJbmMuIC0gRm9yIGF1dGhvcml6ZWQgdXNlIG9ubHkxNjA0BgNV -BAMTLUdlb1RydXN0IFByaW1hcnkgQ2VydGlmaWNhdGlvbiBBdXRob3JpdHkgLSBH -MjB2MBAGByqGSM49AgEGBSuBBAAiA2IABBWx6P0DFUPlrOuHNxFi79KDNlJ9RVcL -So17VDs6bl8VAsBQps8lL33KSLjHUGMcKiEIfJo22Av+0SbFWDEwKCXzXV2juLal -tJLtbCyf691DiaI8S0iRHVDsJt/WYC69IaNCMEAwDwYDVR0TAQH/BAUwAwEB/zAO -BgNVHQ8BAf8EBAMCAQYwHQYDVR0OBBYEFBVfNVdRVfslsq0DafwBo/q+EVXVMAoG -CCqGSM49BAMDA2cAMGQCMGSWWaboCd6LuvpaiIjwH5HTRqjySkwCY/tsXzjbLkGT -qQ7mndwxHLKgpxgceeHHNgIwOlavmnRs9vuD4DPTCF+hnMJbn0bWtsuRBmOiBucz -rD6ogRLQy7rQkgu2npaqBA+K ------END CERTIFICATE----- - -# Issuer: CN=VeriSign Universal Root Certification Authority O=VeriSign, Inc. OU=VeriSign Trust Network/(c) 2008 VeriSign, Inc. - For authorized use only -# Subject: CN=VeriSign Universal Root Certification Authority O=VeriSign, Inc. OU=VeriSign Trust Network/(c) 2008 VeriSign, Inc. - For authorized use only -# Label: "VeriSign Universal Root Certification Authority" -# Serial: 85209574734084581917763752644031726877 -# MD5 Fingerprint: 8e:ad:b5:01:aa:4d:81:e4:8c:1d:d1:e1:14:00:95:19 -# SHA1 Fingerprint: 36:79:ca:35:66:87:72:30:4d:30:a5:fb:87:3b:0f:a7:7b:b7:0d:54 -# SHA256 Fingerprint: 23:99:56:11:27:a5:71:25:de:8c:ef:ea:61:0d:df:2f:a0:78:b5:c8:06:7f:4e:82:82:90:bf:b8:60:e8:4b:3c ------BEGIN CERTIFICATE----- -MIIEuTCCA6GgAwIBAgIQQBrEZCGzEyEDDrvkEhrFHTANBgkqhkiG9w0BAQsFADCB -vTELMAkGA1UEBhMCVVMxFzAVBgNVBAoTDlZlcmlTaWduLCBJbmMuMR8wHQYDVQQL -ExZWZXJpU2lnbiBUcnVzdCBOZXR3b3JrMTowOAYDVQQLEzEoYykgMjAwOCBWZXJp -U2lnbiwgSW5jLiAtIEZvciBhdXRob3JpemVkIHVzZSBvbmx5MTgwNgYDVQQDEy9W -ZXJpU2lnbiBVbml2ZXJzYWwgUm9vdCBDZXJ0aWZpY2F0aW9uIEF1dGhvcml0eTAe -Fw0wODA0MDIwMDAwMDBaFw0zNzEyMDEyMzU5NTlaMIG9MQswCQYDVQQGEwJVUzEX -MBUGA1UEChMOVmVyaVNpZ24sIEluYy4xHzAdBgNVBAsTFlZlcmlTaWduIFRydXN0 -IE5ldHdvcmsxOjA4BgNVBAsTMShjKSAyMDA4IFZlcmlTaWduLCBJbmMuIC0gRm9y -IGF1dGhvcml6ZWQgdXNlIG9ubHkxODA2BgNVBAMTL1ZlcmlTaWduIFVuaXZlcnNh -bCBSb290IENlcnRpZmljYXRpb24gQXV0aG9yaXR5MIIBIjANBgkqhkiG9w0BAQEF -AAOCAQ8AMIIBCgKCAQEAx2E3XrEBNNti1xWb/1hajCMj1mCOkdeQmIN65lgZOIzF -9uVkhbSicfvtvbnazU0AtMgtc6XHaXGVHzk8skQHnOgO+k1KxCHfKWGPMiJhgsWH -H26MfF8WIFFE0XBPV+rjHOPMee5Y2A7Cs0WTwCznmhcrewA3ekEzeOEz4vMQGn+H -LL729fdC4uW/h2KJXwBL38Xd5HVEMkE6HnFuacsLdUYI0crSK5XQz/u5QGtkjFdN -/BMReYTtXlT2NJ8IAfMQJQYXStrxHXpma5hgZqTZ79IugvHw7wnqRMkVauIDbjPT -rJ9VAMf2CGqUuV/c4DPxhGD5WycRtPwW8rtWaoAljQIDAQABo4GyMIGvMA8GA1Ud -EwEB/wQFMAMBAf8wDgYDVR0PAQH/BAQDAgEGMG0GCCsGAQUFBwEMBGEwX6FdoFsw -WTBXMFUWCWltYWdlL2dpZjAhMB8wBwYFKw4DAhoEFI/l0xqGrI2Oa8PPgGrUSBgs -exkuMCUWI2h0dHA6Ly9sb2dvLnZlcmlzaWduLmNvbS92c2xvZ28uZ2lmMB0GA1Ud -DgQWBBS2d/ppSEefUxLVwuoHMnYH0ZcHGTANBgkqhkiG9w0BAQsFAAOCAQEASvj4 -sAPmLGd75JR3Y8xuTPl9Dg3cyLk1uXBPY/ok+myDjEedO2Pzmvl2MpWRsXe8rJq+ -seQxIcaBlVZaDrHC1LGmWazxY8u4TB1ZkErvkBYoH1quEPuBUDgMbMzxPcP1Y+Oz -4yHJJDnp/RVmRvQbEdBNc6N9Rvk97ahfYtTxP/jgdFcrGJ2BtMQo2pSXpXDrrB2+ -BxHw1dvd5Yzw1TKwg+ZX4o+/vqGqvz0dtdQ46tewXDpPaj+PwGZsY6rp2aQW9IHR -lRQOfc2VNNnSj3BzgXucfr2YYdhFh5iQxeuGMMY1v/D/w1WIg0vvBZIGcfK4mJO3 -7M2CYfE45k+XmCpajQ== ------END CERTIFICATE----- - -# Issuer: CN=VeriSign Class 3 Public Primary Certification Authority - G4 O=VeriSign, Inc. OU=VeriSign Trust Network/(c) 2007 VeriSign, Inc. - For authorized use only -# Subject: CN=VeriSign Class 3 Public Primary Certification Authority - G4 O=VeriSign, Inc. OU=VeriSign Trust Network/(c) 2007 VeriSign, Inc. - For authorized use only -# Label: "VeriSign Class 3 Public Primary Certification Authority - G4" -# Serial: 63143484348153506665311985501458640051 -# MD5 Fingerprint: 3a:52:e1:e7:fd:6f:3a:e3:6f:f3:6f:99:1b:f9:22:41 -# SHA1 Fingerprint: 22:d5:d8:df:8f:02:31:d1:8d:f7:9d:b7:cf:8a:2d:64:c9:3f:6c:3a -# SHA256 Fingerprint: 69:dd:d7:ea:90:bb:57:c9:3e:13:5d:c8:5e:a6:fc:d5:48:0b:60:32:39:bd:c4:54:fc:75:8b:2a:26:cf:7f:79 ------BEGIN CERTIFICATE----- -MIIDhDCCAwqgAwIBAgIQL4D+I4wOIg9IZxIokYesszAKBggqhkjOPQQDAzCByjEL -MAkGA1UEBhMCVVMxFzAVBgNVBAoTDlZlcmlTaWduLCBJbmMuMR8wHQYDVQQLExZW -ZXJpU2lnbiBUcnVzdCBOZXR3b3JrMTowOAYDVQQLEzEoYykgMjAwNyBWZXJpU2ln -biwgSW5jLiAtIEZvciBhdXRob3JpemVkIHVzZSBvbmx5MUUwQwYDVQQDEzxWZXJp -U2lnbiBDbGFzcyAzIFB1YmxpYyBQcmltYXJ5IENlcnRpZmljYXRpb24gQXV0aG9y -aXR5IC0gRzQwHhcNMDcxMTA1MDAwMDAwWhcNMzgwMTE4MjM1OTU5WjCByjELMAkG -A1UEBhMCVVMxFzAVBgNVBAoTDlZlcmlTaWduLCBJbmMuMR8wHQYDVQQLExZWZXJp -U2lnbiBUcnVzdCBOZXR3b3JrMTowOAYDVQQLEzEoYykgMjAwNyBWZXJpU2lnbiwg -SW5jLiAtIEZvciBhdXRob3JpemVkIHVzZSBvbmx5MUUwQwYDVQQDEzxWZXJpU2ln -biBDbGFzcyAzIFB1YmxpYyBQcmltYXJ5IENlcnRpZmljYXRpb24gQXV0aG9yaXR5 -IC0gRzQwdjAQBgcqhkjOPQIBBgUrgQQAIgNiAASnVnp8Utpkmw4tXNherJI9/gHm -GUo9FANL+mAnINmDiWn6VMaaGF5VKmTeBvaNSjutEDxlPZCIBIngMGGzrl0Bp3ve -fLK+ymVhAIau2o970ImtTR1ZmkGxvEeA3J5iw/mjgbIwga8wDwYDVR0TAQH/BAUw -AwEB/zAOBgNVHQ8BAf8EBAMCAQYwbQYIKwYBBQUHAQwEYTBfoV2gWzBZMFcwVRYJ -aW1hZ2UvZ2lmMCEwHzAHBgUrDgMCGgQUj+XTGoasjY5rw8+AatRIGCx7GS4wJRYj -aHR0cDovL2xvZ28udmVyaXNpZ24uY29tL3ZzbG9nby5naWYwHQYDVR0OBBYEFLMW -kf3upm7ktS5Jj4d4gYDs5bG1MAoGCCqGSM49BAMDA2gAMGUCMGYhDBgmYFo4e1ZC -4Kf8NoRRkSAsdk1DPcQdhCPQrNZ8NQbOzWm9kA3bbEhCHQ6qQgIxAJw9SDkjOVga -FRJZap7v1VmyHVIsmXHNxynfGyphe3HR3vPA5Q06Sqotp9iGKt0uEA== ------END CERTIFICATE----- - -# Issuer: CN=NetLock Arany (Class Gold) Főtanúsítvány O=NetLock Kft. OU=Tanúsítványkiadók (Certification Services) -# Subject: CN=NetLock Arany (Class Gold) Főtanúsítvány O=NetLock Kft. OU=Tanúsítványkiadók (Certification Services) -# Label: "NetLock Arany (Class Gold) Főtanúsítvány" -# Serial: 80544274841616 -# MD5 Fingerprint: c5:a1:b7:ff:73:dd:d6:d7:34:32:18:df:fc:3c:ad:88 -# SHA1 Fingerprint: 06:08:3f:59:3f:15:a1:04:a0:69:a4:6b:a9:03:d0:06:b7:97:09:91 -# SHA256 Fingerprint: 6c:61:da:c3:a2:de:f0:31:50:6b:e0:36:d2:a6:fe:40:19:94:fb:d1:3d:f9:c8:d4:66:59:92:74:c4:46:ec:98 -----BEGIN CERTIFICATE----- MIIEFTCCAv2gAwIBAgIGSUEs5AAQMA0GCSqGSIb3DQEBCwUAMIGnMQswCQYDVQQG EwJIVTERMA8GA1UEBwwIQnVkYXBlc3QxFTATBgNVBAoMDE5ldExvY2sgS2Z0LjE3 @@ -1509,55 +753,6 @@ bLBQWV2QWzuoDTDPv31/zvGdg73JRm4gpvlhUbohL3u+pRVjodSVh/GeufOJ8z2F uLjbvrW5KfnaNwUASZQDhETnv0Mxz3WLJdH0pmT1kvarBes96aULNmLazAZfNou2 XjG4Kvte9nHfRCaexOYNkbQudZWAUWpLMKawYqGT8ZvYzsRjdT9ZR7E= -----END CERTIFICATE----- - -# Issuer: CN=Staat der Nederlanden Root CA - G2 O=Staat der Nederlanden -# Subject: CN=Staat der Nederlanden Root CA - G2 O=Staat der Nederlanden -# Label: "Staat der Nederlanden Root CA - G2" -# Serial: 10000012 -# MD5 Fingerprint: 7c:a5:0f:f8:5b:9a:7d:6d:30:ae:54:5a:e3:42:a2:8a -# SHA1 Fingerprint: 59:af:82:79:91:86:c7:b4:75:07:cb:cf:03:57:46:eb:04:dd:b7:16 -# SHA256 Fingerprint: 66:8c:83:94:7d:a6:3b:72:4b:ec:e1:74:3c:31:a0:e6:ae:d0:db:8e:c5:b3:1b:e3:77:bb:78:4f:91:b6:71:6f ------BEGIN CERTIFICATE----- -MIIFyjCCA7KgAwIBAgIEAJiWjDANBgkqhkiG9w0BAQsFADBaMQswCQYDVQQGEwJO -TDEeMBwGA1UECgwVU3RhYXQgZGVyIE5lZGVybGFuZGVuMSswKQYDVQQDDCJTdGFh -dCBkZXIgTmVkZXJsYW5kZW4gUm9vdCBDQSAtIEcyMB4XDTA4MDMyNjExMTgxN1oX -DTIwMDMyNTExMDMxMFowWjELMAkGA1UEBhMCTkwxHjAcBgNVBAoMFVN0YWF0IGRl -ciBOZWRlcmxhbmRlbjErMCkGA1UEAwwiU3RhYXQgZGVyIE5lZGVybGFuZGVuIFJv -b3QgQ0EgLSBHMjCCAiIwDQYJKoZIhvcNAQEBBQADggIPADCCAgoCggIBAMVZ5291 -qj5LnLW4rJ4L5PnZyqtdj7U5EILXr1HgO+EASGrP2uEGQxGZqhQlEq0i6ABtQ8Sp -uOUfiUtnvWFI7/3S4GCI5bkYYCjDdyutsDeqN95kWSpGV+RLufg3fNU254DBtvPU -Z5uW6M7XxgpT0GtJlvOjCwV3SPcl5XCsMBQgJeN/dVrlSPhOewMHBPqCYYdu8DvE -pMfQ9XQ+pV0aCPKbJdL2rAQmPlU6Yiile7Iwr/g3wtG61jj99O9JMDeZJiFIhQGp -5Rbn3JBV3w/oOM2ZNyFPXfUib2rFEhZgF1XyZWampzCROME4HYYEhLoaJXhena/M -UGDWE4dS7WMfbWV9whUYdMrhfmQpjHLYFhN9C0lK8SgbIHRrxT3dsKpICT0ugpTN -GmXZK4iambwYfp/ufWZ8Pr2UuIHOzZgweMFvZ9C+X+Bo7d7iscksWXiSqt8rYGPy -5V6548r6f1CGPqI0GAwJaCgRHOThuVw+R7oyPxjMW4T182t0xHJ04eOLoEq9jWYv -6q012iDTiIJh8BIitrzQ1aTsr1SIJSQ8p22xcik/Plemf1WvbibG/ufMQFxRRIEK -eN5KzlW/HdXZt1bv8Hb/C3m1r737qWmRRpdogBQ2HbN/uymYNqUg+oJgYjOk7Na6 -B6duxc8UpufWkjTYgfX8HV2qXB72o007uPc5AgMBAAGjgZcwgZQwDwYDVR0TAQH/ -BAUwAwEB/zBSBgNVHSAESzBJMEcGBFUdIAAwPzA9BggrBgEFBQcCARYxaHR0cDov -L3d3dy5wa2lvdmVyaGVpZC5ubC9wb2xpY2llcy9yb290LXBvbGljeS1HMjAOBgNV -HQ8BAf8EBAMCAQYwHQYDVR0OBBYEFJFoMocVHYnitfGsNig0jQt8YojrMA0GCSqG -SIb3DQEBCwUAA4ICAQCoQUpnKpKBglBu4dfYszk78wIVCVBR7y29JHuIhjv5tLyS -CZa59sCrI2AGeYwRTlHSeYAz+51IvuxBQ4EffkdAHOV6CMqqi3WtFMTC6GY8ggen -5ieCWxjmD27ZUD6KQhgpxrRW/FYQoAUXvQwjf/ST7ZwaUb7dRUG/kSS0H4zpX897 -IZmflZ85OkYcbPnNe5yQzSipx6lVu6xiNGI1E0sUOlWDuYaNkqbG9AclVMwWVxJK -gnjIFNkXgiYtXSAfea7+1HAWFpWD2DU5/1JddRwWxRNVz0fMdWVSSt7wsKfkCpYL -+63C4iWEst3kvX5ZbJvw8NjnyvLplzh+ib7M+zkXYT9y2zqR2GUBGR2tUKRXCnxL -vJxxcypFURmFzI79R6d0lR2o0a9OF7FpJsKqeFdbxU2n5Z4FF5TKsl+gSRiNNOkm -bEgeqmiSBeGCc1qb3AdbCG19ndeNIdn8FCCqwkXfP+cAslHkwvgFuXkajDTznlvk -N1trSt8sV4pAWja63XVECDdCcAz+3F4hoKOKwJCcaNpQ5kUQR3i2TtJlycM33+FC -Y7BXN0Ute4qcvwXqZVUz9zkQxSgqIXobisQk+T8VyJoVIPVVYpbtbZNQvOSqeK3Z -ywplh6ZmwcSBo3c6WB4L7oOLnR7SUqTMHW+wmG2UMbX4cQrcufx9MmDm66+KAQ== ------END CERTIFICATE----- - -# Issuer: CN=Hongkong Post Root CA 1 O=Hongkong Post -# Subject: CN=Hongkong Post Root CA 1 O=Hongkong Post -# Label: "Hongkong Post Root CA 1" -# Serial: 1000 -# MD5 Fingerprint: a8:0d:6f:39:78:b9:43:6d:77:42:6d:98:5a:cc:23:ca -# SHA1 Fingerprint: d6:da:a8:20:8d:09:d2:15:4d:24:b5:2f:cb:34:6e:b2:58:b2:8a:58 -# SHA256 Fingerprint: f9:e6:7d:33:6c:51:00:2a:c0:54:c6:32:02:2d:66:dd:a2:e7:e3:ff:f1:0a:d0:61:ed:31:d8:bb:b4:10:cf:b2 -----BEGIN CERTIFICATE----- MIIDMDCCAhigAwIBAgICA+gwDQYJKoZIhvcNAQEFBQAwRzELMAkGA1UEBhMCSEsx FjAUBgNVBAoTDUhvbmdrb25nIFBvc3QxIDAeBgNVBAMTF0hvbmdrb25nIFBvc3Qg @@ -1578,14 +773,6 @@ EhTkYY2sEJCehFC78JZvRZ+K88psT/oROhUVRsPNH4NbLUES7VBnQRM9IauUiqpO fMGx+6fWtScvl6tu4B3i0RwsH0Ti/L6RoZz71ilTc4afU9hDDl3WY4JxHYB0yvbi AmvZWg== -----END CERTIFICATE----- - -# Issuer: CN=SecureSign RootCA11 O=Japan Certification Services, Inc. -# Subject: CN=SecureSign RootCA11 O=Japan Certification Services, Inc. -# Label: "SecureSign RootCA11" -# Serial: 1 -# MD5 Fingerprint: b7:52:74:e2:92:b4:80:93:f2:75:e4:cc:d7:f2:ea:26 -# SHA1 Fingerprint: 3b:c4:9f:48:f8:f3:73:a0:9c:1e:bd:f8:5b:b1:c3:65:c7:d8:11:b3 -# SHA256 Fingerprint: bf:0f:ee:fb:9e:3a:58:1a:d5:f9:e9:db:75:89:98:57:43:d2:61:08:5c:4d:31:4f:6f:5d:72:59:aa:42:16:12 -----BEGIN CERTIFICATE----- MIIDbTCCAlWgAwIBAgIBATANBgkqhkiG9w0BAQUFADBYMQswCQYDVQQGEwJKUDEr MCkGA1UEChMiSmFwYW4gQ2VydGlmaWNhdGlvbiBTZXJ2aWNlcywgSW5jLjEcMBoG @@ -1607,14 +794,6 @@ QbJUb9wlze144o4MjQlJ3WN7WmmWAiGovVJZ6X01y8hSyn+B/tlr0/cR7SXf+Of5 pPpyl4RTDaXQMhhRdlkUbA/r7F+AjHVDg8OFmP9Mni0N5HeDk061lgeLKBObjBmN QSdJQO7e5iNEOdyhIta6A/I= -----END CERTIFICATE----- - -# Issuer: CN=Microsec e-Szigno Root CA 2009 O=Microsec Ltd. -# Subject: CN=Microsec e-Szigno Root CA 2009 O=Microsec Ltd. -# Label: "Microsec e-Szigno Root CA 2009" -# Serial: 14014712776195784473 -# MD5 Fingerprint: f8:49:f4:03:bc:44:2d:83:be:48:69:7d:29:64:fc:b1 -# SHA1 Fingerprint: 89:df:74:fe:5c:f4:0f:4a:80:f9:e3:37:7d:54:da:91:e1:01:31:8e -# SHA256 Fingerprint: 3c:5f:81:fe:a5:fa:b8:2c:64:bf:a2:ea:ec:af:cd:e8:e0:77:fc:86:20:a7:ca:e5:37:16:3d:f3:6e:db:f3:78 -----BEGIN CERTIFICATE----- MIIECjCCAvKgAwIBAgIJAMJ+QwRORz8ZMA0GCSqGSIb3DQEBCwUAMIGCMQswCQYD VQQGEwJIVTERMA8GA1UEBwwIQnVkYXBlc3QxFjAUBgNVBAoMDU1pY3Jvc2VjIEx0 @@ -1639,14 +818,6 @@ tyERzAMBVnCnEJIeGzSBHq2cGsMEPO0CYdYeBvNfOofyK/FFh+U9rNHHV4S9a67c 2Pm2G2JwCz02yULyMtd6YebS2z3PyKnJm9zbWETXbzivf3jTo60adbocwTZ8jx5t HMN1Rq41Bab2XD0h7lbwyYIiLXpUq3DDfSJlgnCW -----END CERTIFICATE----- - -# Issuer: CN=GlobalSign O=GlobalSign OU=GlobalSign Root CA - R3 -# Subject: CN=GlobalSign O=GlobalSign OU=GlobalSign Root CA - R3 -# Label: "GlobalSign Root CA - R3" -# Serial: 4835703278459759426209954 -# MD5 Fingerprint: c5:df:b8:49:ca:05:13:55:ee:2d:ba:1a:c3:3e:b0:28 -# SHA1 Fingerprint: d6:9b:56:11:48:f0:1c:77:c5:45:78:c1:09:26:df:5b:85:69:76:ad -# SHA256 Fingerprint: cb:b5:22:d7:b7:f1:27:ad:6a:01:13:86:5b:df:1c:d4:10:2e:7d:07:59:af:63:5a:7c:f4:72:0d:c9:63:c5:3b -----BEGIN CERTIFICATE----- MIIDXzCCAkegAwIBAgILBAAAAAABIVhTCKIwDQYJKoZIhvcNAQELBQAwTDEgMB4G A1UECxMXR2xvYmFsU2lnbiBSb290IENBIC0gUjMxEzARBgNVBAoTCkdsb2JhbFNp @@ -1668,14 +839,6 @@ mcIfeg7jLQitChws/zyrVQ4PkX4268NXSb7hLi18YIvDQVETI53O9zJrlAGomecs Mx86OyXShkDOOyyGeMlhLxS67ttVb9+E7gUJTb0o2HLO02JQZR7rkpeDMdmztcpH WD9f -----END CERTIFICATE----- - -# Issuer: CN=Autoridad de Certificacion Firmaprofesional CIF A62634068 -# Subject: CN=Autoridad de Certificacion Firmaprofesional CIF A62634068 -# Label: "Autoridad de Certificacion Firmaprofesional CIF A62634068" -# Serial: 6047274297262753887 -# MD5 Fingerprint: 73:3a:74:7a:ec:bb:a3:96:a6:c2:e4:e2:c8:9b:c0:c3 -# SHA1 Fingerprint: ae:c5:fb:3f:c8:e1:bf:c4:e5:4f:03:07:5a:9a:e8:00:b7:f7:b6:fa -# SHA256 Fingerprint: 04:04:80:28:bf:1f:28:64:d4:8f:9a:d4:d8:32:94:36:6a:82:88:56:55:3f:3b:14:30:3f:90:14:7f:5d:40:ef -----BEGIN CERTIFICATE----- MIIGFDCCA/ygAwIBAgIIU+w77vuySF8wDQYJKoZIhvcNAQEFBQAwUTELMAkGA1UE BhMCRVMxQjBABgNVBAMMOUF1dG9yaWRhZCBkZSBDZXJ0aWZpY2FjaW9uIEZpcm1h @@ -1711,14 +874,6 @@ StRf571oe2XyFR7SOqkt6dhrJKyXWERHrVkY8SFlcN7ONGCoQPHzPKTDKCOM/icz Q0CgFzzr6juwcqajuUpLXhZI9LK8yIySxZ2frHI2vDSANGupi5LAuBft7HZT9SQB jLMi6Et8Vcad+qMUu2WFbm5PEn4KPJ2V -----END CERTIFICATE----- - -# Issuer: CN=Izenpe.com O=IZENPE S.A. -# Subject: CN=Izenpe.com O=IZENPE S.A. -# Label: "Izenpe.com" -# Serial: 917563065490389241595536686991402621 -# MD5 Fingerprint: a6:b0:cd:85:80:da:5c:50:34:a3:39:90:2f:55:67:73 -# SHA1 Fingerprint: 2f:78:3d:25:52:18:a7:4a:65:39:71:b5:2c:a2:9c:45:15:6f:e9:19 -# SHA256 Fingerprint: 25:30:cc:8e:98:32:15:02:ba:d9:6f:9b:1f:ba:1b:09:9e:2d:29:9e:0f:45:48:bb:91:4f:36:3b:c0:d4:53:1f -----BEGIN CERTIFICATE----- MIIF8TCCA9mgAwIBAgIQALC3WhZIX7/hy/WL1xnmfTANBgkqhkiG9w0BAQsFADA4 MQswCQYDVQQGEwJFUzEUMBIGA1UECgwLSVpFTlBFIFMuQS4xEzARBgNVBAMMCkl6 @@ -1753,113 +908,6 @@ QnMFlEPVjjxOAToZpR9GTnfQXeWBIiGH/pR9hNiTrdZoQ0iy2+tzJOeRf1SktoA+ naM8THLCV8Sg1Mw4J87VBp6iSNnpn86CcDaTmjvfliHjWbcM2pE38P1ZWrOZyGls QyYBNWNgVYkDOnXYukrZVP/u3oDYLdE41V4tC5h9Pmzb/CaIxw== -----END CERTIFICATE----- - -# Issuer: CN=Chambers of Commerce Root - 2008 O=AC Camerfirma S.A. -# Subject: CN=Chambers of Commerce Root - 2008 O=AC Camerfirma S.A. -# Label: "Chambers of Commerce Root - 2008" -# Serial: 11806822484801597146 -# MD5 Fingerprint: 5e:80:9e:84:5a:0e:65:0b:17:02:f3:55:18:2a:3e:d7 -# SHA1 Fingerprint: 78:6a:74:ac:76:ab:14:7f:9c:6a:30:50:ba:9e:a8:7e:fe:9a:ce:3c -# SHA256 Fingerprint: 06:3e:4a:fa:c4:91:df:d3:32:f3:08:9b:85:42:e9:46:17:d8:93:d7:fe:94:4e:10:a7:93:7e:e2:9d:96:93:c0 ------BEGIN CERTIFICATE----- -MIIHTzCCBTegAwIBAgIJAKPaQn6ksa7aMA0GCSqGSIb3DQEBBQUAMIGuMQswCQYD -VQQGEwJFVTFDMEEGA1UEBxM6TWFkcmlkIChzZWUgY3VycmVudCBhZGRyZXNzIGF0 -IHd3dy5jYW1lcmZpcm1hLmNvbS9hZGRyZXNzKTESMBAGA1UEBRMJQTgyNzQzMjg3 -MRswGQYDVQQKExJBQyBDYW1lcmZpcm1hIFMuQS4xKTAnBgNVBAMTIENoYW1iZXJz -IG9mIENvbW1lcmNlIFJvb3QgLSAyMDA4MB4XDTA4MDgwMTEyMjk1MFoXDTM4MDcz -MTEyMjk1MFowga4xCzAJBgNVBAYTAkVVMUMwQQYDVQQHEzpNYWRyaWQgKHNlZSBj -dXJyZW50IGFkZHJlc3MgYXQgd3d3LmNhbWVyZmlybWEuY29tL2FkZHJlc3MpMRIw -EAYDVQQFEwlBODI3NDMyODcxGzAZBgNVBAoTEkFDIENhbWVyZmlybWEgUy5BLjEp -MCcGA1UEAxMgQ2hhbWJlcnMgb2YgQ29tbWVyY2UgUm9vdCAtIDIwMDgwggIiMA0G -CSqGSIb3DQEBAQUAA4ICDwAwggIKAoICAQCvAMtwNyuAWko6bHiUfaN/Gh/2NdW9 -28sNRHI+JrKQUrpjOyhYb6WzbZSm891kDFX29ufyIiKAXuFixrYp4YFs8r/lfTJq -VKAyGVn+H4vXPWCGhSRv4xGzdz4gljUha7MI2XAuZPeEklPWDrCQiorjh40G072Q -DuKZoRuGDtqaCrsLYVAGUvGef3bsyw/QHg3PmTA9HMRFEFis1tPo1+XqxQEHd9ZR -5gN/ikilTWh1uem8nk4ZcfUyS5xtYBkL+8ydddy/Js2Pk3g5eXNeJQ7KXOt3EgfL -ZEFHcpOrUMPrCXZkNNI5t3YRCQ12RcSprj1qr7V9ZS+UWBDsXHyvfuK2GNnQm05a -Sd+pZgvMPMZ4fKecHePOjlO+Bd5gD2vlGts/4+EhySnB8esHnFIbAURRPHsl18Tl -UlRdJQfKFiC4reRB7noI/plvg6aRArBsNlVq5331lubKgdaX8ZSD6e2wsWsSaR6s -+12pxZjptFtYer49okQ6Y1nUCyXeG0+95QGezdIp1Z8XGQpvvwyQ0wlf2eOKNcx5 -Wk0ZN5K3xMGtr/R5JJqyAQuxr1yW84Ay+1w9mPGgP0revq+ULtlVmhduYJ1jbLhj -ya6BXBg14JC7vjxPNyK5fuvPnnchpj04gftI2jE9K+OJ9dC1vX7gUMQSibMjmhAx -hduub+84Mxh2EQIDAQABo4IBbDCCAWgwEgYDVR0TAQH/BAgwBgEB/wIBDDAdBgNV -HQ4EFgQU+SSsD7K1+HnA+mCIG8TZTQKeFxkwgeMGA1UdIwSB2zCB2IAU+SSsD7K1 -+HnA+mCIG8TZTQKeFxmhgbSkgbEwga4xCzAJBgNVBAYTAkVVMUMwQQYDVQQHEzpN -YWRyaWQgKHNlZSBjdXJyZW50IGFkZHJlc3MgYXQgd3d3LmNhbWVyZmlybWEuY29t -L2FkZHJlc3MpMRIwEAYDVQQFEwlBODI3NDMyODcxGzAZBgNVBAoTEkFDIENhbWVy -ZmlybWEgUy5BLjEpMCcGA1UEAxMgQ2hhbWJlcnMgb2YgQ29tbWVyY2UgUm9vdCAt -IDIwMDiCCQCj2kJ+pLGu2jAOBgNVHQ8BAf8EBAMCAQYwPQYDVR0gBDYwNDAyBgRV -HSAAMCowKAYIKwYBBQUHAgEWHGh0dHA6Ly9wb2xpY3kuY2FtZXJmaXJtYS5jb20w -DQYJKoZIhvcNAQEFBQADggIBAJASryI1wqM58C7e6bXpeHxIvj99RZJe6dqxGfwW -PJ+0W2aeaufDuV2I6A+tzyMP3iU6XsxPpcG1Lawk0lgH3qLPaYRgM+gQDROpI9CF -5Y57pp49chNyM/WqfcZjHwj0/gF/JM8rLFQJ3uIrbZLGOU8W6jx+ekbURWpGqOt1 -glanq6B8aBMz9p0w8G8nOSQjKpD9kCk18pPfNKXG9/jvjA9iSnyu0/VU+I22mlaH -FoI6M6taIgj3grrqLuBHmrS1RaMFO9ncLkVAO+rcf+g769HsJtg1pDDFOqxXnrN2 -pSB7+R5KBWIBpih1YJeSDW4+TTdDDZIVnBgizVGZoCkaPF+KMjNbMMeJL0eYD6MD -xvbxrN8y8NmBGuScvfaAFPDRLLmF9dijscilIeUcE5fuDr3fKanvNFNb0+RqE4QG -tjICxFKuItLcsiFCGtpA8CnJ7AoMXOLQusxI0zcKzBIKinmwPQN/aUv0NCB9szTq -jktk9T79syNnFQ0EuPAtwQlRPLJsFfClI9eDdOTlLsn+mCdCxqvGnrDQWzilm1De -fhiYtUU79nm06PcaewaD+9CL2rvHvRirCG88gGtAPxkZumWK5r7VXNM21+9AUiRg -OGcEMeyP84LG3rlV8zsxkVrctQgVrXYlCg17LofiDKYGvCYQbTed7N14jHyAxfDZ -d0jQ ------END CERTIFICATE----- - -# Issuer: CN=Global Chambersign Root - 2008 O=AC Camerfirma S.A. -# Subject: CN=Global Chambersign Root - 2008 O=AC Camerfirma S.A. -# Label: "Global Chambersign Root - 2008" -# Serial: 14541511773111788494 -# MD5 Fingerprint: 9e:80:ff:78:01:0c:2e:c1:36:bd:fe:96:90:6e:08:f3 -# SHA1 Fingerprint: 4a:bd:ee:ec:95:0d:35:9c:89:ae:c7:52:a1:2c:5b:29:f6:d6:aa:0c -# SHA256 Fingerprint: 13:63:35:43:93:34:a7:69:80:16:a0:d3:24:de:72:28:4e:07:9d:7b:52:20:bb:8f:bd:74:78:16:ee:be:ba:ca ------BEGIN CERTIFICATE----- -MIIHSTCCBTGgAwIBAgIJAMnN0+nVfSPOMA0GCSqGSIb3DQEBBQUAMIGsMQswCQYD -VQQGEwJFVTFDMEEGA1UEBxM6TWFkcmlkIChzZWUgY3VycmVudCBhZGRyZXNzIGF0 -IHd3dy5jYW1lcmZpcm1hLmNvbS9hZGRyZXNzKTESMBAGA1UEBRMJQTgyNzQzMjg3 -MRswGQYDVQQKExJBQyBDYW1lcmZpcm1hIFMuQS4xJzAlBgNVBAMTHkdsb2JhbCBD -aGFtYmVyc2lnbiBSb290IC0gMjAwODAeFw0wODA4MDExMjMxNDBaFw0zODA3MzEx -MjMxNDBaMIGsMQswCQYDVQQGEwJFVTFDMEEGA1UEBxM6TWFkcmlkIChzZWUgY3Vy -cmVudCBhZGRyZXNzIGF0IHd3dy5jYW1lcmZpcm1hLmNvbS9hZGRyZXNzKTESMBAG -A1UEBRMJQTgyNzQzMjg3MRswGQYDVQQKExJBQyBDYW1lcmZpcm1hIFMuQS4xJzAl -BgNVBAMTHkdsb2JhbCBDaGFtYmVyc2lnbiBSb290IC0gMjAwODCCAiIwDQYJKoZI -hvcNAQEBBQADggIPADCCAgoCggIBAMDfVtPkOpt2RbQT2//BthmLN0EYlVJH6xed -KYiONWwGMi5HYvNJBL99RDaxccy9Wglz1dmFRP+RVyXfXjaOcNFccUMd2drvXNL7 -G706tcuto8xEpw2uIRU/uXpbknXYpBI4iRmKt4DS4jJvVpyR1ogQC7N0ZJJ0YPP2 -zxhPYLIj0Mc7zmFLmY/CDNBAspjcDahOo7kKrmCgrUVSY7pmvWjg+b4aqIG7HkF4 -ddPB/gBVsIdU6CeQNR1MM62X/JcumIS/LMmjv9GYERTtY/jKmIhYF5ntRQOXfjyG -HoiMvvKRhI9lNNgATH23MRdaKXoKGCQwoze1eqkBfSbW+Q6OWfH9GzO1KTsXO0G2 -Id3UwD2ln58fQ1DJu7xsepeY7s2MH/ucUa6LcL0nn3HAa6x9kGbo1106DbDVwo3V -yJ2dwW3Q0L9R5OP4wzg2rtandeavhENdk5IMagfeOx2YItaswTXbo6Al/3K1dh3e -beksZixShNBFks4c5eUzHdwHU1SjqoI7mjcv3N2gZOnm3b2u/GSFHTynyQbehP9r -6GsaPMWis0L7iwk+XwhSx2LE1AVxv8Rk5Pihg+g+EpuoHtQ2TS9x9o0o9oOpE9Jh -wZG7SMA0j0GMS0zbaRL/UJScIINZc+18ofLx/d33SdNDWKBWY8o9PeU1VlnpDsog -zCtLkykPAgMBAAGjggFqMIIBZjASBgNVHRMBAf8ECDAGAQH/AgEMMB0GA1UdDgQW -BBS5CcqcHtvTbDprru1U8VuTBjUuXjCB4QYDVR0jBIHZMIHWgBS5CcqcHtvTbDpr -ru1U8VuTBjUuXqGBsqSBrzCBrDELMAkGA1UEBhMCRVUxQzBBBgNVBAcTOk1hZHJp -ZCAoc2VlIGN1cnJlbnQgYWRkcmVzcyBhdCB3d3cuY2FtZXJmaXJtYS5jb20vYWRk -cmVzcykxEjAQBgNVBAUTCUE4Mjc0MzI4NzEbMBkGA1UEChMSQUMgQ2FtZXJmaXJt -YSBTLkEuMScwJQYDVQQDEx5HbG9iYWwgQ2hhbWJlcnNpZ24gUm9vdCAtIDIwMDiC -CQDJzdPp1X0jzjAOBgNVHQ8BAf8EBAMCAQYwPQYDVR0gBDYwNDAyBgRVHSAAMCow -KAYIKwYBBQUHAgEWHGh0dHA6Ly9wb2xpY3kuY2FtZXJmaXJtYS5jb20wDQYJKoZI -hvcNAQEFBQADggIBAICIf3DekijZBZRG/5BXqfEv3xoNa/p8DhxJJHkn2EaqbylZ -UohwEurdPfWbU1Rv4WCiqAm57OtZfMY18dwY6fFn5a+6ReAJ3spED8IXDneRRXoz -X1+WLGiLwUePmJs9wOzL9dWCkoQ10b42OFZyMVtHLaoXpGNR6woBrX/sdZ7LoR/x -fxKxueRkf2fWIyr0uDldmOghp+G9PUIadJpwr2hsUF1Jz//7Dl3mLEfXgTpZALVz -a2Mg9jFFCDkO9HB+QHBaP9BrQql0PSgvAm11cpUJjUhjxsYjV5KTXjXBjfkK9yyd -Yhz2rXzdpjEetrHHfoUm+qRqtdpjMNHvkzeyZi99Bffnt0uYlDXA2TopwZ2yUDMd -SqlapskD7+3056huirRXhOukP9DuqqqHW2Pok+JrqNS4cnhrG+055F3Lm6qH1U9O -AP7Zap88MQ8oAgF9mOinsKJknnn4SPIVqczmyETrP3iZ8ntxPjzxmKfFGBI/5rso -M0LpRQp8bfKGeS/Fghl9CYl8slR2iK7ewfPM4W7bMdaTrpmg7yVqc5iJWzouE4ge -v8CSlDQb4ye3ix5vQv/n6TebUB0tovkC7stYWDpxvGjjqsGvHCgfotwjZT+B6q6Z -09gwzxMNTxXJhLynSC34MCN32EZLeW32jO06f2ARePTpm67VVMB0gNELQp/B ------END CERTIFICATE----- - -# Issuer: CN=Go Daddy Root Certificate Authority - G2 O=GoDaddy.com, Inc. -# Subject: CN=Go Daddy Root Certificate Authority - G2 O=GoDaddy.com, Inc. -# Label: "Go Daddy Root Certificate Authority - G2" -# Serial: 0 -# MD5 Fingerprint: 80:3a:bc:22:c1:e6:fb:8d:9b:3b:27:4a:32:1b:9a:01 -# SHA1 Fingerprint: 47:be:ab:c9:22:ea:e8:0e:78:78:34:62:a7:9f:45:c2:54:fd:e6:8b -# SHA256 Fingerprint: 45:14:0b:32:47:eb:9c:c8:c5:b4:f0:d7:b5:30:91:f7:32:92:08:9e:6e:5a:63:e2:74:9d:d3:ac:a9:19:8e:da -----BEGIN CERTIFICATE----- MIIDxTCCAq2gAwIBAgIBADANBgkqhkiG9w0BAQsFADCBgzELMAkGA1UEBhMCVVMx EDAOBgNVBAgTB0FyaXpvbmExEzARBgNVBAcTClNjb3R0c2RhbGUxGjAYBgNVBAoT @@ -1883,14 +931,6 @@ gIOrmgIttRD02JDHBHNA7XIloKmf7J6raBKZV8aPEjoJpL1E/QYVN8Gb5DKj7Tjo LPAvTK33sefOT6jEm0pUBsV/fdUID+Ic/n4XuKxe9tQWskMJDE32p2u0mYRlynqI 4uJEvlz36hz1 -----END CERTIFICATE----- - -# Issuer: CN=Starfield Root Certificate Authority - G2 O=Starfield Technologies, Inc. -# Subject: CN=Starfield Root Certificate Authority - G2 O=Starfield Technologies, Inc. -# Label: "Starfield Root Certificate Authority - G2" -# Serial: 0 -# MD5 Fingerprint: d6:39:81:c6:52:7e:96:69:fc:fc:ca:66:ed:05:f2:96 -# SHA1 Fingerprint: b5:1c:06:7c:ee:2b:0c:3d:f8:55:ab:2d:92:f4:fe:39:d4:e7:0f:0e -# SHA256 Fingerprint: 2c:e1:cb:0b:f9:d2:f9:e1:02:99:3f:be:21:51:52:c3:b2:dd:0c:ab:de:1c:68:e5:31:9b:83:91:54:db:b7:f5 -----BEGIN CERTIFICATE----- MIID3TCCAsWgAwIBAgIBADANBgkqhkiG9w0BAQsFADCBjzELMAkGA1UEBhMCVVMx EDAOBgNVBAgTB0FyaXpvbmExEzARBgNVBAcTClNjb3R0c2RhbGUxJTAjBgNVBAoT @@ -1914,14 +954,6 @@ sHU48TRqneSfioYmUeYs0cYtbpUgSpIB7LiKZ3sx4mcujJUDJi5DnUox9g61DLu3 pL/QlwVKvOoYKAKQvVR4CSFx09F9HdkWsKlhPdAKACL8x3vLCWRFCztAgfd9fDL1 mMpYjn0q7pBZc2T5NnReJaH1ZgUufzkVqSr7UIuOhWn0 -----END CERTIFICATE----- - -# Issuer: CN=Starfield Services Root Certificate Authority - G2 O=Starfield Technologies, Inc. -# Subject: CN=Starfield Services Root Certificate Authority - G2 O=Starfield Technologies, Inc. -# Label: "Starfield Services Root Certificate Authority - G2" -# Serial: 0 -# MD5 Fingerprint: 17:35:74:af:7b:61:1c:eb:f4:f9:3c:e2:ee:40:f9:a2 -# SHA1 Fingerprint: 92:5a:8f:8d:2c:6d:04:e0:66:5f:59:6a:ff:22:d8:63:e8:25:6f:3f -# SHA256 Fingerprint: 56:8d:69:05:a2:c8:87:08:a4:b3:02:51:90:ed:cf:ed:b1:97:4a:60:6a:13:c6:e5:29:0f:cb:2a:e6:3e:da:b5 -----BEGIN CERTIFICATE----- MIID7zCCAtegAwIBAgIBADANBgkqhkiG9w0BAQsFADCBmDELMAkGA1UEBhMCVVMx EDAOBgNVBAgTB0FyaXpvbmExEzARBgNVBAcTClNjb3R0c2RhbGUxJTAjBgNVBAoT @@ -1946,14 +978,6 @@ iEDPfUYd/x7H4c7/I9vG+o1VTqkC50cRRj70/b17KSa7qWFiNyi2LSr2EIZkyXCn 0q23KXB56jzaYyWf/Wi3MOxw+3WKt21gZ7IeyLnp2KhvAotnDU0mV3HaIPzBSlCN sSi6 -----END CERTIFICATE----- - -# Issuer: CN=AffirmTrust Commercial O=AffirmTrust -# Subject: CN=AffirmTrust Commercial O=AffirmTrust -# Label: "AffirmTrust Commercial" -# Serial: 8608355977964138876 -# MD5 Fingerprint: 82:92:ba:5b:ef:cd:8a:6f:a6:3d:55:f9:84:f6:d6:b7 -# SHA1 Fingerprint: f9:b5:b6:32:45:5f:9c:be:ec:57:5f:80:dc:e9:6e:2c:c7:b2:78:b7 -# SHA256 Fingerprint: 03:76:ab:1d:54:c5:f9:80:3c:e4:b2:e2:01:a0:ee:7e:ef:7b:57:b6:36:e8:a9:3c:9b:8d:48:60:c9:6f:5f:a7 -----BEGIN CERTIFICATE----- MIIDTDCCAjSgAwIBAgIId3cGJyapsXwwDQYJKoZIhvcNAQELBQAwRDELMAkGA1UE BhMCVVMxFDASBgNVBAoMC0FmZmlybVRydXN0MR8wHQYDVQQDDBZBZmZpcm1UcnVz @@ -1974,14 +998,6 @@ Z8SOyUOyXGsViQK8YvxO8rUzqrJv0wqiUOP2O+guRMLbZjipM1ZI8W0bM40NjD9g N53Tym1+NH4Nn3J2ixufcv1SNUFFApYvHLKac0khsUlHRUe072o0EclNmsxZt9YC nlpOZbWUrhvfKbAW8b8Angc6F2S1BLUjIZkKlTuXfO8= -----END CERTIFICATE----- - -# Issuer: CN=AffirmTrust Networking O=AffirmTrust -# Subject: CN=AffirmTrust Networking O=AffirmTrust -# Label: "AffirmTrust Networking" -# Serial: 8957382827206547757 -# MD5 Fingerprint: 42:65:ca:be:01:9a:9a:4c:a9:8c:41:49:cd:c0:d5:7f -# SHA1 Fingerprint: 29:36:21:02:8b:20:ed:02:f5:66:c5:32:d1:d6:ed:90:9f:45:00:2f -# SHA256 Fingerprint: 0a:81:ec:5a:92:97:77:f1:45:90:4a:f3:8d:5d:50:9f:66:b5:e2:c5:8f:cd:b5:31:05:8b:0e:17:f3:f0:b4:1b -----BEGIN CERTIFICATE----- MIIDTDCCAjSgAwIBAgIIfE8EORzUmS0wDQYJKoZIhvcNAQEFBQAwRDELMAkGA1UE BhMCVVMxFDASBgNVBAoMC0FmZmlybVRydXN0MR8wHQYDVQQDDBZBZmZpcm1UcnVz @@ -2002,14 +1018,6 @@ Lgo/bNjR9eUJtGxUAArgFU2HdW23WJZa3W3SAKD0m0i+wzekujbgfIeFlxoVot4u olu9rxj5kFDNcFn4J2dHy8egBzp90SxdbBk6ZrV9/ZFvgrG+CJPbFEfxojfHRZ48 x3evZKiT3/Zpg4Jg8klCNO1aAFSFHBY2kgxc+qatv9s= -----END CERTIFICATE----- - -# Issuer: CN=AffirmTrust Premium O=AffirmTrust -# Subject: CN=AffirmTrust Premium O=AffirmTrust -# Label: "AffirmTrust Premium" -# Serial: 7893706540734352110 -# MD5 Fingerprint: c4:5d:0e:48:b6:ac:28:30:4e:0a:bc:f9:38:16:87:57 -# SHA1 Fingerprint: d8:a6:33:2c:e0:03:6f:b1:85:f6:63:4f:7d:6a:06:65:26:32:28:27 -# SHA256 Fingerprint: 70:a7:3f:7f:37:6b:60:07:42:48:90:45:34:b1:14:82:d5:bf:0e:69:8e:cc:49:8d:f5:25:77:eb:f2:e9:3b:9a -----BEGIN CERTIFICATE----- MIIFRjCCAy6gAwIBAgIIbYwURrGmCu4wDQYJKoZIhvcNAQEMBQAwQTELMAkGA1UE BhMCVVMxFDASBgNVBAoMC0FmZmlybVRydXN0MRwwGgYDVQQDDBNBZmZpcm1UcnVz @@ -2041,14 +1049,6 @@ GKa1qF60g2xraUDTn9zxw2lrueFtCfTxqlB2Cnp9ehehVZZCmTEJ3WARjQUwfuaO RtGdFNrHF+QFlozEJLUbzxQHskD4o55BhrwE0GuWyCqANP2/7waj3VjFhT0+j/6e KeC2uAloGRwYQw== -----END CERTIFICATE----- - -# Issuer: CN=AffirmTrust Premium ECC O=AffirmTrust -# Subject: CN=AffirmTrust Premium ECC O=AffirmTrust -# Label: "AffirmTrust Premium ECC" -# Serial: 8401224907861490260 -# MD5 Fingerprint: 64:b0:09:55:cf:b1:d5:99:e2:be:13:ab:a6:5d:ea:4d -# SHA1 Fingerprint: b8:23:6b:00:2f:1d:16:86:53:01:55:6c:11:a4:37:ca:eb:ff:c3:bb -# SHA256 Fingerprint: bd:71:fd:f6:da:97:e4:cf:62:d1:64:7a:dd:25:81:b0:7d:79:ad:f8:39:7e:b4:ec:ba:9c:5e:84:88:82:14:23 -----BEGIN CERTIFICATE----- MIIB/jCCAYWgAwIBAgIIdJclisc/elQwCgYIKoZIzj0EAwMwRTELMAkGA1UEBhMC VVMxFDASBgNVBAoMC0FmZmlybVRydXN0MSAwHgYDVQQDDBdBZmZpcm1UcnVzdCBQ @@ -2062,14 +1062,6 @@ A1UdDwEB/wQEAwIBBjAKBggqhkjOPQQDAwNnADBkAjAXCfOHiFBar8jAQr9HX/Vs aobgxCd05DhT1wV/GzTjxi+zygk8N53X57hG8f2h4nECMEJZh0PUUd+60wkyWs6I flc9nF9Ca/UHLbXwgpP5WW+uZPpY5Yse42O+tYHNbwKMeQ== -----END CERTIFICATE----- - -# Issuer: CN=Certum Trusted Network CA O=Unizeto Technologies S.A. OU=Certum Certification Authority -# Subject: CN=Certum Trusted Network CA O=Unizeto Technologies S.A. OU=Certum Certification Authority -# Label: "Certum Trusted Network CA" -# Serial: 279744 -# MD5 Fingerprint: d5:e9:81:40:c5:18:69:fc:46:2c:89:75:62:0f:aa:78 -# SHA1 Fingerprint: 07:e0:32:e0:20:b7:2c:3f:19:2f:06:28:a2:59:3a:19:a7:0f:06:9e -# SHA256 Fingerprint: 5c:58:46:8d:55:f5:8e:49:7e:74:39:82:d2:b5:00:10:b6:d1:65:37:4a:cf:83:a7:d4:a3:2d:b7:68:c4:40:8e -----BEGIN CERTIFICATE----- MIIDuzCCAqOgAwIBAgIDBETAMA0GCSqGSIb3DQEBBQUAMH4xCzAJBgNVBAYTAlBM MSIwIAYDVQQKExlVbml6ZXRvIFRlY2hub2xvZ2llcyBTLkEuMScwJQYDVQQLEx5D @@ -2092,14 +1084,6 @@ J9RHjboNRhx3zxSkHLmkMcScKHQDNP8zGSal6Q10tz6XxnboJ5ajZt3hrvJBW8qY VoNzcOSGGtIxQbovvi0TWnZvTuhOgQ4/WwMioBK+ZlgRSssDxLQqKi2WF+A5VLxI 03YnnZotBqbJ7DnSq9ufmgsnAjUpsUCV5/nonFWIGUbWtzT1fs45mtk48VH3Tyw= -----END CERTIFICATE----- - -# Issuer: CN=TWCA Root Certification Authority O=TAIWAN-CA OU=Root CA -# Subject: CN=TWCA Root Certification Authority O=TAIWAN-CA OU=Root CA -# Label: "TWCA Root Certification Authority" -# Serial: 1 -# MD5 Fingerprint: aa:08:8f:f6:f9:7b:b7:f2:b1:a7:1e:9b:ea:ea:bd:79 -# SHA1 Fingerprint: cf:9e:87:6d:d3:eb:fc:42:26:97:a3:b5:a3:7a:a0:76:a9:06:23:48 -# SHA256 Fingerprint: bf:d8:8f:e1:10:1c:41:ae:3e:80:1b:f8:be:56:35:0e:e9:ba:d1:a6:b9:bd:51:5e:dc:5c:6d:5b:87:11:ac:44 -----BEGIN CERTIFICATE----- MIIDezCCAmOgAwIBAgIBATANBgkqhkiG9w0BAQUFADBfMQswCQYDVQQGEwJUVzES MBAGA1UECgwJVEFJV0FOLUNBMRAwDgYDVQQLDAdSb290IENBMSowKAYDVQQDDCFU @@ -2121,14 +1105,6 @@ lhh9DrUUOYTxKOkto557HnpyWoOzeW/vtPzQCqVYT0bf+215WfKEIlKuD8z7fDvn aspHYcN6+NOSBB+4IIThNlQWx0DeO4pz3N/GCUzf7Nr/1FNCocnyYh0igzyXxfkZ YiesZSLX0zzG5Y6yU8xJzrww/nsOM5D77dIUkR8Hrw== -----END CERTIFICATE----- - -# Issuer: O=SECOM Trust Systems CO.,LTD. OU=Security Communication RootCA2 -# Subject: O=SECOM Trust Systems CO.,LTD. OU=Security Communication RootCA2 -# Label: "Security Communication RootCA2" -# Serial: 0 -# MD5 Fingerprint: 6c:39:7d:a4:0e:55:59:b2:3f:d6:41:b1:12:50:de:43 -# SHA1 Fingerprint: 5f:3b:8c:f2:f8:10:b3:7d:78:b4:ce:ec:19:19:c3:73:34:b9:c7:74 -# SHA256 Fingerprint: 51:3b:2c:ec:b8:10:d4:cd:e5:dd:85:39:1a:df:c6:c2:dd:60:d8:7b:b7:36:d2:b5:21:48:4a:a4:7a:0e:be:f6 -----BEGIN CERTIFICATE----- MIIDdzCCAl+gAwIBAgIBADANBgkqhkiG9w0BAQsFADBdMQswCQYDVQQGEwJKUDEl MCMGA1UEChMcU0VDT00gVHJ1c3QgU3lzdGVtcyBDTy4sTFRELjEnMCUGA1UECxMe @@ -2150,14 +1126,6 @@ t/2jioSgrGK+KwmHNPBqAbubKVY8/gA3zyNs8U6qtnRGEmyR7jTV7JqR50S+kDFy 1UkC9gLl9B/rfNmWVan/7Ir5mUf/NVoCqgTLiluHcSmRvaS0eg29mvVXIwAHIRc/ SjnRBUkLp7Y3gaVdjKozXoEofKd9J+sAro03 -----END CERTIFICATE----- - -# Issuer: CN=EC-ACC O=Agencia Catalana de Certificacio (NIF Q-0801176-I) OU=Serveis Publics de Certificacio/Vegeu https://www.catcert.net/verarrel (c)03/Jerarquia Entitats de Certificacio Catalanes -# Subject: CN=EC-ACC O=Agencia Catalana de Certificacio (NIF Q-0801176-I) OU=Serveis Publics de Certificacio/Vegeu https://www.catcert.net/verarrel (c)03/Jerarquia Entitats de Certificacio Catalanes -# Label: "EC-ACC" -# Serial: -23701579247955709139626555126524820479 -# MD5 Fingerprint: eb:f5:9d:29:0d:61:f9:42:1f:7c:c2:ba:6d:e3:15:09 -# SHA1 Fingerprint: 28:90:3a:63:5b:52:80:fa:e6:77:4c:0b:6d:a7:d6:ba:a6:4a:f2:e8 -# SHA256 Fingerprint: 88:49:7f:01:60:2f:31:54:24:6a:e2:8c:4d:5a:ef:10:f1:d8:7e:bb:76:62:6f:4a:e0:b7:f9:5b:a7:96:87:99 -----BEGIN CERTIFICATE----- MIIFVjCCBD6gAwIBAgIQ7is969Qh3hSoYqwE893EATANBgkqhkiG9w0BAQUFADCB 8zELMAkGA1UEBhMCRVMxOzA5BgNVBAoTMkFnZW5jaWEgQ2F0YWxhbmEgZGUgQ2Vy @@ -2189,14 +1157,6 @@ Rp/7SNVel+axofjk70YllJyJ22k4vuxcDlbHZVHlUIiIv0LVKz3l+bqeLrPK9HOS Agu+TGbrIP65y7WZf+a2E/rKS03Z7lNGBjvGTq2TWoF+bCpLagVFjPIhpDGQh2xl nJ2lYJU6Un/10asIbvPuW/mIPX64b24D5EI= -----END CERTIFICATE----- - -# Issuer: CN=Hellenic Academic and Research Institutions RootCA 2011 O=Hellenic Academic and Research Institutions Cert. Authority -# Subject: CN=Hellenic Academic and Research Institutions RootCA 2011 O=Hellenic Academic and Research Institutions Cert. Authority -# Label: "Hellenic Academic and Research Institutions RootCA 2011" -# Serial: 0 -# MD5 Fingerprint: 73:9f:4c:4b:73:5b:79:e9:fa:ba:1c:ef:6e:cb:d5:c9 -# SHA1 Fingerprint: fe:45:65:9b:79:03:5b:98:a1:61:b5:51:2e:ac:da:58:09:48:22:4d -# SHA256 Fingerprint: bc:10:4f:15:a4:8b:e7:09:dc:a5:42:a7:e1:d4:b9:df:6f:05:45:27:e8:02:ea:a9:2d:59:54:44:25:8a:fe:71 -----BEGIN CERTIFICATE----- MIIEMTCCAxmgAwIBAgIBADANBgkqhkiG9w0BAQUFADCBlTELMAkGA1UEBhMCR1Ix RDBCBgNVBAoTO0hlbGxlbmljIEFjYWRlbWljIGFuZCBSZXNlYXJjaCBJbnN0aXR1 @@ -2222,14 +1182,6 @@ dIsXRSZMFpGD/md9zU1jZ/rzAxKWeAaNsWftjj++n08C9bMJL/NMh98qy5V8Acys Nnq/onN694/BtZqhFLKPM58N7yLcZnuEvUUXBj08yrl3NI/K6s8/MT7jiOOASSXI l7WdmplNsDz4SgCbZN2fOUvRJ9e4 -----END CERTIFICATE----- - -# Issuer: CN=Actalis Authentication Root CA O=Actalis S.p.A./03358520967 -# Subject: CN=Actalis Authentication Root CA O=Actalis S.p.A./03358520967 -# Label: "Actalis Authentication Root CA" -# Serial: 6271844772424770508 -# MD5 Fingerprint: 69:c1:0d:4f:07:a3:1b:c3:fe:56:3d:04:bc:11:f6:a6 -# SHA1 Fingerprint: f3:73:b3:87:06:5a:28:84:8a:f2:f3:4a:ce:19:2b:dd:c7:8e:9c:ac -# SHA256 Fingerprint: 55:92:60:84:ec:96:3a:64:b9:6e:2a:be:01:ce:0b:a8:6a:64:fb:fe:bc:c7:aa:b5:af:c1:55:b3:7f:d7:60:66 -----BEGIN CERTIFICATE----- MIIFuzCCA6OgAwIBAgIIVwoRl0LE48wwDQYJKoZIhvcNAQELBQAwazELMAkGA1UE BhMCSVQxDjAMBgNVBAcMBU1pbGFuMSMwIQYDVQQKDBpBY3RhbGlzIFMucC5BLi8w @@ -2263,14 +1215,6 @@ ZCzJJ7VLkn5l/9Mt4blOvH+kQSGQQXemOR/qnuOf0GZvBeyqdn6/axag67XH/JJU LysRJyU3eExRarDzzFhdFPFqSBX/wge2sY0PjlxQRrM9vwGYT7JZVEc+NHt4bVaT LnPqZih4zR0Uv6CPLy64Lo7yFIrM6bV8+2ydDKXhlg== -----END CERTIFICATE----- - -# Issuer: O=Trustis Limited OU=Trustis FPS Root CA -# Subject: O=Trustis Limited OU=Trustis FPS Root CA -# Label: "Trustis FPS Root CA" -# Serial: 36053640375399034304724988975563710553 -# MD5 Fingerprint: 30:c9:e7:1e:6b:e6:14:eb:65:b2:16:69:20:31:67:4d -# SHA1 Fingerprint: 3b:c0:38:0b:33:c3:f6:a6:0c:86:15:22:93:d9:df:f5:4b:81:c0:04 -# SHA256 Fingerprint: c1:b4:82:99:ab:a5:20:8f:e9:63:0a:ce:55:ca:68:a0:3e:da:5a:51:9c:88:02:a0:d3:a6:73:be:8f:8e:55:7d -----BEGIN CERTIFICATE----- MIIDZzCCAk+gAwIBAgIQGx+ttiD5JNM2a/fH8YygWTANBgkqhkiG9w0BAQUFADBF MQswCQYDVQQGEwJHQjEYMBYGA1UEChMPVHJ1c3RpcyBMaW1pdGVkMRwwGgYDVQQL @@ -2292,14 +1236,6 @@ f1T1o+CP8HxVIo8ptoGj4W1OLBuAZ+ytIJ8MYmHVl/9D7S3B2l0pKoU/rGXuhg8F jZBf3+6f9L/uHfuY5H+QK4R4EA5sSVPvFVtlRkpdr7r7OnIdzfYliB6XzCGcKQEN ZetX2fNXlrtIzYE= -----END CERTIFICATE----- - -# Issuer: CN=Buypass Class 2 Root CA O=Buypass AS-983163327 -# Subject: CN=Buypass Class 2 Root CA O=Buypass AS-983163327 -# Label: "Buypass Class 2 Root CA" -# Serial: 2 -# MD5 Fingerprint: 46:a7:d2:fe:45:fb:64:5a:a8:59:90:9b:78:44:9b:29 -# SHA1 Fingerprint: 49:0a:75:74:de:87:0a:47:fe:58:ee:f6:c7:6b:eb:c6:0b:12:40:99 -# SHA256 Fingerprint: 9a:11:40:25:19:7c:5b:b9:5d:94:e6:3d:55:cd:43:79:08:47:b6:46:b2:3c:df:11:ad:a4:a0:0e:ff:15:fb:48 -----BEGIN CERTIFICATE----- MIIFWTCCA0GgAwIBAgIBAjANBgkqhkiG9w0BAQsFADBOMQswCQYDVQQGEwJOTzEd MBsGA1UECgwUQnV5cGFzcyBBUy05ODMxNjMzMjcxIDAeBgNVBAMMF0J1eXBhc3Mg @@ -2331,14 +1267,6 @@ I+uUWnpp3Q+/QFesa1lQ2aOZ4W7+jQF5JyMV3pKdewlNWudLSDBaGOYKbeaP4NK7 3PFaTWwyI0PurKju7koSCTxdccK+efrCh2gdC/1cacwG0Jp9VJkqyTkaGa9LKkPz Y11aWOIv4x3kqdbQCtCev9eBCfHJxyYNrJgWVqA= -----END CERTIFICATE----- - -# Issuer: CN=Buypass Class 3 Root CA O=Buypass AS-983163327 -# Subject: CN=Buypass Class 3 Root CA O=Buypass AS-983163327 -# Label: "Buypass Class 3 Root CA" -# Serial: 2 -# MD5 Fingerprint: 3d:3b:18:9e:2c:64:5a:e8:d5:88:ce:0e:f9:37:c2:ec -# SHA1 Fingerprint: da:fa:f7:fa:66:84:ec:06:8f:14:50:bd:c7:c2:81:a5:bc:a9:64:57 -# SHA256 Fingerprint: ed:f7:eb:bc:a2:7a:2a:38:4d:38:7b:7d:40:10:c6:66:e2:ed:b4:84:3e:4c:29:b4:ae:1d:5b:93:32:e6:b2:4d -----BEGIN CERTIFICATE----- MIIFWTCCA0GgAwIBAgIBAjANBgkqhkiG9w0BAQsFADBOMQswCQYDVQQGEwJOTzEd MBsGA1UECgwUQnV5cGFzcyBBUy05ODMxNjMzMjcxIDAeBgNVBAMMF0J1eXBhc3Mg @@ -2370,14 +1298,6 @@ kbIRNBE+6tBDGR8Dk5AM/1E9V/RBbuHLoL7ryWPNbczk+DaqaJ3tvV2XcEQNtg41 u79leNKGef9JOxqDDPDeeOzI8k1MGt6CKfjBWtrt7uYnXuhF0J0cUahoq0Tj0Itq 4/g7u9xN12TyUb7mqqta6THuBrxzvxNiCp/HuZc= -----END CERTIFICATE----- - -# Issuer: CN=T-TeleSec GlobalRoot Class 3 O=T-Systems Enterprise Services GmbH OU=T-Systems Trust Center -# Subject: CN=T-TeleSec GlobalRoot Class 3 O=T-Systems Enterprise Services GmbH OU=T-Systems Trust Center -# Label: "T-TeleSec GlobalRoot Class 3" -# Serial: 1 -# MD5 Fingerprint: ca:fb:40:a8:4e:39:92:8a:1d:fe:8e:2f:c4:27:ea:ef -# SHA1 Fingerprint: 55:a6:72:3e:cb:f2:ec:cd:c3:23:74:70:19:9d:2a:be:11:e3:81:d1 -# SHA256 Fingerprint: fd:73:da:d3:1c:64:4f:f1:b4:3b:ef:0c:cd:da:96:71:0b:9c:d9:87:5e:ca:7e:31:70:7a:f3:e9:6d:52:2b:bd -----BEGIN CERTIFICATE----- MIIDwzCCAqugAwIBAgIBATANBgkqhkiG9w0BAQsFADCBgjELMAkGA1UEBhMCREUx KzApBgNVBAoMIlQtU3lzdGVtcyBFbnRlcnByaXNlIFNlcnZpY2VzIEdtYkgxHzAd @@ -2401,46 +1321,6 @@ WL6ukK2YJ5f+AbGwUgC4TeQbIXQbfsDuXmkqJa9c1h3a0nnJ85cp4IaH3gRZD/FZ e9eiPZaGzPImNC1qkp2aGtAw4l1OBLBfiyB+d8E9lYLRRpo7PHi4b6HQDWSieB4p TpPDpFQUWw== -----END CERTIFICATE----- - -# Issuer: CN=EE Certification Centre Root CA O=AS Sertifitseerimiskeskus -# Subject: CN=EE Certification Centre Root CA O=AS Sertifitseerimiskeskus -# Label: "EE Certification Centre Root CA" -# Serial: 112324828676200291871926431888494945866 -# MD5 Fingerprint: 43:5e:88:d4:7d:1a:4a:7e:fd:84:2e:52:eb:01:d4:6f -# SHA1 Fingerprint: c9:a8:b9:e7:55:80:5e:58:e3:53:77:a7:25:eb:af:c3:7b:27:cc:d7 -# SHA256 Fingerprint: 3e:84:ba:43:42:90:85:16:e7:75:73:c0:99:2f:09:79:ca:08:4e:46:85:68:1f:f1:95:cc:ba:8a:22:9b:8a:76 ------BEGIN CERTIFICATE----- -MIIEAzCCAuugAwIBAgIQVID5oHPtPwBMyonY43HmSjANBgkqhkiG9w0BAQUFADB1 -MQswCQYDVQQGEwJFRTEiMCAGA1UECgwZQVMgU2VydGlmaXRzZWVyaW1pc2tlc2t1 -czEoMCYGA1UEAwwfRUUgQ2VydGlmaWNhdGlvbiBDZW50cmUgUm9vdCBDQTEYMBYG -CSqGSIb3DQEJARYJcGtpQHNrLmVlMCIYDzIwMTAxMDMwMTAxMDMwWhgPMjAzMDEy -MTcyMzU5NTlaMHUxCzAJBgNVBAYTAkVFMSIwIAYDVQQKDBlBUyBTZXJ0aWZpdHNl -ZXJpbWlza2Vza3VzMSgwJgYDVQQDDB9FRSBDZXJ0aWZpY2F0aW9uIENlbnRyZSBS -b290IENBMRgwFgYJKoZIhvcNAQkBFglwa2lAc2suZWUwggEiMA0GCSqGSIb3DQEB -AQUAA4IBDwAwggEKAoIBAQDIIMDs4MVLqwd4lfNE7vsLDP90jmG7sWLqI9iroWUy -euuOF0+W2Ap7kaJjbMeMTC55v6kF/GlclY1i+blw7cNRfdCT5mzrMEvhvH2/UpvO -bntl8jixwKIy72KyaOBhU8E2lf/slLo2rpwcpzIP5Xy0xm90/XsY6KxX7QYgSzIw -WFv9zajmofxwvI6Sc9uXp3whrj3B9UiHbCe9nyV0gVWw93X2PaRka9ZP585ArQ/d -MtO8ihJTmMmJ+xAdTX7Nfh9WDSFwhfYggx/2uh8Ej+p3iDXE/+pOoYtNP2MbRMNE -1CV2yreN1x5KZmTNXMWcg+HCCIia7E6j8T4cLNlsHaFLAgMBAAGjgYowgYcwDwYD -VR0TAQH/BAUwAwEB/zAOBgNVHQ8BAf8EBAMCAQYwHQYDVR0OBBYEFBLyWj7qVhy/ -zQas8fElyalL1BSZMEUGA1UdJQQ+MDwGCCsGAQUFBwMCBggrBgEFBQcDAQYIKwYB -BQUHAwMGCCsGAQUFBwMEBggrBgEFBQcDCAYIKwYBBQUHAwkwDQYJKoZIhvcNAQEF -BQADggEBAHv25MANqhlHt01Xo/6tu7Fq1Q+e2+RjxY6hUFaTlrg4wCQiZrxTFGGV -v9DHKpY5P30osxBAIWrEr7BSdxjhlthWXePdNl4dp1BUoMUq5KqMlIpPnTX/dqQG -E5Gion0ARD9V04I8GtVbvFZMIi5GQ4okQC3zErg7cBqklrkar4dBGmoYDQZPxz5u -uSlNDUmJEYcyW+ZLBMjkXOZ0c5RdFpgTlf7727FE5TpwrDdr5rMzcijJs1eg9gIW -iAYLtqZLICjU3j2LrTcFU3T+bsy8QxdxXvnFzBqpYe73dgzzcvRyrc9yAjYHR8/v -GVCJYMzpJJUPwssd8m92kMfMdcGWxZ0= ------END CERTIFICATE----- - -# Issuer: CN=D-TRUST Root Class 3 CA 2 2009 O=D-Trust GmbH -# Subject: CN=D-TRUST Root Class 3 CA 2 2009 O=D-Trust GmbH -# Label: "D-TRUST Root Class 3 CA 2 2009" -# Serial: 623603 -# MD5 Fingerprint: cd:e0:25:69:8d:47:ac:9c:89:35:90:f7:fd:51:3d:2f -# SHA1 Fingerprint: 58:e8:ab:b0:36:15:33:fb:80:f7:9b:1b:6d:29:d3:ff:8d:5f:00:f0 -# SHA256 Fingerprint: 49:e7:a4:42:ac:f0:ea:62:87:05:00:54:b5:25:64:b6:50:e4:f4:9e:42:e3:48:d6:aa:38:e0:39:e9:57:b1:c1 -----BEGIN CERTIFICATE----- MIIEMzCCAxugAwIBAgIDCYPzMA0GCSqGSIb3DQEBCwUAME0xCzAJBgNVBAYTAkRF MRUwEwYDVQQKDAxELVRydXN0IEdtYkgxJzAlBgNVBAMMHkQtVFJVU1QgUm9vdCBD @@ -2466,14 +1346,6 @@ zCUqNQT4YJEVdT1B/yMfGchs64JTBKbkTCJNjYy6zltz7GRUUG3RnFX7acM2w4y8 PIWmawomDeCTmGCufsYkl4phX5GOZpIJhzbNi5stPvZR1FDUWSi9g/LMKHtThm3Y Johw1+qRzT65ysCQblrGXnRl11z+o+I= -----END CERTIFICATE----- - -# Issuer: CN=D-TRUST Root Class 3 CA 2 EV 2009 O=D-Trust GmbH -# Subject: CN=D-TRUST Root Class 3 CA 2 EV 2009 O=D-Trust GmbH -# Label: "D-TRUST Root Class 3 CA 2 EV 2009" -# Serial: 623604 -# MD5 Fingerprint: aa:c6:43:2c:5e:2d:cd:c4:34:c0:50:4f:11:02:4f:b6 -# SHA1 Fingerprint: 96:c9:1b:0b:95:b4:10:98:42:fa:d0:d8:22:79:fe:60:fa:b9:16:83 -# SHA256 Fingerprint: ee:c5:49:6b:98:8c:e9:86:25:b9:34:09:2e:ec:29:08:be:d0:b0:f3:16:c2:d4:73:0c:84:ea:f1:f3:d3:48:81 -----BEGIN CERTIFICATE----- MIIEQzCCAyugAwIBAgIDCYP0MA0GCSqGSIb3DQEBCwUAMFAxCzAJBgNVBAYTAkRF MRUwEwYDVQQKDAxELVRydXN0IEdtYkgxKjAoBgNVBAMMIUQtVFJVU1QgUm9vdCBD @@ -2499,14 +1371,6 @@ CSuGdXzfX2lXANtu2KZyIktQ1HWYVt+3GP9DQ1CuekR78HlR10M9p9OB0/DJT7na xpeG0ILD5EJt/rDiZE4OJudANCa1CInXCGNjOCd1HjPqbqjdn5lPdE2BiYBL3ZqX KVwvvoFBuYz/6n1gBp7N1z3TLqMVvKjmJuVvw9y4AyHqnxbxLFS1 -----END CERTIFICATE----- - -# Issuer: CN=CA Disig Root R2 O=Disig a.s. -# Subject: CN=CA Disig Root R2 O=Disig a.s. -# Label: "CA Disig Root R2" -# Serial: 10572350602393338211 -# MD5 Fingerprint: 26:01:fb:d8:27:a7:17:9a:45:54:38:1a:43:01:3b:03 -# SHA1 Fingerprint: b5:61:eb:ea:a4:de:e4:25:4b:69:1a:98:a5:57:47:c2:34:c7:d9:71 -# SHA256 Fingerprint: e2:3d:4a:03:6d:7b:70:e9:f5:95:b1:42:20:79:d2:b9:1e:df:bb:1f:b6:51:a0:63:3e:aa:8a:9d:c5:f8:07:03 -----BEGIN CERTIFICATE----- MIIFaTCCA1GgAwIBAgIJAJK4iNuwisFjMA0GCSqGSIb3DQEBCwUAMFIxCzAJBgNV BAYTAlNLMRMwEQYDVQQHEwpCcmF0aXNsYXZhMRMwEQYDVQQKEwpEaXNpZyBhLnMu @@ -2538,14 +1402,6 @@ G5gPcFw0sorMwIUY6256s/daoQe/qUKS82Ail+QUoQebTnbAjn39pCXHR+3/H3Os zMOl6W8KjptlwlCFtaOgUxLMVYdh84GuEEZhvUQhuMI9dM9+JDX6HAcOmz0iyu8x L4ysEr3vQCj8KWefshNPZiTEUxnpHikV7+ZtsH8tZ/3zbBt1RqPlShfppNcL -----END CERTIFICATE----- - -# Issuer: CN=ACCVRAIZ1 O=ACCV OU=PKIACCV -# Subject: CN=ACCVRAIZ1 O=ACCV OU=PKIACCV -# Label: "ACCVRAIZ1" -# Serial: 6828503384748696800 -# MD5 Fingerprint: d0:a0:5a:ee:05:b6:09:94:21:a1:7d:f1:b2:29:82:02 -# SHA1 Fingerprint: 93:05:7a:88:15:c6:4f:ce:88:2f:fa:91:16:52:28:78:bc:53:64:17 -# SHA256 Fingerprint: 9a:6e:c0:12:e1:a7:da:9d:be:34:19:4d:47:8a:d7:c0:db:18:22:fb:07:1d:f1:29:81:49:6e:d1:04:38:41:13 -----BEGIN CERTIFICATE----- MIIH0zCCBbugAwIBAgIIXsO3pkN/pOAwDQYJKoZIhvcNAQEFBQAwQjESMBAGA1UE AwwJQUNDVlJBSVoxMRAwDgYDVQQLDAdQS0lBQ0NWMQ0wCwYDVQQKDARBQ0NWMQsw @@ -2590,14 +1446,6 @@ h1xA2syVP1XgNce4hL60Xc16gwFy7ofmXx2utYXGJt/mwZrpHgJHnyqobalbz+xF d3+YJ5oyXSrjhO7FmGYvliAd3djDJ9ew+f7Zfc3Qn48LFFhRny+Lwzgt3uiP1o2H pPVWQxaZLPSkVrQ0uGE3ycJYgBugl6H8WY3pEfbRD0tVNEYqi4Y7 -----END CERTIFICATE----- - -# Issuer: CN=TWCA Global Root CA O=TAIWAN-CA OU=Root CA -# Subject: CN=TWCA Global Root CA O=TAIWAN-CA OU=Root CA -# Label: "TWCA Global Root CA" -# Serial: 3262 -# MD5 Fingerprint: f9:03:7e:cf:e6:9e:3c:73:7a:2a:90:07:69:ff:2b:96 -# SHA1 Fingerprint: 9c:bb:48:53:f6:a4:f6:d3:52:a4:e8:32:52:55:60:13:f5:ad:af:65 -# SHA256 Fingerprint: 59:76:90:07:f7:68:5d:0f:cd:50:87:2f:9f:95:d5:75:5a:5b:2b:45:7d:81:f3:69:2b:61:0a:98:67:2f:0e:1b -----BEGIN CERTIFICATE----- MIIFQTCCAymgAwIBAgICDL4wDQYJKoZIhvcNAQELBQAwUTELMAkGA1UEBhMCVFcx EjAQBgNVBAoTCVRBSVdBTi1DQTEQMA4GA1UECxMHUm9vdCBDQTEcMBoGA1UEAxMT @@ -2629,14 +1477,6 @@ wa19hAM8EHiGG3njxPPyBJUgriOCxLM6AGK/5jYk4Ve6xx6QddVfP5VhK8E7zeWz aGHQRiapIVJpLesux+t3zqY6tQMzT3bR51xUAV3LePTJDL/PEo4XLSNolOer/qmy KwbQBM0= -----END CERTIFICATE----- - -# Issuer: CN=TeliaSonera Root CA v1 O=TeliaSonera -# Subject: CN=TeliaSonera Root CA v1 O=TeliaSonera -# Label: "TeliaSonera Root CA v1" -# Serial: 199041966741090107964904287217786801558 -# MD5 Fingerprint: 37:41:49:1b:18:56:9a:26:f5:ad:c2:66:fb:40:a5:4c -# SHA1 Fingerprint: 43:13:bb:96:f1:d5:86:9b:c1:4e:6a:92:f6:cf:f6:34:69:87:82:37 -# SHA256 Fingerprint: dd:69:36:fe:21:f8:f0:77:c1:23:a1:a5:21:c1:22:24:f7:22:55:b7:3e:03:a7:26:06:93:e8:a2:4b:0f:a3:89 -----BEGIN CERTIFICATE----- MIIFODCCAyCgAwIBAgIRAJW+FqD3LkbxezmCcvqLzZYwDQYJKoZIhvcNAQEFBQAw NzEUMBIGA1UECgwLVGVsaWFTb25lcmExHzAdBgNVBAMMFlRlbGlhU29uZXJhIFJv @@ -2667,14 +1507,6 @@ t88NkvuOGKmYSdGe/mBEciG5Ge3C9THxOUiIkCR1VBatzvT4aRRkOfujuLpwQMcn HL/EVlP6Y2XQ8xwOFvVrhlhNGNTkDY6lnVuR3HYkUD/GKvvZt5y11ubQ2egZixVx SK236thZiNSQvxaz2emsWWFUyBy6ysHK4bkgTI86k4mloMy/0/Z1pHWWbVY= -----END CERTIFICATE----- - -# Issuer: CN=E-Tugra Certification Authority O=E-Tuğra EBG Bilişim Teknolojileri ve Hizmetleri A.Ş. OU=E-Tugra Sertifikasyon Merkezi -# Subject: CN=E-Tugra Certification Authority O=E-Tuğra EBG Bilişim Teknolojileri ve Hizmetleri A.Ş. OU=E-Tugra Sertifikasyon Merkezi -# Label: "E-Tugra Certification Authority" -# Serial: 7667447206703254355 -# MD5 Fingerprint: b8:a1:03:63:b0:bd:21:71:70:8a:6f:13:3a:bb:79:49 -# SHA1 Fingerprint: 51:c6:e7:08:49:06:6e:f3:92:d4:5c:a0:0d:6d:a3:62:8f:c3:52:39 -# SHA256 Fingerprint: b0:bf:d5:2b:b0:d7:d9:bd:92:bf:5d:4d:c1:3d:a2:55:c0:2c:54:2f:37:83:65:ea:89:39:11:f5:5e:55:f2:3c -----BEGIN CERTIFICATE----- MIIGSzCCBDOgAwIBAgIIamg+nFGby1MwDQYJKoZIhvcNAQELBQAwgbIxCzAJBgNV BAYTAlRSMQ8wDQYDVQQHDAZBbmthcmExQDA+BgNVBAoMN0UtVHXEn3JhIEVCRyBC @@ -2711,14 +1543,6 @@ AJ8C2sH6H3p6CcRK5ogql5+Ji/03X186zjhZhkuvcQu02PJwT58yE+Owp1fl2tpD y4Q08ijE6m30Ku/Ba3ba+367hTzSU8JNvnHhRdH9I2cNE3X7z2VnIp2usAnRCf8d NL/+I5c30jn6PQ0GC7TbO6Orb1wdtn7os4I07QZcJA== -----END CERTIFICATE----- - -# Issuer: CN=T-TeleSec GlobalRoot Class 2 O=T-Systems Enterprise Services GmbH OU=T-Systems Trust Center -# Subject: CN=T-TeleSec GlobalRoot Class 2 O=T-Systems Enterprise Services GmbH OU=T-Systems Trust Center -# Label: "T-TeleSec GlobalRoot Class 2" -# Serial: 1 -# MD5 Fingerprint: 2b:9b:9e:e4:7b:6c:1f:00:72:1a:cc:c1:77:79:df:6a -# SHA1 Fingerprint: 59:0d:2d:7d:88:4f:40:2e:61:7e:a5:62:32:17:65:cf:17:d8:94:e9 -# SHA256 Fingerprint: 91:e2:f5:78:8d:58:10:eb:a7:ba:58:73:7d:e1:54:8a:8e:ca:cd:01:45:98:bc:0b:14:3e:04:1b:17:05:25:52 -----BEGIN CERTIFICATE----- MIIDwzCCAqugAwIBAgIBATANBgkqhkiG9w0BAQsFADCBgjELMAkGA1UEBhMCREUx KzApBgNVBAoMIlQtU3lzdGVtcyBFbnRlcnByaXNlIFNlcnZpY2VzIEdtYkgxHzAd @@ -2742,14 +1566,6 @@ g1XqfMIpiRvpb7PO4gWEyS8+eIVibslfwXhjdFjASBgMmTnrpMwatXlajRWc2BQN 9noHV8cigwUtPJslJj0Ys6lDfMjIq2SPDqO/nBudMNva0Bkuqjzx+zOAduTNrRlP BSeOE6Fuwg== -----END CERTIFICATE----- - -# Issuer: CN=Atos TrustedRoot 2011 O=Atos -# Subject: CN=Atos TrustedRoot 2011 O=Atos -# Label: "Atos TrustedRoot 2011" -# Serial: 6643877497813316402 -# MD5 Fingerprint: ae:b9:c4:32:4b:ac:7f:5d:66:cc:77:94:bb:2a:77:56 -# SHA1 Fingerprint: 2b:b1:f5:3e:55:0c:1d:c5:f1:d4:e6:b7:6a:46:4b:55:06:02:ac:21 -# SHA256 Fingerprint: f3:56:be:a2:44:b7:a9:1e:b3:5d:53:ca:9a:d7:86:4a:ce:01:8e:2d:35:d5:f8:f9:6d:df:68:a6:f4:1a:a4:74 -----BEGIN CERTIFICATE----- MIIDdzCCAl+gAwIBAgIIXDPLYixfszIwDQYJKoZIhvcNAQELBQAwPDEeMBwGA1UE AwwVQXRvcyBUcnVzdGVkUm9vdCAyMDExMQ0wCwYDVQQKDARBdG9zMQswCQYDVQQG @@ -2771,14 +1587,6 @@ maHFCN795trV1lpFDMS3wrUU77QR/w4VtfX128a961qn8FYiqTxlVMYVqL2Gns2D lmh6cYGJ4Qvh6hEbaAjMaZ7snkGeRDImeuKHCnE96+RapNLbxc3G3mB/ufNPRJLv KrcYPqcZ2Qt9sTdBQrC6YB3y/gkRsPCHe6ed -----END CERTIFICATE----- - -# Issuer: CN=QuoVadis Root CA 1 G3 O=QuoVadis Limited -# Subject: CN=QuoVadis Root CA 1 G3 O=QuoVadis Limited -# Label: "QuoVadis Root CA 1 G3" -# Serial: 687049649626669250736271037606554624078720034195 -# MD5 Fingerprint: a4:bc:5b:3f:fe:37:9a:fa:64:f0:e2:fa:05:3d:0b:ab -# SHA1 Fingerprint: 1b:8e:ea:57:96:29:1a:c9:39:ea:b8:0a:81:1a:73:73:c0:93:79:67 -# SHA256 Fingerprint: 8a:86:6f:d1:b2:76:b5:7e:57:8e:92:1c:65:82:8a:2b:ed:58:e9:f2:f2:88:05:41:34:b7:f1:f4:bf:c9:cc:74 -----BEGIN CERTIFICATE----- MIIFYDCCA0igAwIBAgIUeFhfLq0sGUvjNwc1NBMotZbUZZMwDQYJKoZIhvcNAQEL BQAwSDELMAkGA1UEBhMCQk0xGTAXBgNVBAoTEFF1b1ZhZGlzIExpbWl0ZWQxHjAc @@ -2810,14 +1618,6 @@ ZgKAvQU6O0ec7AAmTPWIUb+oI38YB7AL7YsmoWTTYUrrXJ/es69nA7Mf3W1daWhp q1467HxpvMc7hU6eFbm0FU/DlXpY18ls6Wy58yljXrQs8C097Vpl4KlbQMJImYFt nh8GKjwStIsPm6Ik8KaN1nrgS7ZklmOVhMJKzRwuJIczYOXD -----END CERTIFICATE----- - -# Issuer: CN=QuoVadis Root CA 2 G3 O=QuoVadis Limited -# Subject: CN=QuoVadis Root CA 2 G3 O=QuoVadis Limited -# Label: "QuoVadis Root CA 2 G3" -# Serial: 390156079458959257446133169266079962026824725800 -# MD5 Fingerprint: af:0c:86:6e:bf:40:2d:7f:0b:3e:12:50:ba:12:3d:06 -# SHA1 Fingerprint: 09:3c:61:f3:8b:8b:dc:7d:55:df:75:38:02:05:00:e1:25:f5:c8:36 -# SHA256 Fingerprint: 8f:e4:fb:0a:f9:3a:4d:0d:67:db:0b:eb:b2:3e:37:c7:1b:f3:25:dc:bc:dd:24:0e:a0:4d:af:58:b4:7e:18:40 -----BEGIN CERTIFICATE----- MIIFYDCCA0igAwIBAgIURFc0JFuBiZs18s64KztbpybwdSgwDQYJKoZIhvcNAQEL BQAwSDELMAkGA1UEBhMCQk0xGTAXBgNVBAoTEFF1b1ZhZGlzIExpbWl0ZWQxHjAc @@ -2849,14 +1649,6 @@ KCLjsZWDzYWm3S8P52dSbrsvhXz1SnPnxT7AvSESBT/8twNJAlvIJebiVDj1eYeM HVOyToV7BjjHLPj4sHKNJeV3UvQDHEimUF+IIDBu8oJDqz2XhOdT+yHBTw8imoa4 WSr2Rz0ZiC3oheGe7IUIarFsNMkd7EgrO3jtZsSOeWmD3n+M -----END CERTIFICATE----- - -# Issuer: CN=QuoVadis Root CA 3 G3 O=QuoVadis Limited -# Subject: CN=QuoVadis Root CA 3 G3 O=QuoVadis Limited -# Label: "QuoVadis Root CA 3 G3" -# Serial: 268090761170461462463995952157327242137089239581 -# MD5 Fingerprint: df:7d:b9:ad:54:6f:68:a1:df:89:57:03:97:43:b0:d7 -# SHA1 Fingerprint: 48:12:bd:92:3c:a8:c4:39:06:e7:30:6d:27:96:e6:a4:cf:22:2e:7d -# SHA256 Fingerprint: 88:ef:81:de:20:2e:b0:18:45:2e:43:f8:64:72:5c:ea:5f:bd:1f:c2:d9:d2:05:73:07:09:c5:d8:b8:69:0f:46 -----BEGIN CERTIFICATE----- MIIFYDCCA0igAwIBAgIULvWbAiin23r/1aOp7r0DoM8Sah0wDQYJKoZIhvcNAQEL BQAwSDELMAkGA1UEBhMCQk0xGTAXBgNVBAoTEFF1b1ZhZGlzIExpbWl0ZWQxHjAc @@ -2888,14 +1680,6 @@ DhcI00iX0HGS8A85PjRqHH3Y8iKuu2n0M7SmSFXRDw4m6Oy2Cy2nhTXN/VnIn9HN PlopNLk9hM6xZdRZkZFWdSHBd575euFgndOtBBj0fOtek49TSiIp+EgrPk2GrFt/ ywaZWWDYWGWVjUTR939+J399roD1B0y2PpxxVJkES/1Y+Zj0 -----END CERTIFICATE----- - -# Issuer: CN=DigiCert Assured ID Root G2 O=DigiCert Inc OU=www.digicert.com -# Subject: CN=DigiCert Assured ID Root G2 O=DigiCert Inc OU=www.digicert.com -# Label: "DigiCert Assured ID Root G2" -# Serial: 15385348160840213938643033620894905419 -# MD5 Fingerprint: 92:38:b9:f8:63:24:82:65:2c:57:33:e6:fe:81:8f:9d -# SHA1 Fingerprint: a1:4b:48:d9:43:ee:0a:0e:40:90:4f:3c:e0:a4:c0:91:93:51:5d:3f -# SHA256 Fingerprint: 7d:05:eb:b6:82:33:9f:8c:94:51:ee:09:4e:eb:fe:fa:79:53:a1:14:ed:b2:f4:49:49:45:2f:ab:7d:2f:c1:85 -----BEGIN CERTIFICATE----- MIIDljCCAn6gAwIBAgIQC5McOtY5Z+pnI7/Dr5r0SzANBgkqhkiG9w0BAQsFADBl MQswCQYDVQQGEwJVUzEVMBMGA1UEChMMRGlnaUNlcnQgSW5jMRkwFwYDVQQLExB3 @@ -2918,14 +1702,6 @@ B5yiutkBclzzTcHdDrEcDcRjvq30FPuJ7KJBDkzMyFdA0G4Dqs0MjomZmWzwPDCv ON9vvKO+KSAnq3T/EyJ43pdSVR6DtVQgA+6uwE9W3jfMw3+qBCe703e4YtsXfJwo IhNzbM8m9Yop5w== -----END CERTIFICATE----- - -# Issuer: CN=DigiCert Assured ID Root G3 O=DigiCert Inc OU=www.digicert.com -# Subject: CN=DigiCert Assured ID Root G3 O=DigiCert Inc OU=www.digicert.com -# Label: "DigiCert Assured ID Root G3" -# Serial: 15459312981008553731928384953135426796 -# MD5 Fingerprint: 7c:7f:65:31:0c:81:df:8d:ba:3e:99:e2:5c:ad:6e:fb -# SHA1 Fingerprint: f5:17:a2:4f:9a:48:c6:c9:f8:a2:00:26:9f:dc:0f:48:2c:ab:30:89 -# SHA256 Fingerprint: 7e:37:cb:8b:4c:47:09:0c:ab:36:55:1b:a6:f4:5d:b8:40:68:0f:ba:16:6a:95:2d:b1:00:71:7f:43:05:3f:c2 -----BEGIN CERTIFICATE----- MIICRjCCAc2gAwIBAgIQC6Fa+h3foLVJRK/NJKBs7DAKBggqhkjOPQQDAzBlMQsw CQYDVQQGEwJVUzEVMBMGA1UEChMMRGlnaUNlcnQgSW5jMRkwFwYDVQQLExB3d3cu @@ -2941,14 +1717,6 @@ AwNnADBkAjAlpIFFAmsSS3V0T8gj43DydXLefInwz5FyYZ5eEJJZVrmDxxDnOOlY JjZ91eQ0hjkCMHw2U/Aw5WJjOpnitqM7mzT6HtoQknFekROn3aRukswy1vUhZscv 6pZjamVFkpUBtA== -----END CERTIFICATE----- - -# Issuer: CN=DigiCert Global Root G2 O=DigiCert Inc OU=www.digicert.com -# Subject: CN=DigiCert Global Root G2 O=DigiCert Inc OU=www.digicert.com -# Label: "DigiCert Global Root G2" -# Serial: 4293743540046975378534879503202253541 -# MD5 Fingerprint: e4:a6:8a:c8:54:ac:52:42:46:0a:fd:72:48:1b:2a:44 -# SHA1 Fingerprint: df:3c:24:f9:bf:d6:66:76:1b:26:80:73:fe:06:d1:cc:8d:4f:82:a4 -# SHA256 Fingerprint: cb:3c:cb:b7:60:31:e5:e0:13:8f:8d:d3:9a:23:f9:de:47:ff:c3:5e:43:c1:14:4c:ea:27:d4:6a:5a:b1:cb:5f -----BEGIN CERTIFICATE----- MIIDjjCCAnagAwIBAgIQAzrx5qcRqaC7KGSxHQn65TANBgkqhkiG9w0BAQsFADBh MQswCQYDVQQGEwJVUzEVMBMGA1UEChMMRGlnaUNlcnQgSW5jMRkwFwYDVQQLExB3 @@ -2971,14 +1739,6 @@ Fdtom/DzMNU+MeKNhJ7jitralj41E6Vf8PlwUHBHQRFXGU7Aj64GxJUTFy8bJZ91 pLiaWN0bfVKfjllDiIGknibVb63dDcY3fe0Dkhvld1927jyNxF1WW6LZZm6zNTfl MrY= -----END CERTIFICATE----- - -# Issuer: CN=DigiCert Global Root G3 O=DigiCert Inc OU=www.digicert.com -# Subject: CN=DigiCert Global Root G3 O=DigiCert Inc OU=www.digicert.com -# Label: "DigiCert Global Root G3" -# Serial: 7089244469030293291760083333884364146 -# MD5 Fingerprint: f5:5d:a4:50:a5:fb:28:7e:1e:0f:0d:cc:96:57:56:ca -# SHA1 Fingerprint: 7e:04:de:89:6a:3e:66:6d:00:e6:87:d3:3f:fa:d9:3b:e8:3d:34:9e -# SHA256 Fingerprint: 31:ad:66:48:f8:10:41:38:c7:38:f3:9e:a4:32:01:33:39:3e:3a:18:cc:02:29:6e:f9:7c:2a:c9:ef:67:31:d0 -----BEGIN CERTIFICATE----- MIICPzCCAcWgAwIBAgIQBVVWvPJepDU1w6QP1atFcjAKBggqhkjOPQQDAzBhMQsw CQYDVQQGEwJVUzEVMBMGA1UEChMMRGlnaUNlcnQgSW5jMRkwFwYDVQQLExB3d3cu @@ -2994,14 +1754,6 @@ AK288mw/EkrRLTnDCgmXc/SINoyIJ7vmiI1Qhadj+Z4y3maTD/HMsQmP3Wyr+mt/ oAIwOWZbwmSNuJ5Q3KjVSaLtx9zRSX8XAbjIho9OjIgrqJqpisXRAL34VOKa5Vt8 sycX -----END CERTIFICATE----- - -# Issuer: CN=DigiCert Trusted Root G4 O=DigiCert Inc OU=www.digicert.com -# Subject: CN=DigiCert Trusted Root G4 O=DigiCert Inc OU=www.digicert.com -# Label: "DigiCert Trusted Root G4" -# Serial: 7451500558977370777930084869016614236 -# MD5 Fingerprint: 78:f2:fc:aa:60:1f:2f:b4:eb:c9:37:ba:53:2e:75:49 -# SHA1 Fingerprint: dd:fb:16:cd:49:31:c9:73:a2:03:7d:3f:c8:3a:4d:7d:77:5d:05:e4 -# SHA256 Fingerprint: 55:2f:7b:dc:f1:a7:af:9e:6c:e6:72:01:7f:4f:12:ab:f7:72:40:c7:8e:76:1a:c2:03:d1:d9:d2:0a:c8:99:88 -----BEGIN CERTIFICATE----- MIIFkDCCA3igAwIBAgIQBZsbV56OITLiOQe9p3d1XDANBgkqhkiG9w0BAQwFADBi MQswCQYDVQQGEwJVUzEVMBMGA1UEChMMRGlnaUNlcnQgSW5jMRkwFwYDVQQLExB3 @@ -3034,14 +1786,6 @@ r/OSmbaz5mEP0oUA51Aa5BuVnRmhuZyxm7EAHu/QD09CbMkKvO5D+jpxpchNJqU1 /YldvIViHTLSoCtU7ZpXwdv6EM8Zt4tKG48BtieVU+i2iW1bvGjUI+iLUaJW+fCm gKDWHrO8Dw9TdSmq6hN35N6MgSGtBxBHEa2HPQfRdbzP82Z+ -----END CERTIFICATE----- - -# Issuer: CN=COMODO RSA Certification Authority O=COMODO CA Limited -# Subject: CN=COMODO RSA Certification Authority O=COMODO CA Limited -# Label: "COMODO RSA Certification Authority" -# Serial: 101909084537582093308941363524873193117 -# MD5 Fingerprint: 1b:31:b0:71:40:36:cc:14:36:91:ad:c4:3e:fd:ec:18 -# SHA1 Fingerprint: af:e5:d2:44:a8:d1:19:42:30:ff:47:9f:e2:f8:97:bb:cd:7a:8c:b4 -# SHA256 Fingerprint: 52:f0:e1:c4:e5:8e:c6:29:29:1b:60:31:7f:07:46:71:b8:5d:7e:a8:0d:5b:07:27:34:63:53:4b:32:b4:02:34 -----BEGIN CERTIFICATE----- MIIF2DCCA8CgAwIBAgIQTKr5yttjb+Af907YWwOGnTANBgkqhkiG9w0BAQwFADCB hTELMAkGA1UEBhMCR0IxGzAZBgNVBAgTEkdyZWF0ZXIgTWFuY2hlc3RlcjEQMA4G @@ -3076,14 +1820,6 @@ QOhTsiedSrnAdyGN/4fy3ryM7xfft0kL0fJuMAsaDk527RH89elWsn2/x20Kk4yl 0MC2Hb46TpSi125sC8KKfPog88Tk5c0NqMuRkrF8hey1FGlmDoLnzc7ILaZRfyHB NVOFBkpdn627G190 -----END CERTIFICATE----- - -# Issuer: CN=USERTrust RSA Certification Authority O=The USERTRUST Network -# Subject: CN=USERTrust RSA Certification Authority O=The USERTRUST Network -# Label: "USERTrust RSA Certification Authority" -# Serial: 2645093764781058787591871645665788717 -# MD5 Fingerprint: 1b:fe:69:d1:91:b7:19:33:a3:72:a8:0f:e1:55:e5:b5 -# SHA1 Fingerprint: 2b:8f:1b:57:33:0d:bb:a2:d0:7a:6c:51:f7:0e:e9:0d:da:b9:ad:8e -# SHA256 Fingerprint: e7:93:c9:b0:2f:d8:aa:13:e2:1c:31:22:8a:cc:b0:81:19:64:3b:74:9c:89:89:64:b1:74:6d:46:c3:d4:cb:d2 -----BEGIN CERTIFICATE----- MIIF3jCCA8agAwIBAgIQAf1tMPyjylGoG7xkDjUDLTANBgkqhkiG9w0BAQwFADCB iDELMAkGA1UEBhMCVVMxEzARBgNVBAgTCk5ldyBKZXJzZXkxFDASBgNVBAcTC0pl @@ -3118,14 +1854,6 @@ VXyNWQKV3WKdwrnuWih0hKWbt5DHDAff9Yk2dDLWKMGwsAvgnEzDHNb842m1R0aB L6KCq9NjRHDEjf8tM7qtj3u1cIiuPhnPQCjY/MiQu12ZIvVS5ljFH4gxQ+6IHdfG jjxDah2nGN59PRbxYvnKkKj9 -----END CERTIFICATE----- - -# Issuer: CN=USERTrust ECC Certification Authority O=The USERTRUST Network -# Subject: CN=USERTrust ECC Certification Authority O=The USERTRUST Network -# Label: "USERTrust ECC Certification Authority" -# Serial: 123013823720199481456569720443997572134 -# MD5 Fingerprint: fa:68:bc:d9:b5:7f:ad:fd:c9:1d:06:83:28:cc:24:c1 -# SHA1 Fingerprint: d1:cb:ca:5d:b2:d5:2a:7f:69:3b:67:4d:e5:f0:5a:1d:0c:95:7d:f0 -# SHA256 Fingerprint: 4f:f4:60:d5:4b:9c:86:da:bf:bc:fc:57:12:e0:40:0d:2b:ed:3f:bc:4d:4f:bd:aa:86:e0:6a:dc:d2:a9:ad:7a -----BEGIN CERTIFICATE----- MIICjzCCAhWgAwIBAgIQXIuZxVqUxdJxVt7NiYDMJjAKBggqhkjOPQQDAzCBiDEL MAkGA1UEBhMCVVMxEzARBgNVBAgTCk5ldyBKZXJzZXkxFDASBgNVBAcTC0plcnNl @@ -3142,14 +1870,6 @@ VR0TAQH/BAUwAwEB/zAKBggqhkjOPQQDAwNoADBlAjA2Z6EWCNzklwBBHU6+4WMB zzuqQhFkoJ2UOQIReVx7Hfpkue4WQrO/isIJxOzksU0CMQDpKmFHjFJKS04YcPbW RNZu9YO6bVi9JNlWSOrvxKJGgYhqOkbRqZtNyWHa0V1Xahg= -----END CERTIFICATE----- - -# Issuer: CN=GlobalSign O=GlobalSign OU=GlobalSign ECC Root CA - R4 -# Subject: CN=GlobalSign O=GlobalSign OU=GlobalSign ECC Root CA - R4 -# Label: "GlobalSign ECC Root CA - R4" -# Serial: 14367148294922964480859022125800977897474 -# MD5 Fingerprint: 20:f0:27:68:d1:7e:a0:9d:0e:e6:2a:ca:df:5c:89:8e -# SHA1 Fingerprint: 69:69:56:2e:40:80:f4:24:a1:e7:19:9f:14:ba:f3:ee:58:ab:6a:bb -# SHA256 Fingerprint: be:c9:49:11:c2:95:56:76:db:6c:0a:55:09:86:d7:6e:3b:a0:05:66:7c:44:2c:97:62:b4:fb:b7:73:de:22:8c -----BEGIN CERTIFICATE----- MIIB4TCCAYegAwIBAgIRKjikHJYKBN5CsiilC+g0mAIwCgYIKoZIzj0EAwIwUDEk MCIGA1UECxMbR2xvYmFsU2lnbiBFQ0MgUm9vdCBDQSAtIFI0MRMwEQYDVQQKEwpH @@ -3163,14 +1883,6 @@ uOJAf/sKbvu+M8k8o4TVMAoGCCqGSM49BAMCA0gAMEUCIQDckqGgE6bPA7DmxCGX kPoUVy0D7O48027KqGx2vKLeuwIgJ6iFJzWbVsaj8kfSt24bAgAXqmemFZHe+pTs ewv4n4Q= -----END CERTIFICATE----- - -# Issuer: CN=GlobalSign O=GlobalSign OU=GlobalSign ECC Root CA - R5 -# Subject: CN=GlobalSign O=GlobalSign OU=GlobalSign ECC Root CA - R5 -# Label: "GlobalSign ECC Root CA - R5" -# Serial: 32785792099990507226680698011560947931244 -# MD5 Fingerprint: 9f:ad:3b:1c:02:1e:8a:ba:17:74:38:81:0c:a2:bc:08 -# SHA1 Fingerprint: 1f:24:c6:30:cd:a4:18:ef:20:69:ff:ad:4f:dd:5f:46:3a:1b:69:aa -# SHA256 Fingerprint: 17:9f:bc:14:8a:3d:d0:0f:d2:4e:a1:34:58:cc:43:bf:a7:f5:9c:81:82:d7:83:a5:13:f6:eb:ec:10:0c:89:24 -----BEGIN CERTIFICATE----- MIICHjCCAaSgAwIBAgIRYFlJ4CYuu1X5CneKcflK2GwwCgYIKoZIzj0EAwMwUDEk MCIGA1UECxMbR2xvYmFsU2lnbiBFQ0MgUm9vdCBDQSAtIFI1MRMwEQYDVQQKEwpH @@ -3185,54 +1897,6 @@ KoZIzj0EAwMDaAAwZQIxAOVpEslu28YxuglB4Zf4+/2a4n0Sye18ZNPLBSWLVtmg 515dTguDnFt2KaAJJiFqYgIwcdK1j1zqO+F4CYWodZI7yFz9SO8NdCKoCOJuxUnO xwy8p2Fp8fc74SrL+SvzZpA3 -----END CERTIFICATE----- - -# Issuer: CN=Staat der Nederlanden Root CA - G3 O=Staat der Nederlanden -# Subject: CN=Staat der Nederlanden Root CA - G3 O=Staat der Nederlanden -# Label: "Staat der Nederlanden Root CA - G3" -# Serial: 10003001 -# MD5 Fingerprint: 0b:46:67:07:db:10:2f:19:8c:35:50:60:d1:0b:f4:37 -# SHA1 Fingerprint: d8:eb:6b:41:51:92:59:e0:f3:e7:85:00:c0:3d:b6:88:97:c9:ee:fc -# SHA256 Fingerprint: 3c:4f:b0:b9:5a:b8:b3:00:32:f4:32:b8:6f:53:5f:e1:72:c1:85:d0:fd:39:86:58:37:cf:36:18:7f:a6:f4:28 ------BEGIN CERTIFICATE----- -MIIFdDCCA1ygAwIBAgIEAJiiOTANBgkqhkiG9w0BAQsFADBaMQswCQYDVQQGEwJO -TDEeMBwGA1UECgwVU3RhYXQgZGVyIE5lZGVybGFuZGVuMSswKQYDVQQDDCJTdGFh -dCBkZXIgTmVkZXJsYW5kZW4gUm9vdCBDQSAtIEczMB4XDTEzMTExNDExMjg0MloX -DTI4MTExMzIzMDAwMFowWjELMAkGA1UEBhMCTkwxHjAcBgNVBAoMFVN0YWF0IGRl -ciBOZWRlcmxhbmRlbjErMCkGA1UEAwwiU3RhYXQgZGVyIE5lZGVybGFuZGVuIFJv -b3QgQ0EgLSBHMzCCAiIwDQYJKoZIhvcNAQEBBQADggIPADCCAgoCggIBAL4yolQP -cPssXFnrbMSkUeiFKrPMSjTysF/zDsccPVMeiAho2G89rcKezIJnByeHaHE6n3WW -IkYFsO2tx1ueKt6c/DrGlaf1F2cY5y9JCAxcz+bMNO14+1Cx3Gsy8KL+tjzk7FqX -xz8ecAgwoNzFs21v0IJyEavSgWhZghe3eJJg+szeP4TrjTgzkApyI/o1zCZxMdFy -KJLZWyNtZrVtB0LrpjPOktvA9mxjeM3KTj215VKb8b475lRgsGYeCasH/lSJEULR -9yS6YHgamPfJEf0WwTUaVHXvQ9Plrk7O53vDxk5hUUurmkVLoR9BvUhTFXFkC4az -5S6+zqQbwSmEorXLCCN2QyIkHxcE1G6cxvx/K2Ya7Irl1s9N9WMJtxU51nus6+N8 -6U78dULI7ViVDAZCopz35HCz33JvWjdAidiFpNfxC95DGdRKWCyMijmev4SH8RY7 -Ngzp07TKbBlBUgmhHbBqv4LvcFEhMtwFdozL92TkA1CvjJFnq8Xy7ljY3r735zHP -bMk7ccHViLVlvMDoFxcHErVc0qsgk7TmgoNwNsXNo42ti+yjwUOH5kPiNL6VizXt -BznaqB16nzaeErAMZRKQFWDZJkBE41ZgpRDUajz9QdwOWke275dhdU/Z/seyHdTt -XUmzqWrLZoQT1Vyg3N9udwbRcXXIV2+vD3dbAgMBAAGjQjBAMA8GA1UdEwEB/wQF -MAMBAf8wDgYDVR0PAQH/BAQDAgEGMB0GA1UdDgQWBBRUrfrHkleuyjWcLhL75Lpd -INyUVzANBgkqhkiG9w0BAQsFAAOCAgEAMJmdBTLIXg47mAE6iqTnB/d6+Oea31BD -U5cqPco8R5gu4RV78ZLzYdqQJRZlwJ9UXQ4DO1t3ApyEtg2YXzTdO2PCwyiBwpwp -LiniyMMB8jPqKqrMCQj3ZWfGzd/TtiunvczRDnBfuCPRy5FOCvTIeuXZYzbB1N/8 -Ipf3YF3qKS9Ysr1YvY2WTxB1v0h7PVGHoTx0IsL8B3+A3MSs/mrBcDCw6Y5p4ixp -gZQJut3+TcCDjJRYwEYgr5wfAvg1VUkvRtTA8KCWAg8zxXHzniN9lLf9OtMJgwYh -/WA9rjLA0u6NpvDntIJ8CsxwyXmA+P5M9zWEGYox+wrZ13+b8KKaa8MFSu1BYBQw -0aoRQm7TIwIEC8Zl3d1Sd9qBa7Ko+gE4uZbqKmxnl4mUnrzhVNXkanjvSr0rmj1A -fsbAddJu+2gw7OyLnflJNZoaLNmzlTnVHpL3prllL+U9bTpITAjc5CgSKL59NVzq -4BZ+Extq1z7XnvwtdbLBFNUjA9tbbws+eC8N3jONFrdI54OagQ97wUNNVQQXOEpR -1VmiiXTTn74eS9fGbbeIJG9gkaSChVtWQbzQRKtqE77RLFi3EjNYsjdj3BP1lB0/ -QFH1T/U67cjF68IeHRaVesd+QnGTbksVtzDfqu1XhUisHWrdOWnk4Xl4vs4Fv6EM -94B7IWcnMFk= ------END CERTIFICATE----- - -# Issuer: CN=Staat der Nederlanden EV Root CA O=Staat der Nederlanden -# Subject: CN=Staat der Nederlanden EV Root CA O=Staat der Nederlanden -# Label: "Staat der Nederlanden EV Root CA" -# Serial: 10000013 -# MD5 Fingerprint: fc:06:af:7b:e8:1a:f1:9a:b4:e8:d2:70:1f:c0:f5:ba -# SHA1 Fingerprint: 76:e2:7e:c1:4f:db:82:c1:c0:a6:75:b5:05:be:3d:29:b4:ed:db:bb -# SHA256 Fingerprint: 4d:24:91:41:4c:fe:95:67:46:ec:4c:ef:a6:cf:6f:72:e2:8a:13:29:43:2f:9d:8a:90:7a:c4:cb:5d:ad:c1:5a -----BEGIN CERTIFICATE----- MIIFcDCCA1igAwIBAgIEAJiWjTANBgkqhkiG9w0BAQsFADBYMQswCQYDVQQGEwJO TDEeMBwGA1UECgwVU3RhYXQgZGVyIE5lZGVybGFuZGVuMSkwJwYDVQQDDCBTdGFh @@ -3265,14 +1929,6 @@ eG9QgkRQP2YGiqtDhFZKDyAthg710tvSeopLzaXoTvFeJiUBWSOgftL2fiFX1ye8 FVdMpEbB4IMeDExNH08GGeL5qPQ6gqGyeUN51q1veieQA6TqJIc/2b3Z6fJfUEkc 7uzXLg== -----END CERTIFICATE----- - -# Issuer: CN=IdenTrust Commercial Root CA 1 O=IdenTrust -# Subject: CN=IdenTrust Commercial Root CA 1 O=IdenTrust -# Label: "IdenTrust Commercial Root CA 1" -# Serial: 13298821034946342390520003877796839426 -# MD5 Fingerprint: b3:3e:77:73:75:ee:a0:d3:e3:7e:49:63:49:59:bb:c7 -# SHA1 Fingerprint: df:71:7e:aa:4a:d9:4e:c9:55:84:99:60:2d:48:de:5f:bc:f0:3a:25 -# SHA256 Fingerprint: 5d:56:49:9b:e4:d2:e0:8b:cf:ca:d0:8a:3e:38:72:3d:50:50:3b:de:70:69:48:e4:2f:55:60:30:19:e5:28:ae -----BEGIN CERTIFICATE----- MIIFYDCCA0igAwIBAgIQCgFCgAAAAUUjyES1AAAAAjANBgkqhkiG9w0BAQsFADBK MQswCQYDVQQGEwJVUzESMBAGA1UEChMJSWRlblRydXN0MScwJQYDVQQDEx5JZGVu @@ -3304,14 +1960,6 @@ l1gEIt44w8y8bckzOmoKaT+gyOpyj4xjhiO9bTyWnpXgSUyqorkqG5w2gXjtw+hG mUlO+KWA2yUPHGNiiskzZ2s8EIPGrd6ozRaOjfAHN3Gf8qv8QfXBi+wAN10J5U6A 7/qxXDgGpRtK4dw4LTzcqx+QGtVKnO7RcGzM7vRX+Bi6hG6H -----END CERTIFICATE----- - -# Issuer: CN=IdenTrust Public Sector Root CA 1 O=IdenTrust -# Subject: CN=IdenTrust Public Sector Root CA 1 O=IdenTrust -# Label: "IdenTrust Public Sector Root CA 1" -# Serial: 13298821034946342390521976156843933698 -# MD5 Fingerprint: 37:06:a5:b0:fc:89:9d:ba:f4:6b:8c:1a:64:cd:d5:ba -# SHA1 Fingerprint: ba:29:41:60:77:98:3f:f4:f3:ef:f2:31:05:3b:2e:ea:6d:4d:45:fd -# SHA256 Fingerprint: 30:d0:89:5a:9a:44:8a:26:20:91:63:55:22:d1:f5:20:10:b5:86:7a:ca:e1:2c:78:ef:95:8f:d4:f4:38:9f:2f -----BEGIN CERTIFICATE----- MIIFZjCCA06gAwIBAgIQCgFCgAAAAUUjz0Z8AAAAAjANBgkqhkiG9w0BAQsFADBN MQswCQYDVQQGEwJVUzESMBAGA1UEChMJSWRlblRydXN0MSowKAYDVQQDEyFJZGVu @@ -3343,14 +1991,6 @@ tshquDDIajjDbp7hNxbqBWJMWxJH7ae0s1hWx0nzfxJoCTFx8G34Tkf71oXuxVhA GaQdp/lLQzfcaFpPz+vCZHTetBXZ9FRUGi8c15dxVJCO2SCdUyt/q4/i6jC8UDfv 8Ue1fXwsBOxonbRJRBD0ckscZOf85muQ3Wl9af0AVqW3rLatt8o+Ae+c -----END CERTIFICATE----- - -# Issuer: CN=Entrust Root Certification Authority - G2 O=Entrust, Inc. OU=See www.entrust.net/legal-terms/(c) 2009 Entrust, Inc. - for authorized use only -# Subject: CN=Entrust Root Certification Authority - G2 O=Entrust, Inc. OU=See www.entrust.net/legal-terms/(c) 2009 Entrust, Inc. - for authorized use only -# Label: "Entrust Root Certification Authority - G2" -# Serial: 1246989352 -# MD5 Fingerprint: 4b:e2:c9:91:96:65:0c:f4:0e:5a:93:92:a0:0a:fe:b2 -# SHA1 Fingerprint: 8c:f4:27:fd:79:0c:3a:d1:66:06:8d:e8:1e:57:ef:bb:93:22:72:d4 -# SHA256 Fingerprint: 43:df:57:74:b0:3e:7f:ef:5f:e4:0d:93:1a:7b:ed:f1:bb:2e:6b:42:73:8c:4e:6d:38:41:10:3d:3a:a7:f3:39 -----BEGIN CERTIFICATE----- MIIEPjCCAyagAwIBAgIESlOMKDANBgkqhkiG9w0BAQsFADCBvjELMAkGA1UEBhMC VVMxFjAUBgNVBAoTDUVudHJ1c3QsIEluYy4xKDAmBgNVBAsTH1NlZSB3d3cuZW50 @@ -3376,14 +2016,6 @@ Rkfz6/djwUAFQKXSt/S1mja/qYh2iARVBCuch38aNzx+LaUa2NSJXsq9rD1s2G2v nAuknZoh8/CbCzB428Hch0P+vGOaysXCHMnHjf87ElgI5rY97HosTvuDls4MPGmH VHOkc8KT/1EQrBVUAdj8BbGJoX90g5pJ19xOe4pIb4tF9g== -----END CERTIFICATE----- - -# Issuer: CN=Entrust Root Certification Authority - EC1 O=Entrust, Inc. OU=See www.entrust.net/legal-terms/(c) 2012 Entrust, Inc. - for authorized use only -# Subject: CN=Entrust Root Certification Authority - EC1 O=Entrust, Inc. OU=See www.entrust.net/legal-terms/(c) 2012 Entrust, Inc. - for authorized use only -# Label: "Entrust Root Certification Authority - EC1" -# Serial: 51543124481930649114116133369 -# MD5 Fingerprint: b6:7e:1d:f0:58:c5:49:6c:24:3b:3d:ed:98:18:ed:bc -# SHA1 Fingerprint: 20:d8:06:40:df:9b:25:f5:12:25:3a:11:ea:f7:59:8a:eb:14:b5:47 -# SHA256 Fingerprint: 02:ed:0e:b2:8c:14:da:45:16:5c:56:67:91:70:0d:64:51:d7:fb:56:f0:b2:ab:1d:3b:8e:b0:70:e5:6e:df:f5 -----BEGIN CERTIFICATE----- MIIC+TCCAoCgAwIBAgINAKaLeSkAAAAAUNCR+TAKBggqhkjOPQQDAzCBvzELMAkG A1UEBhMCVVMxFjAUBgNVBAoTDUVudHJ1c3QsIEluYy4xKDAmBgNVBAsTH1NlZSB3 @@ -3402,14 +2034,6 @@ BBYEFLdj5xrdjekIplWDpOBqUEFlEUJJMAoGCCqGSM49BAMDA2cAMGQCMGF52OVC R98crlOZF7ZvHH3hvxGU0QOIdeSNiaSKd0bebWHvAvX7td/M/k7//qnmpwIwW5nX hTcGtXsI/esni0qU+eH6p44mCOh8kmhtc9hvJqwhAriZtyZBWyVgrtBIGu4G -----END CERTIFICATE----- - -# Issuer: CN=CFCA EV ROOT O=China Financial Certification Authority -# Subject: CN=CFCA EV ROOT O=China Financial Certification Authority -# Label: "CFCA EV ROOT" -# Serial: 407555286 -# MD5 Fingerprint: 74:e1:b6:ed:26:7a:7a:44:30:33:94:ab:7b:27:81:30 -# SHA1 Fingerprint: e2:b8:29:4b:55:84:ab:6b:58:c2:90:46:6c:ac:3f:b8:39:8f:84:83 -# SHA256 Fingerprint: 5c:c3:d7:8e:4e:1d:5e:45:54:7a:04:e6:87:3e:64:f9:0c:f9:53:6d:1c:cc:2e:f8:00:f3:55:c4:c5:fd:70:fd -----BEGIN CERTIFICATE----- MIIFjTCCA3WgAwIBAgIEGErM1jANBgkqhkiG9w0BAQsFADBWMQswCQYDVQQGEwJD TjEwMC4GA1UECgwnQ2hpbmEgRmluYW5jaWFsIENlcnRpZmljYXRpb24gQXV0aG9y @@ -3442,14 +2066,6 @@ Ci77o0cOPaYjesYBx4/IXr9tgFa+iiS6M+qf4TIRnvHST4D2G0CvOJ4RUHlzEhLN AAoACxGV2lZFA4gKn2fQ1XmxqI1AbQ3CekD6819kR5LLU7m7Wc5P/dAVUwHY3+vZ 5nbv0CO7O6l5s9UCKc2Jo5YPSjXnTkLAdc0Hz+Ys63su -----END CERTIFICATE----- - -# Issuer: CN=OISTE WISeKey Global Root GB CA O=WISeKey OU=OISTE Foundation Endorsed -# Subject: CN=OISTE WISeKey Global Root GB CA O=WISeKey OU=OISTE Foundation Endorsed -# Label: "OISTE WISeKey Global Root GB CA" -# Serial: 157768595616588414422159278966750757568 -# MD5 Fingerprint: a4:eb:b9:61:28:2e:b7:2f:98:b0:35:26:90:99:51:1d -# SHA1 Fingerprint: 0f:f9:40:76:18:d3:d7:6a:4b:98:f0:a8:35:9e:0c:fd:27:ac:cc:ed -# SHA256 Fingerprint: 6b:9c:08:e8:6e:b0:f7:67:cf:ad:65:cd:98:b6:21:49:e5:49:4a:67:f5:84:5e:7b:d1:ed:01:9f:27:b8:6b:d6 -----BEGIN CERTIFICATE----- MIIDtTCCAp2gAwIBAgIQdrEgUnTwhYdGs/gjGvbCwDANBgkqhkiG9w0BAQsFADBt MQswCQYDVQQGEwJDSDEQMA4GA1UEChMHV0lTZUtleTEiMCAGA1UECxMZT0lTVEUg @@ -3472,14 +2088,6 @@ ZvUPQ82nK1d7Y0Zqqi5S2PTt4W2tKZB4SLrhI6qjiey1q5bAtEuiHZeeevJuQHHf aPFlTc58Bd9TZaml8LGXBHAVRgOY1NK/VLSgWH1Sb9pWJmLU2NuJMW8c8CLC02Ic Nc1MaRVUGpCY3useX8p3x8uOPUNpnJpY0CQ73xtAln41rYHHTnG6iBM= -----END CERTIFICATE----- - -# Issuer: CN=SZAFIR ROOT CA2 O=Krajowa Izba Rozliczeniowa S.A. -# Subject: CN=SZAFIR ROOT CA2 O=Krajowa Izba Rozliczeniowa S.A. -# Label: "SZAFIR ROOT CA2" -# Serial: 357043034767186914217277344587386743377558296292 -# MD5 Fingerprint: 11:64:c1:89:b0:24:b1:8c:b1:07:7e:89:9e:51:9e:99 -# SHA1 Fingerprint: e2:52:fa:95:3f:ed:db:24:60:bd:6e:28:f3:9c:cc:cf:5e:b3:3f:de -# SHA256 Fingerprint: a1:33:9d:33:28:1a:0b:56:e5:57:d3:d3:2b:1c:e7:f9:36:7e:b0:94:bd:5f:a7:2a:7e:50:04:c8:de:d7:ca:fe -----BEGIN CERTIFICATE----- MIIDcjCCAlqgAwIBAgIUPopdB+xV0jLVt+O2XwHrLdzk1uQwDQYJKoZIhvcNAQEL BQAwUTELMAkGA1UEBhMCUEwxKDAmBgNVBAoMH0tyYWpvd2EgSXpiYSBSb3psaWN6 @@ -3501,14 +2109,6 @@ oky4rc/hkA/NrgrHXXu3UNLUYfrVFdvXn4dRVOul4+vJhaAlIDf7js4MNIThPIGy d05DpYhfhmehPea0XGG2Ptv+tyjFogeutcrKjSoS75ftwjCkySp6+/NNIxuZMzSg LvWpCz/UXeHPhJ/iGcJfitYgHuNztw== -----END CERTIFICATE----- - -# Issuer: CN=Certum Trusted Network CA 2 O=Unizeto Technologies S.A. OU=Certum Certification Authority -# Subject: CN=Certum Trusted Network CA 2 O=Unizeto Technologies S.A. OU=Certum Certification Authority -# Label: "Certum Trusted Network CA 2" -# Serial: 44979900017204383099463764357512596969 -# MD5 Fingerprint: 6d:46:9e:d9:25:6d:08:23:5b:5e:74:7d:1e:27:db:f2 -# SHA1 Fingerprint: d3:dd:48:3e:2b:bf:4c:05:e8:af:10:f5:fa:76:26:cf:d3:dc:30:92 -# SHA256 Fingerprint: b6:76:f2:ed:da:e8:77:5c:d3:6c:b0:f6:3c:d1:d4:60:39:61:f4:9e:62:65:ba:01:3a:2f:03:07:b6:d0:b8:04 -----BEGIN CERTIFICATE----- MIIF0jCCA7qgAwIBAgIQIdbQSk8lD8kyN/yqXhKN6TANBgkqhkiG9w0BAQ0FADCB gDELMAkGA1UEBhMCUEwxIjAgBgNVBAoTGVVuaXpldG8gVGVjaG5vbG9naWVzIFMu @@ -3543,14 +2143,6 @@ XALKLNhvSgfZyTXaQHXyxKcZb55CEJh15pWLYLztxRLXis7VmFxWlgPF7ncGNf/P 5O4/E2Hu29othfDNrp2yGAlFw5Khchf8R7agCyzxxN5DaAhqXzvwdmP7zAYspsbi DrW5viSP -----END CERTIFICATE----- - -# Issuer: CN=Hellenic Academic and Research Institutions RootCA 2015 O=Hellenic Academic and Research Institutions Cert. Authority -# Subject: CN=Hellenic Academic and Research Institutions RootCA 2015 O=Hellenic Academic and Research Institutions Cert. Authority -# Label: "Hellenic Academic and Research Institutions RootCA 2015" -# Serial: 0 -# MD5 Fingerprint: ca:ff:e2:db:03:d9:cb:4b:e9:0f:ad:84:fd:7b:18:ce -# SHA1 Fingerprint: 01:0c:06:95:a6:98:19:14:ff:bf:5f:c6:b0:b6:95:ea:29:e9:12:a6 -# SHA256 Fingerprint: a0:40:92:9a:02:ce:53:b4:ac:f4:f2:ff:c6:98:1c:e4:49:6f:75:5e:6d:45:fe:0b:2a:69:2b:cd:52:52:3f:36 -----BEGIN CERTIFICATE----- MIIGCzCCA/OgAwIBAgIBADANBgkqhkiG9w0BAQsFADCBpjELMAkGA1UEBhMCR1Ix DzANBgNVBAcTBkF0aGVuczFEMEIGA1UEChM7SGVsbGVuaWMgQWNhZGVtaWMgYW5k @@ -3586,14 +2178,6 @@ pcw72Hc3MKJP2W/R8kCtQXoXxdZKNYm3QdV8hn9VTYNKpXMgwDqvkPGaJI7ZjnHK e7iG2rKPmT4dEw0SEe7Uq/DpFXYC5ODfqiAeW2GFZECpkJcNrVPSWh2HagCXZWK0 vm9qp/UsQu0yrbYhnr68 -----END CERTIFICATE----- - -# Issuer: CN=Hellenic Academic and Research Institutions ECC RootCA 2015 O=Hellenic Academic and Research Institutions Cert. Authority -# Subject: CN=Hellenic Academic and Research Institutions ECC RootCA 2015 O=Hellenic Academic and Research Institutions Cert. Authority -# Label: "Hellenic Academic and Research Institutions ECC RootCA 2015" -# Serial: 0 -# MD5 Fingerprint: 81:e5:b4:17:eb:c2:f5:e1:4b:0d:41:7b:49:92:fe:ef -# SHA1 Fingerprint: 9f:f1:71:8d:92:d5:9a:f3:7d:74:97:b4:bc:6f:84:68:0b:ba:b6:66 -# SHA256 Fingerprint: 44:b5:45:aa:8a:25:e6:5a:73:ca:15:dc:27:fc:36:d2:4c:1c:b9:95:3a:06:65:39:b1:15:82:dc:48:7b:48:33 -----BEGIN CERTIFICATE----- MIICwzCCAkqgAwIBAgIBADAKBggqhkjOPQQDAjCBqjELMAkGA1UEBhMCR1IxDzAN BgNVBAcTBkF0aGVuczFEMEIGA1UEChM7SGVsbGVuaWMgQWNhZGVtaWMgYW5kIFJl @@ -3611,14 +2195,6 @@ C4KZJAEOnLvkDv2/+5cgk5kqMAoGCCqGSM49BAMCA2cAMGQCMGfOFmI4oqxiRaep lSTAGiecMjvAwNW6qef4BENThe5SId6d9SWDPp5YSy/XZxMOIQIwBeF1Ad5o7Sof TUwJCA3sS61kFyjndc5FZXIhF8siQQ6ME5g4mlRtm8rifOoCWCKR -----END CERTIFICATE----- - -# Issuer: CN=ISRG Root X1 O=Internet Security Research Group -# Subject: CN=ISRG Root X1 O=Internet Security Research Group -# Label: "ISRG Root X1" -# Serial: 172886928669790476064670243504169061120 -# MD5 Fingerprint: 0c:d2:f9:e0:da:17:73:e9:ed:86:4d:a5:e3:70:e7:4e -# SHA1 Fingerprint: ca:bd:2a:79:a1:07:6a:31:f2:1d:25:36:35:cb:03:9d:43:29:a5:e8 -# SHA256 Fingerprint: 96:bc:ec:06:26:49:76:f3:74:60:77:9a:cf:28:c5:a7:cf:e8:a3:c0:aa:e1:1a:8f:fc:ee:05:c0:bd:df:08:c6 -----BEGIN CERTIFICATE----- MIIFazCCA1OgAwIBAgIRAIIQz7DSQONZRGPgu2OCiwAwDQYJKoZIhvcNAQELBQAw TzELMAkGA1UEBhMCVVMxKTAnBgNVBAoTIEludGVybmV0IFNlY3VyaXR5IFJlc2Vh @@ -3650,14 +2226,6 @@ oyi3B43njTOQ5yOf+1CceWxG1bQVs5ZufpsMljq4Ui0/1lvh+wjChP4kqKOJ2qxq mRGunUHBcnWEvgJBQl9nJEiU0Zsnvgc/ubhPgXRR4Xq37Z0j4r7g1SgEEzwxA57d emyPxgcYxn/eR44/KJ4EBs+lVDR3veyJm+kXQ99b21/+jh5Xos1AnX5iItreGCc= -----END CERTIFICATE----- - -# Issuer: O=FNMT-RCM OU=AC RAIZ FNMT-RCM -# Subject: O=FNMT-RCM OU=AC RAIZ FNMT-RCM -# Label: "AC RAIZ FNMT-RCM" -# Serial: 485876308206448804701554682760554759 -# MD5 Fingerprint: e2:09:04:b4:d3:bd:d1:a0:14:fd:1a:d2:47:c4:57:1d -# SHA1 Fingerprint: ec:50:35:07:b2:15:c4:95:62:19:e2:a8:9a:5b:42:99:2c:4c:2c:20 -# SHA256 Fingerprint: eb:c5:57:0c:29:01:8c:4d:67:b1:aa:12:7b:af:12:f7:03:b4:61:1e:bc:17:b7:da:b5:57:38:94:17:9b:93:fa -----BEGIN CERTIFICATE----- MIIFgzCCA2ugAwIBAgIPXZONMGc2yAYdGsdUhGkHMA0GCSqGSIb3DQEBCwUAMDsx CzAJBgNVBAYTAkVTMREwDwYDVQQKDAhGTk1ULVJDTTEZMBcGA1UECwwQQUMgUkFJ @@ -3690,14 +2258,6 @@ fZ5nc8OaKveri6E6FO80vFIOiZiaBECEHX5FaZNXzuvO+FB8TxxuBEOb+dY7Ixjp RqEIr9baRRmW1FMdW4R58MD3R++Lj8UGrp1MYp3/RgT408m2ECVAdf4WqslKYIYv uu8wd+RU4riEmViAqhOLUTpPSPaLtrM= -----END CERTIFICATE----- - -# Issuer: CN=Amazon Root CA 1 O=Amazon -# Subject: CN=Amazon Root CA 1 O=Amazon -# Label: "Amazon Root CA 1" -# Serial: 143266978916655856878034712317230054538369994 -# MD5 Fingerprint: 43:c6:bf:ae:ec:fe:ad:2f:18:c6:88:68:30:fc:c8:e6 -# SHA1 Fingerprint: 8d:a7:f9:65:ec:5e:fc:37:91:0f:1c:6e:59:fd:c1:cc:6a:6e:de:16 -# SHA256 Fingerprint: 8e:cd:e6:88:4f:3d:87:b1:12:5b:a3:1a:c3:fc:b1:3d:70:16:de:7f:57:cc:90:4f:e1:cb:97:c6:ae:98:19:6e -----BEGIN CERTIFICATE----- MIIDQTCCAimgAwIBAgITBmyfz5m/jAo54vB4ikPmljZbyjANBgkqhkiG9w0BAQsF ADA5MQswCQYDVQQGEwJVUzEPMA0GA1UEChMGQW1hem9uMRkwFwYDVQQDExBBbWF6 @@ -3718,14 +2278,6 @@ o/ufQJVtMVT8QtPHRh8jrdkPSHCa2XV4cdFyQzR1bldZwgJcJmApzyMZFo6IQ6XU 5MsI+yMRQ+hDKXJioaldXgjUkK642M4UwtBV8ob2xJNDd2ZhwLnoQdeXeGADbkpy rqXRfboQnoZsG4q5WTP468SQvvG5 -----END CERTIFICATE----- - -# Issuer: CN=Amazon Root CA 2 O=Amazon -# Subject: CN=Amazon Root CA 2 O=Amazon -# Label: "Amazon Root CA 2" -# Serial: 143266982885963551818349160658925006970653239 -# MD5 Fingerprint: c8:e5:8d:ce:a8:42:e2:7a:c0:2a:5c:7c:9e:26:bf:66 -# SHA1 Fingerprint: 5a:8c:ef:45:d7:a6:98:59:76:7a:8c:8b:44:96:b5:78:cf:47:4b:1a -# SHA256 Fingerprint: 1b:a5:b2:aa:8c:65:40:1a:82:96:01:18:f8:0b:ec:4f:62:30:4d:83:ce:c4:71:3a:19:c3:9c:01:1e:a4:6d:b4 -----BEGIN CERTIFICATE----- MIIFQTCCAymgAwIBAgITBmyf0pY1hp8KD+WGePhbJruKNzANBgkqhkiG9w0BAQwF ADA5MQswCQYDVQQGEwJVUzEPMA0GA1UEChMGQW1hem9uMRkwFwYDVQQDExBBbWF6 @@ -3757,14 +2309,6 @@ n749sSmvZ6ES8lgQGVMDMBu4Gon2nL2XA46jCfMdiyHxtN/kHNGfZQIG6lzWE7OE 9jVlpNMKVv/1F2Rs76giJUmTtt8AF9pYfl3uxRuw0dFfIRDH+fO6AgonB8Xx1sfT 4PsJYGw= -----END CERTIFICATE----- - -# Issuer: CN=Amazon Root CA 3 O=Amazon -# Subject: CN=Amazon Root CA 3 O=Amazon -# Label: "Amazon Root CA 3" -# Serial: 143266986699090766294700635381230934788665930 -# MD5 Fingerprint: a0:d4:ef:0b:f7:b5:d8:49:95:2a:ec:f5:c4:fc:81:87 -# SHA1 Fingerprint: 0d:44:dd:8c:3c:8c:1a:1a:58:75:64:81:e9:0f:2e:2a:ff:b3:d2:6e -# SHA256 Fingerprint: 18:ce:6c:fe:7b:f1:4e:60:b2:e3:47:b8:df:e8:68:cb:31:d0:2e:bb:3a:da:27:15:69:f5:03:43:b4:6d:b3:a4 -----BEGIN CERTIFICATE----- MIIBtjCCAVugAwIBAgITBmyf1XSXNmY/Owua2eiedgPySjAKBggqhkjOPQQDAjA5 MQswCQYDVQQGEwJVUzEPMA0GA1UEChMGQW1hem9uMRkwFwYDVQQDExBBbWF6b24g @@ -3777,14 +2321,6 @@ ttvXBp43rDCGB5Fwx5zEGbF4wDAKBggqhkjOPQQDAgNJADBGAiEA4IWSoxe3jfkr BqWTrBqYaGFy+uGh0PsceGCmQ5nFuMQCIQCcAu/xlJyzlvnrxir4tiz+OpAUFteM YyRIHN8wfdVoOw== -----END CERTIFICATE----- - -# Issuer: CN=Amazon Root CA 4 O=Amazon -# Subject: CN=Amazon Root CA 4 O=Amazon -# Label: "Amazon Root CA 4" -# Serial: 143266989758080763974105200630763877849284878 -# MD5 Fingerprint: 89:bc:27:d5:eb:17:8d:06:6a:69:d5:fd:89:47:b4:cd -# SHA1 Fingerprint: f6:10:84:07:d6:f8:bb:67:98:0c:c2:e2:44:c2:eb:ae:1c:ef:63:be -# SHA256 Fingerprint: e3:5d:28:41:9e:d0:20:25:cf:a6:90:38:cd:62:39:62:45:8d:a5:c6:95:fb:de:a3:c2:2b:0b:fb:25:89:70:92 -----BEGIN CERTIFICATE----- MIIB8jCCAXigAwIBAgITBmyf18G7EEwpQ+Vxe3ssyBrBDjAKBggqhkjOPQQDAzA5 MQswCQYDVQQGEwJVUzEPMA0GA1UEChMGQW1hem9uMRkwFwYDVQQDExBBbWF6b24g @@ -3798,55 +2334,6 @@ MAoGCCqGSM49BAMDA2gAMGUCMDqLIfG9fhGt0O9Yli/W651+kI0rz2ZVwyzjKKlw CkcO8DdZEv8tmZQoTipPNU0zWgIxAOp1AE47xDqUEpHJWEadIRNyp4iciuRMStuW 1KyLa2tJElMzrdfkviT8tQp21KW8EA== -----END CERTIFICATE----- - -# Issuer: CN=LuxTrust Global Root 2 O=LuxTrust S.A. -# Subject: CN=LuxTrust Global Root 2 O=LuxTrust S.A. -# Label: "LuxTrust Global Root 2" -# Serial: 59914338225734147123941058376788110305822489521 -# MD5 Fingerprint: b2:e1:09:00:61:af:f7:f1:91:6f:c4:ad:8d:5e:3b:7c -# SHA1 Fingerprint: 1e:0e:56:19:0a:d1:8b:25:98:b2:04:44:ff:66:8a:04:17:99:5f:3f -# SHA256 Fingerprint: 54:45:5f:71:29:c2:0b:14:47:c4:18:f9:97:16:8f:24:c5:8f:c5:02:3b:f5:da:5b:e2:eb:6e:1d:d8:90:2e:d5 ------BEGIN CERTIFICATE----- -MIIFwzCCA6ugAwIBAgIUCn6m30tEntpqJIWe5rgV0xZ/u7EwDQYJKoZIhvcNAQEL -BQAwRjELMAkGA1UEBhMCTFUxFjAUBgNVBAoMDUx1eFRydXN0IFMuQS4xHzAdBgNV -BAMMFkx1eFRydXN0IEdsb2JhbCBSb290IDIwHhcNMTUwMzA1MTMyMTU3WhcNMzUw -MzA1MTMyMTU3WjBGMQswCQYDVQQGEwJMVTEWMBQGA1UECgwNTHV4VHJ1c3QgUy5B -LjEfMB0GA1UEAwwWTHV4VHJ1c3QgR2xvYmFsIFJvb3QgMjCCAiIwDQYJKoZIhvcN -AQEBBQADggIPADCCAgoCggIBANeFl78RmOnwYoNMPIf5U2o3C/IPPIfOb9wmKb3F -ibrJgz337spbxm1Jc7TJRqMbNBM/wYlFV/TZsfs2ZUv7COJIcRHIbjuend+JZTem -hfY7RBi2xjcwYkSSl2l9QjAk5A0MiWtj3sXh306pFGxT4GHO9hcvHTy95iJMHZP1 -EMShduxq3sVs35a0VkBCwGKSMKEtFZSg0iAGCW5qbeXrt77U8PEVfIvmTroTzEsn -Xpk8F12PgX8zPU/TPxvsXD/wPEx1bvKm1Z3aLQdjAsZy6ZS8TEmVT4hSyNvoaYL4 -zDRbIvCGp4m9SAptZoFtyMhk+wHh9OHe2Z7d21vUKpkmFRseTJIpgp7VkoGSQXAZ -96Tlk0u8d2cx3Rz9MXANF5kM+Qw5GSoXtTBxVdUPrljhPS80m8+f9niFwpN6cj5m -j5wWEWCPnolvZ77gR1o7DJpni89Gxq44o/KnvObWhWszJHAiS8sIm7vI+AIpHb4g -DEa/a4ebsypmQjVGbKq6rfmYe+lQVRQxv7HaLe2ArWgk+2mr2HETMOZns4dA/Yl+ -8kPREd8vZS9kzl8UubG/Mb2HeFpZZYiq/FkySIbWTLkpS5XTdvN3JW1CHDiDTf2j -X5t/Lax5Gw5CMZdjpPuKadUiDTSQMC6otOBttpSsvItO13D8xTiOZCXhTTmQzsmH -hFhxAgMBAAGjgagwgaUwDwYDVR0TAQH/BAUwAwEB/zBCBgNVHSAEOzA5MDcGByuB -KwEBAQowLDAqBggrBgEFBQcCARYeaHR0cHM6Ly9yZXBvc2l0b3J5Lmx1eHRydXN0 -Lmx1MA4GA1UdDwEB/wQEAwIBBjAfBgNVHSMEGDAWgBT/GCh2+UgFLKGu8SsbK7JT -+Et8szAdBgNVHQ4EFgQU/xgodvlIBSyhrvErGyuyU/hLfLMwDQYJKoZIhvcNAQEL -BQADggIBAGoZFO1uecEsh9QNcH7X9njJCwROxLHOk3D+sFTAMs2ZMGQXvw/l4jP9 -BzZAcg4atmpZ1gDlaCDdLnINH2pkMSCEfUmmWjfrRcmF9dTHF5kH5ptV5AzoqbTO -jFu1EVzPig4N1qx3gf4ynCSecs5U89BvolbW7MM3LGVYvlcAGvI1+ut7MV3CwRI9 -loGIlonBWVx65n9wNOeD4rHh4bhY79SV5GCc8JaXcozrhAIuZY+kt9J/Z93I055c -qqmkoCUUBpvsT34tC38ddfEz2O3OuHVtPlu5mB0xDVbYQw8wkbIEa91WvpWAVWe+ -2M2D2RjuLg+GLZKecBPs3lHJQ3gCpU3I+V/EkVhGFndadKpAvAefMLmx9xIX3eP/ -JEAdemrRTxgKqpAd60Ae36EeRJIQmvKN4dFLRp7oRUKX6kWZ8+xm1QL68qZKJKre -zrnK+T+Tb/mjuuqlPpmt/f97mfVl7vBZKGfXkJWkE4SphMHozs51k2MavDzq1WQf -LSoSOcbDWjLtR5EWDrw4wVDej8oqkDQc7kGUnF4ZLvhFSZl0kbAEb+MEWrGrKqv+ -x9CWttrhSmQGbmBNvUJO/3jaJMobtNeWOWyu8Q6qp31IiyBMz2TWuJdGsE7RKlY6 -oJO9r4Ak4Ap+58rVyuiFVdw2KuGUaJPHZnJED4AhMmwlxyOAgwrr ------END CERTIFICATE----- - -# Issuer: CN=TUBITAK Kamu SM SSL Kok Sertifikasi - Surum 1 O=Turkiye Bilimsel ve Teknolojik Arastirma Kurumu - TUBITAK OU=Kamu Sertifikasyon Merkezi - Kamu SM -# Subject: CN=TUBITAK Kamu SM SSL Kok Sertifikasi - Surum 1 O=Turkiye Bilimsel ve Teknolojik Arastirma Kurumu - TUBITAK OU=Kamu Sertifikasyon Merkezi - Kamu SM -# Label: "TUBITAK Kamu SM SSL Kok Sertifikasi - Surum 1" -# Serial: 1 -# MD5 Fingerprint: dc:00:81:dc:69:2f:3e:2f:b0:3b:f6:3d:5a:91:8e:49 -# SHA1 Fingerprint: 31:43:64:9b:ec:ce:27:ec:ed:3a:3f:0b:8f:0d:e4:e8:91:dd:ee:ca -# SHA256 Fingerprint: 46:ed:c3:68:90:46:d5:3a:45:3f:b3:10:4a:b8:0d:ca:ec:65:8b:26:60:ea:16:29:dd:7e:86:79:90:64:87:16 -----BEGIN CERTIFICATE----- MIIEYzCCA0ugAwIBAgIBATANBgkqhkiG9w0BAQsFADCB0jELMAkGA1UEBhMCVFIx GDAWBgNVBAcTD0dlYnplIC0gS29jYWVsaTFCMEAGA1UEChM5VHVya2l5ZSBCaWxp @@ -3873,14 +2360,6 @@ lzwDGrpDxpa5RXI4s6ehlj2Re37AIVNMh+3yC1SVUZPVIqUNivGTDj5UDrDYyU7c 8jEyVupk+eq1nRZmQnLzf9OxMUP8pI4X8W0jq5Rm+K37DwhuJi1/FwcJsoz7UMCf lo3Ptv0AnVoUmr8CRPXBwp8iXqIPoeM= -----END CERTIFICATE----- - -# Issuer: CN=GDCA TrustAUTH R5 ROOT O=GUANG DONG CERTIFICATE AUTHORITY CO.,LTD. -# Subject: CN=GDCA TrustAUTH R5 ROOT O=GUANG DONG CERTIFICATE AUTHORITY CO.,LTD. -# Label: "GDCA TrustAUTH R5 ROOT" -# Serial: 9009899650740120186 -# MD5 Fingerprint: 63:cc:d9:3d:34:35:5c:6f:53:a3:e2:08:70:48:1f:b4 -# SHA1 Fingerprint: 0f:36:38:5b:81:1a:25:c3:9b:31:4e:83:ca:e9:34:66:70:cc:74:b4 -# SHA256 Fingerprint: bf:ff:8f:d0:44:33:48:7d:6a:8a:a6:0c:1a:29:76:7a:9f:c2:bb:b0:5e:42:0f:71:3a:13:b9:92:89:1d:38:93 -----BEGIN CERTIFICATE----- MIIFiDCCA3CgAwIBAgIIfQmX/vBH6nowDQYJKoZIhvcNAQELBQAwYjELMAkGA1UE BhMCQ04xMjAwBgNVBAoMKUdVQU5HIERPTkcgQ0VSVElGSUNBVEUgQVVUSE9SSVRZ @@ -3913,14 +2392,6 @@ XR4EzzffHqhmsYzmIGrv/EhOdJhCrylvLmrH+33RZjEizIYAfmaDDEL0vTSSwxrq T8p+ck0LcIymSLumoRT2+1hEmRSuqguTaaApJUqlyyvdimYHFngVV3Eb7PVHhPOe MTd61X8kreS8/f3MboPoDKi3QWwH3b08hpcv0g== -----END CERTIFICATE----- - -# Issuer: CN=TrustCor RootCert CA-1 O=TrustCor Systems S. de R.L. OU=TrustCor Certificate Authority -# Subject: CN=TrustCor RootCert CA-1 O=TrustCor Systems S. de R.L. OU=TrustCor Certificate Authority -# Label: "TrustCor RootCert CA-1" -# Serial: 15752444095811006489 -# MD5 Fingerprint: 6e:85:f1:dc:1a:00:d3:22:d5:b2:b2:ac:6b:37:05:45 -# SHA1 Fingerprint: ff:bd:cd:e7:82:c8:43:5e:3c:6f:26:86:5c:ca:a8:3a:45:5b:c3:0a -# SHA256 Fingerprint: d4:0e:9c:86:cd:8f:e4:68:c1:77:69:59:f4:9e:a7:74:fa:54:86:84:b6:c4:06:f3:90:92:61:f4:dc:e2:57:5c -----BEGIN CERTIFICATE----- MIIEMDCCAxigAwIBAgIJANqb7HHzA7AZMA0GCSqGSIb3DQEBCwUAMIGkMQswCQYD VQQGEwJQQTEPMA0GA1UECAwGUGFuYW1hMRQwEgYDVQQHDAtQYW5hbWEgQ2l0eTEk @@ -3946,14 +2417,6 @@ yonnMlo2HD6CqFqTvsbQZJG2z9m2GM/bftJlo6bEjhcxwft+dtvTheNYsnd6djts L1Ac59v2Z3kf9YKVmgenFK+P3CghZwnS1k1aHBkcjndcw5QkPTJrS37UeJSDvjdN zl/HHk484IkzlQsPpTLWPFp5LBk= -----END CERTIFICATE----- - -# Issuer: CN=TrustCor RootCert CA-2 O=TrustCor Systems S. de R.L. OU=TrustCor Certificate Authority -# Subject: CN=TrustCor RootCert CA-2 O=TrustCor Systems S. de R.L. OU=TrustCor Certificate Authority -# Label: "TrustCor RootCert CA-2" -# Serial: 2711694510199101698 -# MD5 Fingerprint: a2:e1:f8:18:0b:ba:45:d5:c7:41:2a:bb:37:52:45:64 -# SHA1 Fingerprint: b8:be:6d:cb:56:f1:55:b9:63:d4:12:ca:4e:06:34:c7:94:b2:1c:c0 -# SHA256 Fingerprint: 07:53:e9:40:37:8c:1b:d5:e3:83:6e:39:5d:ae:a5:cb:83:9e:50:46:f1:bd:0e:ae:19:51:cf:10:fe:c7:c9:65 -----BEGIN CERTIFICATE----- MIIGLzCCBBegAwIBAgIIJaHfyjPLWQIwDQYJKoZIhvcNAQELBQAwgaQxCzAJBgNV BAYTAlBBMQ8wDQYDVQQIDAZQYW5hbWExFDASBgNVBAcMC1BhbmFtYSBDaXR5MSQw @@ -3990,14 +2453,6 @@ As8e5ZTZ845b2EzwnexhF7sUMlQMAimTHpKG9n/v55IFDlndmQguLvqcAFLTxWYp 5KeXRKQOKIETNcX2b2TmQcTVL8w0RSXPQQCWPUouwpaYT05KnJe32x+SMsj/D1Fu 1uwJ -----END CERTIFICATE----- - -# Issuer: CN=TrustCor ECA-1 O=TrustCor Systems S. de R.L. OU=TrustCor Certificate Authority -# Subject: CN=TrustCor ECA-1 O=TrustCor Systems S. de R.L. OU=TrustCor Certificate Authority -# Label: "TrustCor ECA-1" -# Serial: 9548242946988625984 -# MD5 Fingerprint: 27:92:23:1d:0a:f5:40:7c:e9:e6:6b:9d:d8:f5:e7:6c -# SHA1 Fingerprint: 58:d1:df:95:95:67:6b:63:c0:f0:5b:1c:17:4d:8b:84:0b:c8:78:bd -# SHA256 Fingerprint: 5a:88:5d:b1:9c:01:d9:12:c5:75:93:88:93:8c:af:bb:df:03:1a:b2:d4:8e:91:ee:15:58:9b:42:97:1d:03:9c -----BEGIN CERTIFICATE----- MIIEIDCCAwigAwIBAgIJAISCLF8cYtBAMA0GCSqGSIb3DQEBCwUAMIGcMQswCQYD VQQGEwJQQTEPMA0GA1UECAwGUGFuYW1hMRQwEgYDVQQHDAtQYW5hbWEgQ2l0eTEk @@ -4023,14 +2478,6 @@ soIipX1TH0XsJ5F95yIW6MBoNtjG8U+ARDL54dHRHareqKucBK+tIA5kmE2la8BI WJZpTdwHjFGTot+fDz2LYLSCjaoITmJF4PkL0uDgPFveXHEnJcLmA4GLEFPjx1Wi tJ/X5g== -----END CERTIFICATE----- - -# Issuer: CN=SSL.com Root Certification Authority RSA O=SSL Corporation -# Subject: CN=SSL.com Root Certification Authority RSA O=SSL Corporation -# Label: "SSL.com Root Certification Authority RSA" -# Serial: 8875640296558310041 -# MD5 Fingerprint: 86:69:12:c0:70:f1:ec:ac:ac:c2:d5:bc:a5:5b:a1:29 -# SHA1 Fingerprint: b7:ab:33:08:d1:ea:44:77:ba:14:80:12:5a:6f:bd:a9:36:49:0c:bb -# SHA256 Fingerprint: 85:66:6a:56:2e:e0:be:5c:e9:25:c1:d8:89:0a:6f:76:a8:7e:c1:6d:4d:7d:5f:29:ea:74:19:cf:20:12:3b:69 -----BEGIN CERTIFICATE----- MIIF3TCCA8WgAwIBAgIIeyyb0xaAMpkwDQYJKoZIhvcNAQELBQAwfDELMAkGA1UE BhMCVVMxDjAMBgNVBAgMBVRleGFzMRAwDgYDVQQHDAdIb3VzdG9uMRgwFgYDVQQK @@ -4065,14 +2512,6 @@ nLwsoFvVagCvXzfh1foQC5ichucmj87w7G6KVwuA406ywKBjYZC6VWg3dGq2ktuf oYYitmUnDuy2n0Jg5GfCtdpBC8TTi2EbvPofkSvXRAdeuims2cXp71NIWuuA8ShY Ic2wBlX7Jz9TkHCpBB5XJ7k= -----END CERTIFICATE----- - -# Issuer: CN=SSL.com Root Certification Authority ECC O=SSL Corporation -# Subject: CN=SSL.com Root Certification Authority ECC O=SSL Corporation -# Label: "SSL.com Root Certification Authority ECC" -# Serial: 8495723813297216424 -# MD5 Fingerprint: 2e:da:e4:39:7f:9c:8f:37:d1:70:9f:26:17:51:3a:8e -# SHA1 Fingerprint: c3:19:7c:39:24:e6:54:af:1b:c4:ab:20:95:7a:e2:c3:0e:13:02:6a -# SHA256 Fingerprint: 34:17:bb:06:cc:60:07:da:1b:96:1c:92:0b:8a:b4:ce:3f:ad:82:0e:4a:a3:0b:9a:cb:c4:a7:4e:bd:ce:bc:65 -----BEGIN CERTIFICATE----- MIICjTCCAhSgAwIBAgIIdebfy8FoW6gwCgYIKoZIzj0EAwIwfDELMAkGA1UEBhMC VVMxDjAMBgNVBAgMBVRleGFzMRAwDgYDVQQHDAdIb3VzdG9uMRgwFgYDVQQKDA9T @@ -4089,14 +2528,6 @@ VR0PAQH/BAQDAgGGMAoGCCqGSM49BAMCA2cAMGQCMG/n61kRpGDPYbCWe+0F+S8T kdzt5fxQaxFGRrMcIQBiu77D5+jNB5n5DQtdcj7EqgIwH7y6C+IwJPt8bYBVCpk+ gA0z5Wajs6O7pdWLjwkspl1+4vAHCGht0nxpbl/f5Wpl -----END CERTIFICATE----- - -# Issuer: CN=SSL.com EV Root Certification Authority RSA R2 O=SSL Corporation -# Subject: CN=SSL.com EV Root Certification Authority RSA R2 O=SSL Corporation -# Label: "SSL.com EV Root Certification Authority RSA R2" -# Serial: 6248227494352943350 -# MD5 Fingerprint: e1:1e:31:58:1a:ae:54:53:02:f6:17:6a:11:7b:4d:95 -# SHA1 Fingerprint: 74:3a:f0:52:9b:d0:32:a0:f4:4a:83:cd:d4:ba:a9:7b:7c:2e:c4:9a -# SHA256 Fingerprint: 2e:7b:f1:6c:c2:24:85:a7:bb:e2:aa:86:96:75:07:61:b0:ae:39:be:3b:2f:e9:d0:cc:6d:4e:f7:34:91:42:5c -----BEGIN CERTIFICATE----- MIIF6zCCA9OgAwIBAgIIVrYpzTS8ePYwDQYJKoZIhvcNAQELBQAwgYIxCzAJBgNV BAYTAlVTMQ4wDAYDVQQIDAVUZXhhczEQMA4GA1UEBwwHSG91c3RvbjEYMBYGA1UE @@ -4131,14 +2562,6 @@ w/cFGsDWr3RiSBd3kmmQYRzelYB0VI8YHMPzA9C/pEN1hlMYegouCRw2n5H9gooi S9EOUCXdywMMF8mDAAhONU2Ki+3wApRmLER/y5UnlhetCTCstnEXbosX9hwJ1C07 mKVx01QT2WDz9UtmT/rx7iASjbSsV7FFY6GsdqnC+w== -----END CERTIFICATE----- - -# Issuer: CN=SSL.com EV Root Certification Authority ECC O=SSL Corporation -# Subject: CN=SSL.com EV Root Certification Authority ECC O=SSL Corporation -# Label: "SSL.com EV Root Certification Authority ECC" -# Serial: 3182246526754555285 -# MD5 Fingerprint: 59:53:22:65:83:42:01:54:c0:ce:42:b9:5a:7c:f2:90 -# SHA1 Fingerprint: 4c:dd:51:a3:d1:f5:20:32:14:b0:c6:c5:32:23:03:91:c7:46:42:6d -# SHA256 Fingerprint: 22:a2:c1:f7:bd:ed:70:4c:c1:e7:01:b5:f4:08:c3:10:88:0f:e9:56:b5:de:2a:4a:44:f9:9c:87:3a:25:a7:c8 -----BEGIN CERTIFICATE----- MIIClDCCAhqgAwIBAgIILCmcWxbtBZUwCgYIKoZIzj0EAwIwfzELMAkGA1UEBhMC VVMxDjAMBgNVBAgMBVRleGFzMRAwDgYDVQQHDAdIb3VzdG9uMRgwFgYDVQQKDA9T @@ -4155,14 +2578,6 @@ MA8GA1UdEwEB/wQFMAMBAf8wHwYDVR0jBBgwFoAUW8pe5d7SgarNqC1kUbbZcpuX ytRrJPOwPYdGWBrssd9v+1a6cGvHOMzosYxPD/fxZ3YOg9AeUY8CMD32IygmTMZg h5Mmm7I1HrrW9zzRHM76JTymGoEVW/MSD2zuZYrJh6j5B+BimoxcSg== -----END CERTIFICATE----- - -# Issuer: CN=GlobalSign O=GlobalSign OU=GlobalSign Root CA - R6 -# Subject: CN=GlobalSign O=GlobalSign OU=GlobalSign Root CA - R6 -# Label: "GlobalSign Root CA - R6" -# Serial: 1417766617973444989252670301619537 -# MD5 Fingerprint: 4f:dd:07:e4:d4:22:64:39:1e:0c:37:42:ea:d1:c6:ae -# SHA1 Fingerprint: 80:94:64:0e:b5:a7:a1:ca:11:9c:1f:dd:d5:9f:81:02:63:a7:fb:d1 -# SHA256 Fingerprint: 2c:ab:ea:fe:37:d0:6c:a2:2a:ba:73:91:c0:03:3d:25:98:29:52:c4:53:64:73:49:76:3a:3a:b5:ad:6c:cf:69 -----BEGIN CERTIFICATE----- MIIFgzCCA2ugAwIBAgIORea7A4Mzw4VlSOb/RVEwDQYJKoZIhvcNAQEMBQAwTDEg MB4GA1UECxMXR2xvYmFsU2lnbiBSb290IENBIC0gUjYxEzARBgNVBAoTCkdsb2Jh @@ -4195,14 +2610,6 @@ JJUEeKgDu+6B5dpffItKoZB0JaezPkvILFa9x8jvOOJckvB595yEunQtYQEgfn7R 8k8HWV+LLUNS60YMlOH1Zkd5d9VUWx+tJDfLRVpOoERIyNiwmcUVhAn21klJwGW4 5hpxbqCo8YLoRT5s1gLXCmeDBVrJpBA= -----END CERTIFICATE----- - -# Issuer: CN=OISTE WISeKey Global Root GC CA O=WISeKey OU=OISTE Foundation Endorsed -# Subject: CN=OISTE WISeKey Global Root GC CA O=WISeKey OU=OISTE Foundation Endorsed -# Label: "OISTE WISeKey Global Root GC CA" -# Serial: 44084345621038548146064804565436152554 -# MD5 Fingerprint: a9:d6:b9:2d:2f:93:64:f8:a5:69:ca:91:e9:68:07:23 -# SHA1 Fingerprint: e0:11:84:5e:34:de:be:88:81:b9:9c:f6:16:26:d1:96:1f:c3:b9:31 -# SHA256 Fingerprint: 85:60:f9:1c:36:24:da:ba:95:70:b5:fe:a0:db:e3:6f:f1:1a:83:23:be:94:86:85:4f:b3:f3:4a:55:71:19:8d -----BEGIN CERTIFICATE----- MIICaTCCAe+gAwIBAgIQISpWDK7aDKtARb8roi066jAKBggqhkjOPQQDAzBtMQsw CQYDVQQGEwJDSDEQMA4GA1UEChMHV0lTZUtleTEiMCAGA1UECxMZT0lTVEUgRm91 @@ -4218,14 +2625,6 @@ rYy0UGYwEAYJKwYBBAGCNxUBBAMCAQAwCgYIKoZIzj0EAwMDaAAwZQIwJsdpW9zV 57LnyAyMjMPdeYwbY9XJUpROTYJKcx6ygISpJcBMWm1JKWB4E+J+SOtkAjEA2zQg Mgj/mkkCtojeFK9dbJlxjRo/i9fgojaGHAeCOnZT/cKi7e97sIBPWA9LUzm9 -----END CERTIFICATE----- - -# Issuer: CN=GTS Root R1 O=Google Trust Services LLC -# Subject: CN=GTS Root R1 O=Google Trust Services LLC -# Label: "GTS Root R1" -# Serial: 146587175971765017618439757810265552097 -# MD5 Fingerprint: 82:1a:ef:d4:d2:4a:f2:9f:e2:3d:97:06:14:70:72:85 -# SHA1 Fingerprint: e1:c9:50:e6:ef:22:f8:4c:56:45:72:8b:92:20:60:d7:d5:a7:a3:e8 -# SHA256 Fingerprint: 2a:57:54:71:e3:13:40:bc:21:58:1c:bd:2c:f1:3e:15:84:63:20:3e:ce:94:bc:f9:d3:cc:19:6b:f0:9a:54:72 -----BEGIN CERTIFICATE----- MIIFWjCCA0KgAwIBAgIQbkepxUtHDA3sM9CJuRz04TANBgkqhkiG9w0BAQwFADBH MQswCQYDVQQGEwJVUzEiMCAGA1UEChMZR29vZ2xlIFRydXN0IFNlcnZpY2VzIExM @@ -4257,14 +2656,6 @@ F62ARPBopY+Udf90WuioAnwMCeKpSwughQtiue+hMZL77/ZRBIls6Kl0obsXs7X9 SQ98POyDGCBDTtWTurQ0sR8WNh8M5mQ5Fkzc4P4dyKliPUDqysU0ArSuiYgzNdws E3PYJ/HQcu51OyLemGhmW/HGY0dVHLqlCFF1pkgl -----END CERTIFICATE----- - -# Issuer: CN=GTS Root R2 O=Google Trust Services LLC -# Subject: CN=GTS Root R2 O=Google Trust Services LLC -# Label: "GTS Root R2" -# Serial: 146587176055767053814479386953112547951 -# MD5 Fingerprint: 44:ed:9a:0e:a4:09:3b:00:f2:ae:4c:a3:c6:61:b0:8b -# SHA1 Fingerprint: d2:73:96:2a:2a:5e:39:9f:73:3f:e1:c7:1e:64:3f:03:38:34:fc:4d -# SHA256 Fingerprint: c4:5d:7b:b0:8e:6d:67:e6:2e:42:35:11:0b:56:4e:5f:78:fd:92:ef:05:8c:84:0a:ea:4e:64:55:d7:58:5c:60 -----BEGIN CERTIFICATE----- MIIFWjCCA0KgAwIBAgIQbkepxlqz5yDFMJo/aFLybzANBgkqhkiG9w0BAQwFADBH MQswCQYDVQQGEwJVUzEiMCAGA1UEChMZR29vZ2xlIFRydXN0IFNlcnZpY2VzIExM @@ -4296,14 +2687,6 @@ RaIRpsyF7gpo8j5QOHokYh4XIDdtak23CZvJ/KRY9bb7nE4Yu5UC56GtmwfuNmsk izoHCBy69Y9Vmhh1fuXsgWbRIXOhNUQLgD1bnF5vKheW0YMjiGZt5obicDIvUiLn yOd/xCxgXS/Dr55FBcOEArf9LAhST4Ldo/DUhgkC -----END CERTIFICATE----- - -# Issuer: CN=GTS Root R3 O=Google Trust Services LLC -# Subject: CN=GTS Root R3 O=Google Trust Services LLC -# Label: "GTS Root R3" -# Serial: 146587176140553309517047991083707763997 -# MD5 Fingerprint: 1a:79:5b:6b:04:52:9c:5d:c7:74:33:1b:25:9a:f9:25 -# SHA1 Fingerprint: 30:d4:24:6f:07:ff:db:91:89:8a:0b:e9:49:66:11:eb:8c:5e:46:e5 -# SHA256 Fingerprint: 15:d5:b8:77:46:19:ea:7d:54:ce:1c:a6:d0:b0:c4:03:e0:37:a9:17:f1:31:e8:a0:4e:1e:6b:7a:71:ba:bc:e5 -----BEGIN CERTIFICATE----- MIICDDCCAZGgAwIBAgIQbkepx2ypcyRAiQ8DVd2NHTAKBggqhkjOPQQDAzBHMQsw CQYDVQQGEwJVUzEiMCAGA1UEChMZR29vZ2xlIFRydXN0IFNlcnZpY2VzIExMQzEU @@ -4317,14 +2700,6 @@ DgQWBBTB8Sa6oC2uhYHP0/EqEr24Cmf9vDAKBggqhkjOPQQDAwNpADBmAjEAgFuk fCPAlaUs3L6JbyO5o91lAFJekazInXJ0glMLfalAvWhgxeG4VDvBNhcl2MG9AjEA njWSdIUlUfUk7GRSJFClH9voy8l27OyCbvWFGFPouOOaKaqW04MjyaR7YbPMAuhd -----END CERTIFICATE----- - -# Issuer: CN=GTS Root R4 O=Google Trust Services LLC -# Subject: CN=GTS Root R4 O=Google Trust Services LLC -# Label: "GTS Root R4" -# Serial: 146587176229350439916519468929765261721 -# MD5 Fingerprint: 5d:b6:6a:c4:60:17:24:6a:1a:99:a8:4b:ee:5e:b4:26 -# SHA1 Fingerprint: 2a:1d:60:27:d9:4a:b1:0a:1c:4d:91:5c:cd:33:a0:cb:3e:2d:54:cb -# SHA256 Fingerprint: 71:cc:a5:39:1f:9e:79:4b:04:80:25:30:b3:63:e1:21:da:8a:30:43:bb:26:66:2f:ea:4d:ca:7f:c9:51:a4:bd -----BEGIN CERTIFICATE----- MIICCjCCAZGgAwIBAgIQbkepyIuUtui7OyrYorLBmTAKBggqhkjOPQQDAzBHMQsw CQYDVQQGEwJVUzEiMCAGA1UEChMZR29vZ2xlIFRydXN0IFNlcnZpY2VzIExMQzEU @@ -4338,14 +2713,6 @@ DgQWBBSATNbrdP9JNqPV2Py1PsVq8JQdjDAKBggqhkjOPQQDAwNnADBkAjBqUFJ0 CMRw3J5QdCHojXohw0+WbhXRIjVhLfoIN+4Zba3bssx9BzT1YBkstTTZbyACMANx sbqjYAuG7ZoIapVon+Kz4ZNkfF6Tpt95LY2F45TPI11xzPKwTdb+mciUqXWi4w== -----END CERTIFICATE----- - -# Issuer: CN=UCA Global G2 Root O=UniTrust -# Subject: CN=UCA Global G2 Root O=UniTrust -# Label: "UCA Global G2 Root" -# Serial: 124779693093741543919145257850076631279 -# MD5 Fingerprint: 80:fe:f0:c4:4a:f0:5c:62:32:9f:1c:ba:78:a9:50:f8 -# SHA1 Fingerprint: 28:f9:78:16:19:7a:ff:18:25:18:aa:44:fe:c1:a0:ce:5c:b6:4c:8a -# SHA256 Fingerprint: 9b:ea:11:c9:76:fe:01:47:64:c1:be:56:a6:f9:14:b5:a5:60:31:7a:bd:99:88:39:33:82:e5:16:1a:a0:49:3c -----BEGIN CERTIFICATE----- MIIFRjCCAy6gAwIBAgIQXd+x2lqj7V2+WmUgZQOQ7zANBgkqhkiG9w0BAQsFADA9 MQswCQYDVQQGEwJDTjERMA8GA1UECgwIVW5pVHJ1c3QxGzAZBgNVBAMMElVDQSBH @@ -4377,14 +2744,6 @@ DMUIYs6Ao9Dz7GjevjPHF1t/gMRMTLGmhIrDO7gJzRSBuhjjVFc2/tsvfEehOjPI YiGqhkCyLmTTX8jjfhFnRR8F/uOi77Oos/N9j/gMHyIfLXC0uAE0djAA5SN4p1bX UB+K+wb1whnw0A== -----END CERTIFICATE----- - -# Issuer: CN=UCA Extended Validation Root O=UniTrust -# Subject: CN=UCA Extended Validation Root O=UniTrust -# Label: "UCA Extended Validation Root" -# Serial: 106100277556486529736699587978573607008 -# MD5 Fingerprint: a1:f3:5f:43:c6:34:9b:da:bf:8c:7e:05:53:ad:96:e2 -# SHA1 Fingerprint: a3:a1:b0:6f:24:61:23:4a:e3:36:a5:c2:37:fc:a6:ff:dd:f0:d7:3a -# SHA256 Fingerprint: d4:3a:f9:b3:54:73:75:5c:96:84:fc:06:d7:d8:cb:70:ee:5c:28:e7:73:fb:29:4e:b4:1e:e7:17:22:92:4d:24 -----BEGIN CERTIFICATE----- MIIFWjCCA0KgAwIBAgIQT9Irj/VkyDOeTzRYZiNwYDANBgkqhkiG9w0BAQsFADBH MQswCQYDVQQGEwJDTjERMA8GA1UECgwIVW5pVHJ1c3QxJTAjBgNVBAMMHFVDQSBF @@ -4416,14 +2775,6 @@ xR9GUeOcGMyNm43sSet1UNWMKFnKdDTajAshqx7qG+XH/RU+wBeq+yNuJkbL+vmx cmtpzyKEC2IPrNkZAJSidjzULZrtBJ4tBmIQN1IchXIbJ+XMxjHsN+xjWZsLHXbM fjKaiJUINlK73nZfdklJrX+9ZSCyycErdhh2n1ax -----END CERTIFICATE----- - -# Issuer: CN=Certigna Root CA O=Dhimyotis OU=0002 48146308100036 -# Subject: CN=Certigna Root CA O=Dhimyotis OU=0002 48146308100036 -# Label: "Certigna Root CA" -# Serial: 269714418870597844693661054334862075617 -# MD5 Fingerprint: 0e:5c:30:62:27:eb:5b:bc:d7:ae:62:ba:e9:d5:df:77 -# SHA1 Fingerprint: 2d:0d:52:14:ff:9e:ad:99:24:01:74:20:47:6e:6c:85:27:27:f5:43 -# SHA256 Fingerprint: d4:8d:3d:23:ee:db:50:a4:59:e5:51:97:60:1c:27:77:4b:9d:7b:18:c9:4d:5a:05:95:11:a1:02:50:b9:31:68 -----BEGIN CERTIFICATE----- MIIGWzCCBEOgAwIBAgIRAMrpG4nxVQMNo+ZBbcTjpuEwDQYJKoZIhvcNAQELBQAw WjELMAkGA1UEBhMCRlIxEjAQBgNVBAoMCURoaW15b3RpczEcMBoGA1UECwwTMDAw @@ -4460,14 +2811,6 @@ Nwf9JtmYhST/WSMDmu2dnajkXjjO11INb9I/bbEFa0nOipFGc/T2L/Coc3cOZayh jWZSaX5LaAzHHjcng6WMxwLkFM1JAbBzs/3GkDpv0mztO+7skb6iQ12LAEpmJURw 3kAP+HwV96LOPNdeE4yBFxgX0b3xdxA61GU5wSesVywlVP+i2k+KYTlerj1KjL0= -----END CERTIFICATE----- - -# Issuer: CN=emSign Root CA - G1 O=eMudhra Technologies Limited OU=emSign PKI -# Subject: CN=emSign Root CA - G1 O=eMudhra Technologies Limited OU=emSign PKI -# Label: "emSign Root CA - G1" -# Serial: 235931866688319308814040 -# MD5 Fingerprint: 9c:42:84:57:dd:cb:0b:a7:2e:95:ad:b6:f3:da:bc:ac -# SHA1 Fingerprint: 8a:c7:ad:8f:73:ac:4e:c1:b5:75:4d:a5:40:f4:fc:cf:7c:b5:8e:8c -# SHA256 Fingerprint: 40:f6:af:03:46:a9:9a:a1:cd:1d:55:5a:4e:9c:ce:62:c7:f9:63:46:03:ee:40:66:15:83:3d:c8:c8:d0:03:67 -----BEGIN CERTIFICATE----- MIIDlDCCAnygAwIBAgIKMfXkYgxsWO3W2DANBgkqhkiG9w0BAQsFADBnMQswCQYD VQQGEwJJTjETMBEGA1UECxMKZW1TaWduIFBLSTElMCMGA1UEChMcZU11ZGhyYSBU @@ -4490,14 +2833,6 @@ GNYIAwlG7mDgfrbESQRRfXBgvKqy/3lyeqYdPV8q+Mri/Tm3R7nrft8EI6/6nAYH RQuQ+q7hv53yrlc8pa6yVvSLZUDp/TGBLPQ5Cdjua6e0ph0VpZj3AYHYhX3zUVxx iN66zB+Afko= -----END CERTIFICATE----- - -# Issuer: CN=emSign ECC Root CA - G3 O=eMudhra Technologies Limited OU=emSign PKI -# Subject: CN=emSign ECC Root CA - G3 O=eMudhra Technologies Limited OU=emSign PKI -# Label: "emSign ECC Root CA - G3" -# Serial: 287880440101571086945156 -# MD5 Fingerprint: ce:0b:72:d1:9f:88:8e:d0:50:03:e8:e3:b8:8b:67:40 -# SHA1 Fingerprint: 30:43:fa:4f:f2:57:dc:a0:c3:80:ee:2e:58:ea:78:b2:3f:e6:bb:c1 -# SHA256 Fingerprint: 86:a1:ec:ba:08:9c:4a:8d:3b:be:27:34:c6:12:ba:34:1d:81:3e:04:3c:f9:e8:a8:62:cd:5c:57:a3:6b:be:6b -----BEGIN CERTIFICATE----- MIICTjCCAdOgAwIBAgIKPPYHqWhwDtqLhDAKBggqhkjOPQQDAzBrMQswCQYDVQQG EwJJTjETMBEGA1UECxMKZW1TaWduIFBLSTElMCMGA1UEChMcZU11ZGhyYSBUZWNo @@ -4513,14 +2848,6 @@ hkjOPQQDAwNpADBmAjEAvvNhzwIQHWSVB7gYboiFBS+DCBeQyh+KTOgNG3qxrdWB CUfvO6wIBHxcmbHtRwfSAjEAnbpV/KlK6O3t5nYBQnvI+GDZjVGLVTv7jHvrZQnD +JbNR6iC8hZVdyR+EhCVBCyj -----END CERTIFICATE----- - -# Issuer: CN=emSign Root CA - C1 O=eMudhra Inc OU=emSign PKI -# Subject: CN=emSign Root CA - C1 O=eMudhra Inc OU=emSign PKI -# Label: "emSign Root CA - C1" -# Serial: 825510296613316004955058 -# MD5 Fingerprint: d8:e3:5d:01:21:fa:78:5a:b0:df:ba:d2:ee:2a:5f:68 -# SHA1 Fingerprint: e7:2e:f1:df:fc:b2:09:28:cf:5d:d4:d5:67:37:b1:51:cb:86:4f:01 -# SHA256 Fingerprint: 12:56:09:aa:30:1d:a0:a2:49:b9:7a:82:39:cb:6a:34:21:6f:44:dc:ac:9f:39:54:b1:42:92:f2:e8:c8:60:8f -----BEGIN CERTIFICATE----- MIIDczCCAlugAwIBAgILAK7PALrEzzL4Q7IwDQYJKoZIhvcNAQELBQAwVjELMAkG A1UEBhMCVVMxEzARBgNVBAsTCmVtU2lnbiBQS0kxFDASBgNVBAoTC2VNdWRocmEg @@ -4542,14 +2869,6 @@ YQTlSTR+08TI9Q/Aqum6VF7zYytPT1DU/rl7mYw9wC68AivTxEDkigcxHpvOJpkT +xHqmiIMERnHXhuBUDDIlhJu58tBf5E7oke3VIAb3ADMmpDqw8NQBmIMMMAVSKeo WXzhriKi4gp6D/piq1JM4fHfyr6DDUI= -----END CERTIFICATE----- - -# Issuer: CN=emSign ECC Root CA - C3 O=eMudhra Inc OU=emSign PKI -# Subject: CN=emSign ECC Root CA - C3 O=eMudhra Inc OU=emSign PKI -# Label: "emSign ECC Root CA - C3" -# Serial: 582948710642506000014504 -# MD5 Fingerprint: 3e:53:b3:a3:81:ee:d7:10:f8:d3:b0:1d:17:92:f5:d5 -# SHA1 Fingerprint: b6:af:43:c2:9b:81:53:7d:f6:ef:6b:c3:1f:1f:60:15:0c:ee:48:66 -# SHA256 Fingerprint: bc:4d:80:9b:15:18:9d:78:db:3e:1d:8c:f4:f9:72:6a:79:5d:a1:64:3c:a5:f1:35:8e:1d:db:0e:dc:0d:7e:b3 -----BEGIN CERTIFICATE----- MIICKzCCAbGgAwIBAgIKe3G2gla4EnycqDAKBggqhkjOPQQDAzBaMQswCQYDVQQG EwJVUzETMBEGA1UECxMKZW1TaWduIFBLSTEUMBIGA1UEChMLZU11ZGhyYSBJbmMx @@ -4564,14 +2883,6 @@ Af8EBTADAQH/MAoGCCqGSM49BAMDA2gAMGUCMQC02C8Cif22TGK6Q04ThHK1rt0c 3ta13FaPWEBaLd4gTCKDypOofu4SQMfWh0/434UCMBwUZOR8loMRnLDRWmFLpg9J 0wD8ofzkpf9/rdcw0Md3f76BB1UwUCAU9Vc4CqgxUQ== -----END CERTIFICATE----- - -# Issuer: CN=Hongkong Post Root CA 3 O=Hongkong Post -# Subject: CN=Hongkong Post Root CA 3 O=Hongkong Post -# Label: "Hongkong Post Root CA 3" -# Serial: 46170865288971385588281144162979347873371282084 -# MD5 Fingerprint: 11:fc:9f:bd:73:30:02:8a:fd:3f:f3:58:b9:cb:20:f0 -# SHA1 Fingerprint: 58:a2:d0:ec:20:52:81:5b:c1:f3:f8:64:02:24:4e:c2:8e:02:4b:02 -# SHA256 Fingerprint: 5a:2f:c0:3f:0c:83:b0:90:bb:fa:40:60:4b:09:88:44:6c:76:36:18:3d:f9:84:6e:17:10:1a:44:7f:b8:ef:d6 -----BEGIN CERTIFICATE----- MIIFzzCCA7egAwIBAgIUCBZfikyl7ADJk0DfxMauI7gcWqQwDQYJKoZIhvcNAQEL BQAwbzELMAkGA1UEBhMCSEsxEjAQBgNVBAgTCUhvbmcgS29uZzESMBAGA1UEBxMJ @@ -4606,14 +2917,6 @@ L5/ndtFhKvshuzHQqp9HpLIiyhY6UFfEW0NnxWViA0kB60PZ2Pierc+xYw5F9KBa LJstxabArahH9CdMOA0uG0k7UvToiIMrVCjU8jVStDKDYmlkDJGcn5fqdBb9HxEG mpv0 -----END CERTIFICATE----- - -# Issuer: CN=Entrust Root Certification Authority - G4 O=Entrust, Inc. OU=See www.entrust.net/legal-terms/(c) 2015 Entrust, Inc. - for authorized use only -# Subject: CN=Entrust Root Certification Authority - G4 O=Entrust, Inc. OU=See www.entrust.net/legal-terms/(c) 2015 Entrust, Inc. - for authorized use only -# Label: "Entrust Root Certification Authority - G4" -# Serial: 289383649854506086828220374796556676440 -# MD5 Fingerprint: 89:53:f1:83:23:b7:7c:8e:05:f1:8c:71:38:4e:1f:88 -# SHA1 Fingerprint: 14:88:4e:86:26:37:b0:26:af:59:62:5c:40:77:ec:35:29:ba:96:01 -# SHA256 Fingerprint: db:35:17:d1:f6:73:2a:2d:5a:b9:7c:53:3e:c7:07:79:ee:32:70:a6:2f:b4:ac:42:38:37:24:60:e6:f0:1e:88 -----BEGIN CERTIFICATE----- MIIGSzCCBDOgAwIBAgIRANm1Q3+vqTkPAAAAAFVlrVgwDQYJKoZIhvcNAQELBQAw gb4xCzAJBgNVBAYTAlVTMRYwFAYDVQQKEw1FbnRydXN0LCBJbmMuMSgwJgYDVQQL @@ -4650,12 +2953,265 @@ IQ6SwJAfzyBfyjs4x7dtOvPmRLgOMWuIjnDrnBdSqEGULoe256YSxXXfW8AKbnuk 5F6G+TaU33fD6Q3AOfF5u0aOq0NZJ7cguyPpVkAh7DE9ZapD8j3fcEThuk0mEDuY n/PIjhs4ViFqUZPTkcpG2om3PVODLAgfi49T3f+sHw== -----END CERTIFICATE----- +-----BEGIN CERTIFICATE----- +MIICWTCCAd+gAwIBAgIQZvI9r4fei7FK6gxXMQHC7DAKBggqhkjOPQQDAzBlMQsw +CQYDVQQGEwJVUzEeMBwGA1UEChMVTWljcm9zb2Z0IENvcnBvcmF0aW9uMTYwNAYD +VQQDEy1NaWNyb3NvZnQgRUNDIFJvb3QgQ2VydGlmaWNhdGUgQXV0aG9yaXR5IDIw +MTcwHhcNMTkxMjE4MjMwNjQ1WhcNNDIwNzE4MjMxNjA0WjBlMQswCQYDVQQGEwJV +UzEeMBwGA1UEChMVTWljcm9zb2Z0IENvcnBvcmF0aW9uMTYwNAYDVQQDEy1NaWNy +b3NvZnQgRUNDIFJvb3QgQ2VydGlmaWNhdGUgQXV0aG9yaXR5IDIwMTcwdjAQBgcq +hkjOPQIBBgUrgQQAIgNiAATUvD0CQnVBEyPNgASGAlEvaqiBYgtlzPbKnR5vSmZR +ogPZnZH6thaxjG7efM3beaYvzrvOcS/lpaso7GMEZpn4+vKTEAXhgShC48Zo9OYb +hGBKia/teQ87zvH2RPUBeMCjVDBSMA4GA1UdDwEB/wQEAwIBhjAPBgNVHRMBAf8E +BTADAQH/MB0GA1UdDgQWBBTIy5lycFIM+Oa+sgRXKSrPQhDtNTAQBgkrBgEEAYI3 +FQEEAwIBADAKBggqhkjOPQQDAwNoADBlAjBY8k3qDPlfXu5gKcs68tvWMoQZP3zV +L8KxzJOuULsJMsbG7X7JNpQS5GiFBqIb0C8CMQCZ6Ra0DvpWSNSkMBaReNtUjGUB +iudQZsIxtzm6uBoiB078a1QWIP8rtedMDE2mT3M= +-----END CERTIFICATE----- +-----BEGIN CERTIFICATE----- +MIIFqDCCA5CgAwIBAgIQHtOXCV/YtLNHcB6qvn9FszANBgkqhkiG9w0BAQwFADBl +MQswCQYDVQQGEwJVUzEeMBwGA1UEChMVTWljcm9zb2Z0IENvcnBvcmF0aW9uMTYw +NAYDVQQDEy1NaWNyb3NvZnQgUlNBIFJvb3QgQ2VydGlmaWNhdGUgQXV0aG9yaXR5 +IDIwMTcwHhcNMTkxMjE4MjI1MTIyWhcNNDIwNzE4MjMwMDIzWjBlMQswCQYDVQQG +EwJVUzEeMBwGA1UEChMVTWljcm9zb2Z0IENvcnBvcmF0aW9uMTYwNAYDVQQDEy1N +aWNyb3NvZnQgUlNBIFJvb3QgQ2VydGlmaWNhdGUgQXV0aG9yaXR5IDIwMTcwggIi +MA0GCSqGSIb3DQEBAQUAA4ICDwAwggIKAoICAQDKW76UM4wplZEWCpW9R2LBifOZ +Nt9GkMml7Xhqb0eRaPgnZ1AzHaGm++DlQ6OEAlcBXZxIQIJTELy/xztokLaCLeX0 +ZdDMbRnMlfl7rEqUrQ7eS0MdhweSE5CAg2Q1OQT85elss7YfUJQ4ZVBcF0a5toW1 +HLUX6NZFndiyJrDKxHBKrmCk3bPZ7Pw71VdyvD/IybLeS2v4I2wDwAW9lcfNcztm +gGTjGqwu+UcF8ga2m3P1eDNbx6H7JyqhtJqRjJHTOoI+dkC0zVJhUXAoP8XFWvLJ +jEm7FFtNyP9nTUwSlq31/niol4fX/V4ggNyhSyL71Imtus5Hl0dVe49FyGcohJUc +aDDv70ngNXtk55iwlNpNhTs+VcQor1fznhPbRiefHqJeRIOkpcrVE7NLP8TjwuaG +YaRSMLl6IE9vDzhTyzMMEyuP1pq9KsgtsRx9S1HKR9FIJ3Jdh+vVReZIZZ2vUpC6 +W6IYZVcSn2i51BVrlMRpIpj0M+Dt+VGOQVDJNE92kKz8OMHY4Xu54+OU4UZpyw4K +UGsTuqwPN1q3ErWQgR5WrlcihtnJ0tHXUeOrO8ZV/R4O03QK0dqq6mm4lyiPSMQH ++FJDOvTKVTUssKZqwJz58oHhEmrARdlns87/I6KJClTUFLkqqNfs+avNJVgyeY+Q +W5g5xAgGwax/Dj0ApQIDAQABo1QwUjAOBgNVHQ8BAf8EBAMCAYYwDwYDVR0TAQH/ +BAUwAwEB/zAdBgNVHQ4EFgQUCctZf4aycI8awznjwNnpv7tNsiMwEAYJKwYBBAGC +NxUBBAMCAQAwDQYJKoZIhvcNAQEMBQADggIBAKyvPl3CEZaJjqPnktaXFbgToqZC +LgLNFgVZJ8og6Lq46BrsTaiXVq5lQ7GPAJtSzVXNUzltYkyLDVt8LkS/gxCP81OC +gMNPOsduET/m4xaRhPtthH80dK2Jp86519efhGSSvpWhrQlTM93uCupKUY5vVau6 +tZRGrox/2KJQJWVggEbbMwSubLWYdFQl3JPk+ONVFT24bcMKpBLBaYVu32TxU5nh +SnUgnZUP5NbcA/FZGOhHibJXWpS2qdgXKxdJ5XbLwVaZOjex/2kskZGT4d9Mozd2 +TaGf+G0eHdP67Pv0RR0Tbc/3WeUiJ3IrhvNXuzDtJE3cfVa7o7P4NHmJweDyAmH3 +pvwPuxwXC65B2Xy9J6P9LjrRk5Sxcx0ki69bIImtt2dmefU6xqaWM/5TkshGsRGR +xpl/j8nWZjEgQRCHLQzWwa80mMpkg/sTV9HB8Dx6jKXB/ZUhoHHBk2dxEuqPiApp +GWSZI1b7rCoucL5mxAyE7+WL85MB+GqQk2dLsmijtWKP6T+MejteD+eMuMZ87zf9 +dOLITzNy4ZQ5bb0Sr74MTnB8G2+NszKTc0QWbej09+CVgI+WXTik9KveCjCHk9hN +AHFiRSdLOkKEW39lt2c0Ui2cFmuqqNh7o0JMcccMyj6D5KbvtwEwXlGjefVwaaZB +RA+GsCyRxj3qrg+E +-----END CERTIFICATE----- +-----BEGIN CERTIFICATE----- +MIICQDCCAeWgAwIBAgIMAVRI7yH9l1kN9QQKMAoGCCqGSM49BAMCMHExCzAJBgNV +BAYTAkhVMREwDwYDVQQHDAhCdWRhcGVzdDEWMBQGA1UECgwNTWljcm9zZWMgTHRk +LjEXMBUGA1UEYQwOVkFUSFUtMjM1ODQ0OTcxHjAcBgNVBAMMFWUtU3ppZ25vIFJv +b3QgQ0EgMjAxNzAeFw0xNzA4MjIxMjA3MDZaFw00MjA4MjIxMjA3MDZaMHExCzAJ +BgNVBAYTAkhVMREwDwYDVQQHDAhCdWRhcGVzdDEWMBQGA1UECgwNTWljcm9zZWMg +THRkLjEXMBUGA1UEYQwOVkFUSFUtMjM1ODQ0OTcxHjAcBgNVBAMMFWUtU3ppZ25v +IFJvb3QgQ0EgMjAxNzBZMBMGByqGSM49AgEGCCqGSM49AwEHA0IABJbcPYrYsHtv +xie+RJCxs1YVe45DJH0ahFnuY2iyxl6H0BVIHqiQrb1TotreOpCmYF9oMrWGQd+H +Wyx7xf58etqjYzBhMA8GA1UdEwEB/wQFMAMBAf8wDgYDVR0PAQH/BAQDAgEGMB0G +A1UdDgQWBBSHERUI0arBeAyxr87GyZDvvzAEwDAfBgNVHSMEGDAWgBSHERUI0arB +eAyxr87GyZDvvzAEwDAKBggqhkjOPQQDAgNJADBGAiEAtVfd14pVCzbhhkT61Nlo +jbjcI4qKDdQvfepz7L9NbKgCIQDLpbQS+ue16M9+k/zzNY9vTlp8tLxOsvxyqltZ ++efcMQ== +-----END CERTIFICATE----- +-----BEGIN CERTIFICATE----- +MIIFRzCCAy+gAwIBAgIJEQA0tk7GNi02MA0GCSqGSIb3DQEBCwUAMEExCzAJBgNV +BAYTAlJPMRQwEgYDVQQKEwtDRVJUU0lHTiBTQTEcMBoGA1UECxMTY2VydFNJR04g +Uk9PVCBDQSBHMjAeFw0xNzAyMDYwOTI3MzVaFw00MjAyMDYwOTI3MzVaMEExCzAJ +BgNVBAYTAlJPMRQwEgYDVQQKEwtDRVJUU0lHTiBTQTEcMBoGA1UECxMTY2VydFNJ +R04gUk9PVCBDQSBHMjCCAiIwDQYJKoZIhvcNAQEBBQADggIPADCCAgoCggIBAMDF +dRmRfUR0dIf+DjuW3NgBFszuY5HnC2/OOwppGnzC46+CjobXXo9X69MhWf05N0Iw +vlDqtg+piNguLWkh59E3GE59kdUWX2tbAMI5Qw02hVK5U2UPHULlj88F0+7cDBrZ +uIt4ImfkabBoxTzkbFpG583H+u/E7Eu9aqSs/cwoUe+StCmrqzWaTOTECMYmzPhp +n+Sc8CnTXPnGFiWeI8MgwT0PPzhAsP6CRDiqWhqKa2NYOLQV07YRaXseVO6MGiKs +cpc/I1mbySKEwQdPzH/iV8oScLumZfNpdWO9lfsbl83kqK/20U6o2YpxJM02PbyW +xPFsqa7lzw1uKA2wDrXKUXt4FMMgL3/7FFXhEZn91QqhngLjYl/rNUssuHLoPj1P +rCy7Lobio3aP5ZMqz6WryFyNSwb/EkaseMsUBzXgqd+L6a8VTxaJW732jcZZroiF +DsGJ6x9nxUWO/203Nit4ZoORUSs9/1F3dmKh7Gc+PoGD4FapUB8fepmrY7+EF3fx +DTvf95xhszWYijqy7DwaNz9+j5LP2RIUZNoQAhVB/0/E6xyjyfqZ90bp4RjZsbgy +LcsUDFDYg2WD7rlcz8sFWkz6GZdr1l0T08JcVLwyc6B49fFtHsufpaafItzRUZ6C +eWRgKRM+o/1Pcmqr4tTluCRVLERLiohEnMqE0yo7AgMBAAGjQjBAMA8GA1UdEwEB +/wQFMAMBAf8wDgYDVR0PAQH/BAQDAgEGMB0GA1UdDgQWBBSCIS1mxteg4BXrzkwJ +d8RgnlRuAzANBgkqhkiG9w0BAQsFAAOCAgEAYN4auOfyYILVAzOBywaK8SJJ6ejq +kX/GM15oGQOGO0MBzwdw5AgeZYWR5hEit/UCI46uuR59H35s5r0l1ZUa8gWmr4UC +b6741jH/JclKyMeKqdmfS0mbEVeZkkMR3rYzpMzXjWR91M08KCy0mpbqTfXERMQl +qiCA2ClV9+BB/AYm/7k29UMUA2Z44RGx2iBfRgB4ACGlHgAoYXhvqAEBj500mv/0 +OJD7uNGzcgbJceaBxXntC6Z58hMLnPddDnskk7RI24Zf3lCGeOdA5jGokHZwYa+c +NywRtYK3qq4kNFtyDGkNzVmf9nGvnAvRCjj5BiKDUyUM/FHE5r7iOZULJK2v0ZXk +ltd0ZGtxTgI8qoXzIKNDOXZbbFD+mpwUHmUUihW9o4JFWklWatKcsWMy5WHgUyIO +pwpJ6st+H6jiYoD2EEVSmAYY3qXNL3+q1Ok+CHLsIwMCPKaq2LxndD0UF/tUSxfj +03k9bWtJySgOLnRQvwzZRjoQhsmnP+mg7H/rpXdYaXHmgwo38oZJar55CJD2AhZk +PuXaTH4MNMn5X7azKFGnpyuqSfqNZSlO42sTp5SjLVFteAxEy9/eCG/Oo2Sr05WE +1LlSVHJ7liXMvGnjSG4N0MedJ5qq+BOS3R7fY581qRY27Iy4g/Q9iY/NtBde17MX +QRBdJ3NghVdJIgc= +-----END CERTIFICATE----- +-----BEGIN CERTIFICATE----- +MIIF2jCCA8KgAwIBAgIMBfcOhtpJ80Y1LrqyMA0GCSqGSIb3DQEBCwUAMIGIMQsw +CQYDVQQGEwJVUzERMA8GA1UECAwISWxsaW5vaXMxEDAOBgNVBAcMB0NoaWNhZ28x +ITAfBgNVBAoMGFRydXN0d2F2ZSBIb2xkaW5ncywgSW5jLjExMC8GA1UEAwwoVHJ1 +c3R3YXZlIEdsb2JhbCBDZXJ0aWZpY2F0aW9uIEF1dGhvcml0eTAeFw0xNzA4MjMx +OTM0MTJaFw00MjA4MjMxOTM0MTJaMIGIMQswCQYDVQQGEwJVUzERMA8GA1UECAwI +SWxsaW5vaXMxEDAOBgNVBAcMB0NoaWNhZ28xITAfBgNVBAoMGFRydXN0d2F2ZSBI +b2xkaW5ncywgSW5jLjExMC8GA1UEAwwoVHJ1c3R3YXZlIEdsb2JhbCBDZXJ0aWZp +Y2F0aW9uIEF1dGhvcml0eTCCAiIwDQYJKoZIhvcNAQEBBQADggIPADCCAgoCggIB +ALldUShLPDeS0YLOvR29zd24q88KPuFd5dyqCblXAj7mY2Hf8g+CY66j96xz0Xzn +swuvCAAJWX/NKSqIk4cXGIDtiLK0thAfLdZfVaITXdHG6wZWiYj+rDKd/VzDBcdu +7oaJuogDnXIhhpCujwOl3J+IKMujkkkP7NAP4m1ET4BqstTnoApTAbqOl5F2brz8 +1Ws25kCI1nsvXwXoLG0R8+eyvpJETNKXpP7ScoFDB5zpET71ixpZfR9oWN0EACyW +80OzfpgZdNmcc9kYvkHHNHnZ9GLCQ7mzJ7Aiy/k9UscwR7PJPrhq4ufogXBeQotP +JqX+OsIgbrv4Fo7NDKm0G2x2EOFYeUY+VM6AqFcJNykbmROPDMjWLBz7BegIlT1l +RtzuzWniTY+HKE40Cz7PFNm73bZQmq131BnW2hqIyE4bJ3XYsgjxroMwuREOzYfw +hI0Vcnyh78zyiGG69Gm7DIwLdVcEuE4qFC49DxweMqZiNu5m4iK4BUBjECLzMx10 +coos9TkpoNPnG4CELcU9402x/RpvumUHO1jsQkUm+9jaJXLE9gCxInm943xZYkqc +BW89zubWR2OZxiRvchLIrH+QtAuRcOi35hYQcRfO3gZPSEF9NUqjifLJS3tBEW1n +twiYTOURGa5CgNz7kAXU+FDKvuStx8KU1xad5hePrzb7AgMBAAGjQjBAMA8GA1Ud +EwEB/wQFMAMBAf8wHQYDVR0OBBYEFJngGWcNYtt2s9o9uFvo/ULSMQ6HMA4GA1Ud +DwEB/wQEAwIBBjANBgkqhkiG9w0BAQsFAAOCAgEAmHNw4rDT7TnsTGDZqRKGFx6W +0OhUKDtkLSGm+J1WE2pIPU/HPinbbViDVD2HfSMF1OQc3Og4ZYbFdada2zUFvXfe +uyk3QAUHw5RSn8pk3fEbK9xGChACMf1KaA0HZJDmHvUqoai7PF35owgLEQzxPy0Q +lG/+4jSHg9bP5Rs1bdID4bANqKCqRieCNqcVtgimQlRXtpla4gt5kNdXElE1GYhB +aCXUNxeEFfsBctyV3lImIJgm4nb1J2/6ADtKYdkNy1GTKv0WBpanI5ojSP5RvbbE +sLFUzt5sQa0WZ37b/TjNuThOssFgy50X31ieemKyJo90lZvkWx3SD92YHJtZuSPT +MaCm/zjdzyBP6VhWOmfD0faZmZ26NraAL4hHT4a/RDqA5Dccprrql5gR0IRiR2Qe +qu5AvzSxnI9O4fKSTx+O856X3vOmeWqJcU9LJxdI/uz0UA9PSX3MReO9ekDFQdxh +VicGaeVyQYHTtgGJoC86cnn+OjC/QezHYj6RS8fZMXZC+fc8Y+wmjHMMfRod6qh8 +h6jCJ3zhM0EPz8/8AKAigJ5Kp28AsEFFtyLKaEjFQqKu3R3y4G5OBVixwJAWKqQ9 +EEC+j2Jjg6mcgn0tAumDMHzLJ8n9HmYAsC7TIS+OMxZsmO0QqAfWzJPP29FpHOTK +yeC2nOnOcXHebD8WpHk= +-----END CERTIFICATE----- +-----BEGIN CERTIFICATE----- +MIICYDCCAgegAwIBAgIMDWpfCD8oXD5Rld9dMAoGCCqGSM49BAMCMIGRMQswCQYD +VQQGEwJVUzERMA8GA1UECBMISWxsaW5vaXMxEDAOBgNVBAcTB0NoaWNhZ28xITAf +BgNVBAoTGFRydXN0d2F2ZSBIb2xkaW5ncywgSW5jLjE6MDgGA1UEAxMxVHJ1c3R3 +YXZlIEdsb2JhbCBFQ0MgUDI1NiBDZXJ0aWZpY2F0aW9uIEF1dGhvcml0eTAeFw0x +NzA4MjMxOTM1MTBaFw00MjA4MjMxOTM1MTBaMIGRMQswCQYDVQQGEwJVUzERMA8G +A1UECBMISWxsaW5vaXMxEDAOBgNVBAcTB0NoaWNhZ28xITAfBgNVBAoTGFRydXN0 +d2F2ZSBIb2xkaW5ncywgSW5jLjE6MDgGA1UEAxMxVHJ1c3R3YXZlIEdsb2JhbCBF +Q0MgUDI1NiBDZXJ0aWZpY2F0aW9uIEF1dGhvcml0eTBZMBMGByqGSM49AgEGCCqG +SM49AwEHA0IABH77bOYj43MyCMpg5lOcunSNGLB4kFKA3TjASh3RqMyTpJcGOMoN +FWLGjgEqZZ2q3zSRLoHB5DOSMcT9CTqmP62jQzBBMA8GA1UdEwEB/wQFMAMBAf8w +DwYDVR0PAQH/BAUDAwcGADAdBgNVHQ4EFgQUo0EGrJBt0UrrdaVKEJmzsaGLSvcw +CgYIKoZIzj0EAwIDRwAwRAIgB+ZU2g6gWrKuEZ+Hxbb/ad4lvvigtwjzRM4q3wgh +DDcCIC0mA6AFvWvR9lz4ZcyGbbOcNEhjhAnFjXca4syc4XR7 +-----END CERTIFICATE----- +-----BEGIN CERTIFICATE----- +MIICnTCCAiSgAwIBAgIMCL2Fl2yZJ6SAaEc7MAoGCCqGSM49BAMDMIGRMQswCQYD +VQQGEwJVUzERMA8GA1UECBMISWxsaW5vaXMxEDAOBgNVBAcTB0NoaWNhZ28xITAf +BgNVBAoTGFRydXN0d2F2ZSBIb2xkaW5ncywgSW5jLjE6MDgGA1UEAxMxVHJ1c3R3 +YXZlIEdsb2JhbCBFQ0MgUDM4NCBDZXJ0aWZpY2F0aW9uIEF1dGhvcml0eTAeFw0x +NzA4MjMxOTM2NDNaFw00MjA4MjMxOTM2NDNaMIGRMQswCQYDVQQGEwJVUzERMA8G +A1UECBMISWxsaW5vaXMxEDAOBgNVBAcTB0NoaWNhZ28xITAfBgNVBAoTGFRydXN0 +d2F2ZSBIb2xkaW5ncywgSW5jLjE6MDgGA1UEAxMxVHJ1c3R3YXZlIEdsb2JhbCBF +Q0MgUDM4NCBDZXJ0aWZpY2F0aW9uIEF1dGhvcml0eTB2MBAGByqGSM49AgEGBSuB +BAAiA2IABGvaDXU1CDFHBa5FmVXxERMuSvgQMSOjfoPTfygIOiYaOs+Xgh+AtycJ +j9GOMMQKmw6sWASr9zZ9lCOkmwqKi6vr/TklZvFe/oyujUF5nQlgziip04pt89ZF +1PKYhDhloKNDMEEwDwYDVR0TAQH/BAUwAwEB/zAPBgNVHQ8BAf8EBQMDBwYAMB0G +A1UdDgQWBBRVqYSJ0sEyvRjLbKYHTsjnnb6CkDAKBggqhkjOPQQDAwNnADBkAjA3 +AZKXRRJ+oPM+rRk6ct30UJMDEr5E0k9BpIycnR+j9sKS50gU/k6bpZFXrsY3crsC +MGclCrEMXu6pY5Jv5ZAL/mYiykf9ijH3g/56vxC+GCsej/YpHpRZ744hN8tRmKVu +Sw== +-----END CERTIFICATE----- +-----BEGIN CERTIFICATE----- +MIIFojCCA4qgAwIBAgIUAZQwHqIL3fXFMyqxQ0Rx+NZQTQ0wDQYJKoZIhvcNAQEM +BQAwaTELMAkGA1UEBhMCS1IxJjAkBgNVBAoMHU5BVkVSIEJVU0lORVNTIFBMQVRG +T1JNIENvcnAuMTIwMAYDVQQDDClOQVZFUiBHbG9iYWwgUm9vdCBDZXJ0aWZpY2F0 +aW9uIEF1dGhvcml0eTAeFw0xNzA4MTgwODU4NDJaFw0zNzA4MTgyMzU5NTlaMGkx +CzAJBgNVBAYTAktSMSYwJAYDVQQKDB1OQVZFUiBCVVNJTkVTUyBQTEFURk9STSBD +b3JwLjEyMDAGA1UEAwwpTkFWRVIgR2xvYmFsIFJvb3QgQ2VydGlmaWNhdGlvbiBB +dXRob3JpdHkwggIiMA0GCSqGSIb3DQEBAQUAA4ICDwAwggIKAoICAQC21PGTXLVA +iQqrDZBbUGOukJR0F0Vy1ntlWilLp1agS7gvQnXp2XskWjFlqxcX0TM62RHcQDaH +38dq6SZeWYp34+hInDEW+j6RscrJo+KfziFTowI2MMtSAuXaMl3Dxeb57hHHi8lE +HoSTGEq0n+USZGnQJoViAbbJAh2+g1G7XNr4rRVqmfeSVPc0W+m/6imBEtRTkZaz +kVrd/pBzKPswRrXKCAfHcXLJZtM0l/aM9BhK4dA9WkW2aacp+yPOiNgSnABIqKYP +szuSjXEOdMWLyEz59JuOuDxp7W87UC9Y7cSw0BwbagzivESq2M0UXZR4Yb8Obtoq +vC8MC3GmsxY/nOb5zJ9TNeIDoKAYv7vxvvTWjIcNQvcGufFt7QSUqP620wbGQGHf +nZ3zVHbOUzoBppJB7ASjjw2i1QnK1sua8e9DXcCrpUHPXFNwcMmIpi3Ua2FzUCaG +YQ5fG8Ir4ozVu53BA0K6lNpfqbDKzE0K70dpAy8i+/Eozr9dUGWokG2zdLAIx6yo +0es+nPxdGoMuK8u180SdOqcXYZaicdNwlhVNt0xz7hlcxVs+Qf6sdWA7G2POAN3a +CJBitOUt7kinaxeZVL6HSuOpXgRM6xBtVNbv8ejyYhbLgGvtPe31HzClrkvJE+2K +AQHJuFFYwGY6sWZLxNUxAmLpdIQM201GLQIDAQABo0IwQDAdBgNVHQ4EFgQU0p+I +36HNLL3s9TsBAZMzJ7LrYEswDgYDVR0PAQH/BAQDAgEGMA8GA1UdEwEB/wQFMAMB +Af8wDQYJKoZIhvcNAQEMBQADggIBADLKgLOdPVQG3dLSLvCkASELZ0jKbY7gyKoN +qo0hV4/GPnrK21HUUrPUloSlWGB/5QuOH/XcChWB5Tu2tyIvCZwTFrFsDDUIbatj +cu3cvuzHV+YwIHHW1xDBE1UBjCpD5EHxzzp6U5LOogMFDTjfArsQLtk70pt6wKGm ++LUx5vR1yblTmXVHIloUFcd4G7ad6Qz4G3bxhYTeodoS76TiEJd6eN4MUZeoIUCL +hr0N8F5OSza7OyAfikJW4Qsav3vQIkMsRIz75Sq0bBwcupTgE34h5prCy8VCZLQe +lHsIJchxzIdFV4XTnyliIoNRlwAYl3dqmJLJfGBs32x9SuRwTMKeuB330DTHD8z7 +p/8Dvq1wkNoL3chtl1+afwkyQf3NosxabUzyqkn+Zvjp2DXrDige7kgvOtB5CTh8 +piKCk5XQA76+AqAF3SAi428diDRgxuYKuQl1C/AH6GmWNcf7I4GOODm4RStDeKLR +LBT/DShycpWbXgnbiUSYqqFJu3FS8r/2/yehNq+4tneI3TqkbZs0kNwUXTC/t+sX +5Ie3cdCh13cV1ELX8vMxmV2b3RZtP+oGI/hGoiLtk/bdmuYqh7GYVPEi92tF4+KO +dh2ajcQGjTa3FPOdVGm3jjzVpG2Tgbet9r1ke8LJaDmgkpzNNIaRkPpkUZ3+/uul +9XXeifdy +-----END CERTIFICATE----- +-----BEGIN CERTIFICATE----- +MIICbjCCAfOgAwIBAgIQYvYybOXE42hcG2LdnC6dlTAKBggqhkjOPQQDAzB4MQsw +CQYDVQQGEwJFUzERMA8GA1UECgwIRk5NVC1SQ00xDjAMBgNVBAsMBUNlcmVzMRgw +FgYDVQRhDA9WQVRFUy1RMjgyNjAwNEoxLDAqBgNVBAMMI0FDIFJBSVogRk5NVC1S +Q00gU0VSVklET1JFUyBTRUdVUk9TMB4XDTE4MTIyMDA5MzczM1oXDTQzMTIyMDA5 +MzczM1oweDELMAkGA1UEBhMCRVMxETAPBgNVBAoMCEZOTVQtUkNNMQ4wDAYDVQQL +DAVDZXJlczEYMBYGA1UEYQwPVkFURVMtUTI4MjYwMDRKMSwwKgYDVQQDDCNBQyBS +QUlaIEZOTVQtUkNNIFNFUlZJRE9SRVMgU0VHVVJPUzB2MBAGByqGSM49AgEGBSuB +BAAiA2IABPa6V1PIyqvfNkpSIeSX0oNnnvBlUdBeh8dHsVnyV0ebAAKTRBdp20LH +sbI6GA60XYyzZl2hNPk2LEnb80b8s0RpRBNm/dfF/a82Tc4DTQdxz69qBdKiQ1oK +Um8BA06Oi6NCMEAwDwYDVR0TAQH/BAUwAwEB/zAOBgNVHQ8BAf8EBAMCAQYwHQYD +VR0OBBYEFAG5L++/EYZg8k/QQW6rcx/n0m5JMAoGCCqGSM49BAMDA2kAMGYCMQCu +SuMrQMN0EfKVrRYj3k4MGuZdpSRea0R7/DjiT8ucRRcRTBQnJlU5dUoDzBOQn5IC +MQD6SmxgiHPz7riYYqnOK8LZiqZwMR2vsJRM60/G49HzYqc8/5MuB1xJAWdpEgJy +v+c= +-----END CERTIFICATE----- +-----BEGIN CERTIFICATE----- +MIIFWjCCA0KgAwIBAgISEdK7udcjGJ5AXwqdLdDfJWfRMA0GCSqGSIb3DQEBDAUA +MEYxCzAJBgNVBAYTAkJFMRkwFwYDVQQKExBHbG9iYWxTaWduIG52LXNhMRwwGgYD +VQQDExNHbG9iYWxTaWduIFJvb3QgUjQ2MB4XDTE5MDMyMDAwMDAwMFoXDTQ2MDMy +MDAwMDAwMFowRjELMAkGA1UEBhMCQkUxGTAXBgNVBAoTEEdsb2JhbFNpZ24gbnYt +c2ExHDAaBgNVBAMTE0dsb2JhbFNpZ24gUm9vdCBSNDYwggIiMA0GCSqGSIb3DQEB +AQUAA4ICDwAwggIKAoICAQCsrHQy6LNl5brtQyYdpokNRbopiLKkHWPd08EsCVeJ +OaFV6Wc0dwxu5FUdUiXSE2te4R2pt32JMl8Nnp8semNgQB+msLZ4j5lUlghYruQG +vGIFAha/r6gjA7aUD7xubMLL1aa7DOn2wQL7Id5m3RerdELv8HQvJfTqa1VbkNud +316HCkD7rRlr+/fKYIje2sGP1q7Vf9Q8g+7XFkyDRTNrJ9CG0Bwta/OrffGFqfUo +0q3v84RLHIf8E6M6cqJaESvWJ3En7YEtbWaBkoe0G1h6zD8K+kZPTXhc+CtI4wSE +y132tGqzZfxCnlEmIyDLPRT5ge1lFgBPGmSXZgjPjHvjK8Cd+RTyG/FWaha/LIWF +zXg4mutCagI0GIMXTpRW+LaCtfOW3T3zvn8gdz57GSNrLNRyc0NXfeD412lPFzYE ++cCQYDdF3uYM2HSNrpyibXRdQr4G9dlkbgIQrImwTDsHTUB+JMWKmIJ5jqSngiCN +I/onccnfxkF0oE32kRbcRoxfKWMxWXEM2G/CtjJ9++ZdU6Z+Ffy7dXxd7Pj2Fxzs +x2sZy/N78CsHpdlseVR2bJ0cpm4O6XkMqCNqo98bMDGfsVR7/mrLZqrcZdCinkqa +ByFrgY/bxFn63iLABJzjqls2k+g9vXqhnQt2sQvHnf3PmKgGwvgqo6GDoLclcqUC +4wIDAQABo0IwQDAOBgNVHQ8BAf8EBAMCAYYwDwYDVR0TAQH/BAUwAwEB/zAdBgNV +HQ4EFgQUA1yrc4GHqMywptWU4jaWSf8FmSwwDQYJKoZIhvcNAQEMBQADggIBAHx4 +7PYCLLtbfpIrXTncvtgdokIzTfnvpCo7RGkerNlFo048p9gkUbJUHJNOxO97k4Vg +JuoJSOD1u8fpaNK7ajFxzHmuEajwmf3lH7wvqMxX63bEIaZHU1VNaL8FpO7XJqti +2kM3S+LGteWygxk6x9PbTZ4IevPuzz5i+6zoYMzRx6Fcg0XERczzF2sUyQQCPtIk +pnnpHs6i58FZFZ8d4kuaPp92CC1r2LpXFNqD6v6MVenQTqnMdzGxRBF6XLE+0xRF +FRhiJBPSy03OXIPBNvIQtQ6IbbjhVp+J3pZmOUdkLG5NrmJ7v2B0GbhWrJKsFjLt +rWhV/pi60zTe9Mlhww6G9kuEYO4Ne7UyWHmRVSyBQ7N0H3qqJZ4d16GLuc1CLgSk +ZoNNiTW2bKg2SnkheCLQQrzRQDGQob4Ez8pn7fXwgNNgyYMqIgXQBztSvwyeqiv5 +u+YfjyW6hY0XHgL+XVAEV8/+LbzvXMAaq7afJMbfc2hIkCwU9D9SGuTSyxTDYWnP +4vkYxboznxSjBF25cfe1lNj2M8FawTSLfJvdkzrnE6JwYZ+vj+vYxXX4M2bUdGc6 +N3ec592kD3ZDZopD8p/7DEJ4Y9HiD2971KE9dJeFt0g5QdYg/NA6s/rob8SKunE3 +vouXsXgxT7PntgMTzlSdriVZzH81Xwj3QEUxeCp6 +-----END CERTIFICATE----- +-----BEGIN CERTIFICATE----- +MIICCzCCAZGgAwIBAgISEdK7ujNu1LzmJGjFDYQdmOhDMAoGCCqGSM49BAMDMEYx +CzAJBgNVBAYTAkJFMRkwFwYDVQQKExBHbG9iYWxTaWduIG52LXNhMRwwGgYDVQQD +ExNHbG9iYWxTaWduIFJvb3QgRTQ2MB4XDTE5MDMyMDAwMDAwMFoXDTQ2MDMyMDAw +MDAwMFowRjELMAkGA1UEBhMCQkUxGTAXBgNVBAoTEEdsb2JhbFNpZ24gbnYtc2Ex +HDAaBgNVBAMTE0dsb2JhbFNpZ24gUm9vdCBFNDYwdjAQBgcqhkjOPQIBBgUrgQQA +IgNiAAScDrHPt+ieUnd1NPqlRqetMhkytAepJ8qUuwzSChDH2omwlwxwEwkBjtjq +R+q+soArzfwoDdusvKSGN+1wCAB16pMLey5SnCNoIwZD7JIvU4Tb+0cUB+hflGdd +yXqBPCCjQjBAMA4GA1UdDwEB/wQEAwIBhjAPBgNVHRMBAf8EBTADAQH/MB0GA1Ud +DgQWBBQxCpCPtsad0kRLgLWi5h+xEk8blTAKBggqhkjOPQQDAwNoADBlAjEA31SQ +7Zvvi5QCkxeCmb6zniz2C5GMn0oUsfZkvLtoURMMA/cVi4RguYv/Uo7njLwcAjA8 ++RHUjE7AwWHCFUyqqx0LMV87HOIAl0Qx5v5zli/altP+CAezNIm8BZ/3Hobui3A= +-----END CERTIFICATE----- ` // CACerts builds an X.509 certificate pool containing the -// certificate bundle from https://mkcert.org/generate/ fetch on 2020-02-11 10:00:50.717122 -0800 PST m=+0.664468880. -// Returns nil on error along with an appropriate error code. +// certificate bundle from https://mkcert.org/generate/ fetch on 2021-05-07 14:14:36.874796853 -0700 PDT m=+0.476299993. +// Will never actually return an error. func CACerts() (*x509.CertPool, error) { pool := x509.NewCertPool() pool.AppendCertsFromPEM([]byte(pemcerts)) diff --git a/vendor/github.com/getsentry/raven-go/.gitignore b/vendor/github.com/getsentry/raven-go/.gitignore index 797da784..0f66ce75 100644 --- a/vendor/github.com/getsentry/raven-go/.gitignore +++ b/vendor/github.com/getsentry/raven-go/.gitignore @@ -1,5 +1,5 @@ *.test +*.out example/example - -docs/_build -docs/doctrees +/xunit.xml +/coverage.xml diff --git a/vendor/github.com/getsentry/raven-go/.gitmodules b/vendor/github.com/getsentry/raven-go/.gitmodules index 1e6464ab..e69de29b 100644 --- a/vendor/github.com/getsentry/raven-go/.gitmodules +++ b/vendor/github.com/getsentry/raven-go/.gitmodules @@ -1,3 +0,0 @@ -[submodule "docs/_sentryext"] - path = docs/_sentryext - url = https://github.com/getsentry/sentry-doc-support diff --git a/vendor/github.com/getsentry/raven-go/.travis.yml b/vendor/github.com/getsentry/raven-go/.travis.yml index 9f0d5488..8ec4eca8 100644 --- a/vendor/github.com/getsentry/raven-go/.travis.yml +++ b/vendor/github.com/getsentry/raven-go/.travis.yml @@ -1,26 +1,41 @@ sudo: false language: go go: - - "1.2" - - "1.3" - - 1.4.x - - 1.5.x - - 1.6.x - 1.7.x - 1.8.x - 1.9.x - 1.10.x + - 1.11.x - tip before_install: - go install -race std - go get golang.org/x/tools/cmd/cover + - go get github.com/tebeka/go2xunit + - go get github.com/t-yuki/gocover-cobertura - go get -v ./... script: - - go test -v -race ./... - - go test -v -cover ./... + - go test -v -race ./... | tee gotest.out + - $GOPATH/bin/go2xunit -fail -input gotest.out -output xunit.xml + - go test -v -coverprofile=coverage.txt -covermode count . + - $GOPATH/bin/gocover-cobertura < coverage.txt > coverage.xml + +after_script: + - npm install -g @zeus-ci/cli + - zeus upload -t "application/x-cobertura+xml" coverage.xml + - zeus upload -t "application/x-xunit+xml" xunit.xml matrix: allow_failures: - go: tip + +notifications: + webhooks: + urls: + - https://zeus.ci/hooks/cd949996-d30a-11e8-ba53-0a580a28042d/public/provider/travis/webhook + on_success: always + on_failure: always + on_start: always + on_cancel: always + on_error: always diff --git a/vendor/github.com/getsentry/raven-go/README.md b/vendor/github.com/getsentry/raven-go/README.md index 5ea29a0a..16c9483e 100644 --- a/vendor/github.com/getsentry/raven-go/README.md +++ b/vendor/github.com/getsentry/raven-go/README.md @@ -1,6 +1,10 @@ -# raven [![Build Status](https://travis-ci.org/getsentry/raven-go.png?branch=master)](https://travis-ci.org/getsentry/raven-go) +# raven -raven is a Go client for the [Sentry](https://github.com/getsentry/sentry) +[![Build Status](https://api.travis-ci.org/getsentry/raven-go.svg?branch=master)](https://travis-ci.org/getsentry/raven-go) +[![Go Report Card](https://goreportcard.com/badge/github.com/getsentry/raven-go)](https://goreportcard.com/report/github.com/getsentry/raven-go) +[![GoDoc](https://godoc.org/github.com/getsentry/raven-go?status.svg)](https://godoc.org/github.com/getsentry/raven-go) + +raven is the official Go SDK for the [Sentry](https://github.com/getsentry/sentry) event/error logging system. - [**API Documentation**](https://godoc.org/github.com/getsentry/raven-go) @@ -11,3 +15,5 @@ event/error logging system. ```text go get github.com/getsentry/raven-go ``` + +Note: Go 1.7 and newer are supported. diff --git a/vendor/github.com/getsentry/raven-go/client.go b/vendor/github.com/getsentry/raven-go/client.go index e224aa1a..a2c9a6c3 100644 --- a/vendor/github.com/getsentry/raven-go/client.go +++ b/vendor/github.com/getsentry/raven-go/client.go @@ -945,7 +945,7 @@ func (t *HTTPTransport) Send(url, authHeader string, packet *Packet) error { io.Copy(ioutil.Discard, res.Body) res.Body.Close() if res.StatusCode != 200 { - return fmt.Errorf("raven: got http status %d", res.StatusCode) + return fmt.Errorf("raven: got http status %d - x-sentry-error: %s", res.StatusCode, res.Header.Get("X-Sentry-Error")) } return nil } diff --git a/vendor/github.com/getsentry/raven-go/http.go b/vendor/github.com/getsentry/raven-go/http.go index d5cb05a6..ae8f4723 100644 --- a/vendor/github.com/getsentry/raven-go/http.go +++ b/vendor/github.com/getsentry/raven-go/http.go @@ -69,17 +69,31 @@ func (h *Http) Class() string { return "request" } // ... // })) func RecoveryHandler(handler func(http.ResponseWriter, *http.Request)) func(http.ResponseWriter, *http.Request) { - return func(w http.ResponseWriter, r *http.Request) { + return Recoverer(http.HandlerFunc(handler)).ServeHTTP +} + +// Recovery handler to wrap the stdlib net/http Mux. +// Example: +// mux := http.NewServeMux +// ... +// http.Handle("/", raven.Recoverer(mux)) +func Recoverer(handler http.Handler) http.Handler { + return http.HandlerFunc(func(w http.ResponseWriter, r *http.Request) { defer func() { if rval := recover(); rval != nil { debug.PrintStack() rvalStr := fmt.Sprint(rval) - packet := NewPacket(rvalStr, NewException(errors.New(rvalStr), GetOrNewStacktrace(rval.(error), 2, 3, nil)), NewHttp(r)) + var packet *Packet + if err, ok := rval.(error); ok { + packet = NewPacket(rvalStr, NewException(errors.New(rvalStr), GetOrNewStacktrace(err, 2, 3, nil)), NewHttp(r)) + } else { + packet = NewPacket(rvalStr, NewException(errors.New(rvalStr), NewStacktrace(2, 3, nil)), NewHttp(r)) + } Capture(packet, nil) w.WriteHeader(http.StatusInternalServerError) } }() - handler(w, r) - } + handler.ServeHTTP(w, r) + }) } diff --git a/vendor/github.com/getsentry/raven-go/stacktrace.go b/vendor/github.com/getsentry/raven-go/stacktrace.go index fe46bf66..bc302ba1 100644 --- a/vendor/github.com/getsentry/raven-go/stacktrace.go +++ b/vendor/github.com/getsentry/raven-go/stacktrace.go @@ -61,14 +61,17 @@ func GetOrNewStacktrace(err error, skip int, context int, appPackagePrefixes []s for _, f := range stacktracer.StackTrace() { pc := uintptr(f) - 1 fn := runtime.FuncForPC(pc) + var fName string var file string var line int if fn != nil { file, line = fn.FileLine(pc) + fName = fn.Name() } else { file = "unknown" + fName = "unknown" } - frame := NewStacktraceFrame(pc, file, line, context, appPackagePrefixes) + frame := NewStacktraceFrame(pc, fName, file, line, context, appPackagePrefixes) if frame != nil { frames = append([]*StacktraceFrame{frame}, frames...) } @@ -89,14 +92,27 @@ func GetOrNewStacktrace(err error, skip int, context int, appPackagePrefixes []s // be considered "in app". func NewStacktrace(skip int, context int, appPackagePrefixes []string) *Stacktrace { var frames []*StacktraceFrame - for i := 1 + skip; ; i++ { - pc, file, line, ok := runtime.Caller(i) - if !ok { - break + + callerPcs := make([]uintptr, 100) + numCallers := runtime.Callers(skip+2, callerPcs) + + // If there are no callers, the entire stacktrace is nil + if numCallers == 0 { + return nil + } + + callersFrames := runtime.CallersFrames(callerPcs) + + for { + fr, more := callersFrames.Next() + if fr.Func != nil { + frame := NewStacktraceFrame(fr.PC, fr.Function, fr.File, fr.Line, context, appPackagePrefixes) + if frame != nil { + frames = append(frames, frame) + } } - frame := NewStacktraceFrame(pc, file, line, context, appPackagePrefixes) - if frame != nil { - frames = append(frames, frame) + if !more { + break } } // If there are no frames, the entire stacktrace is nil @@ -122,9 +138,9 @@ func NewStacktrace(skip int, context int, appPackagePrefixes []string) *Stacktra // // appPackagePrefixes is a list of prefixes used to check whether a package should // be considered "in app". -func NewStacktraceFrame(pc uintptr, file string, line, context int, appPackagePrefixes []string) *StacktraceFrame { +func NewStacktraceFrame(pc uintptr, fName, file string, line, context int, appPackagePrefixes []string) *StacktraceFrame { frame := &StacktraceFrame{AbsolutePath: file, Filename: trimPath(file), Lineno: line, InApp: false} - frame.Module, frame.Function = functionName(pc) + frame.Module, frame.Function = functionName(fName) // `runtime.goexit` is effectively a placeholder that comes from // runtime/asm_amd64.s and is meaningless. @@ -143,7 +159,7 @@ func NewStacktraceFrame(pc uintptr, file string, line, context int, appPackagePr } if context > 0 { - contextLines, lineIdx := fileContext(file, line, context) + contextLines, lineIdx := sourceCodeLoader.Load(file, line, context) if len(contextLines) > 0 { for i, line := range contextLines { switch { @@ -157,7 +173,7 @@ func NewStacktraceFrame(pc uintptr, file string, line, context int, appPackagePr } } } else if context == -1 { - contextLine, _ := fileContext(file, line, 0) + contextLine, _ := sourceCodeLoader.Load(file, line, 0) if len(contextLine) > 0 { frame.ContextLine = string(contextLine[0]) } @@ -166,12 +182,8 @@ func NewStacktraceFrame(pc uintptr, file string, line, context int, appPackagePr } // Retrieve the name of the package and function containing the PC. -func functionName(pc uintptr) (pack string, name string) { - fn := runtime.FuncForPC(pc) - if fn == nil { - return - } - name = fn.Name() +func functionName(fName string) (pack string, name string) { + name = fName // We get this: // runtime/debug.*T·ptrmethod // and want this: @@ -185,24 +197,36 @@ func functionName(pc uintptr) (pack string, name string) { return } -var fileCacheLock sync.Mutex -var fileCache = make(map[string][][]byte) +type SourceCodeLoader interface { + Load(filename string, line, context int) ([][]byte, int) +} -func fileContext(filename string, line, context int) ([][]byte, int) { - fileCacheLock.Lock() - defer fileCacheLock.Unlock() - lines, ok := fileCache[filename] +var sourceCodeLoader SourceCodeLoader = &fsLoader{cache: make(map[string][][]byte)} + +func SetSourceCodeLoader(loader SourceCodeLoader) { + sourceCodeLoader = loader +} + +type fsLoader struct { + mu sync.Mutex + cache map[string][][]byte +} + +func (fs *fsLoader) Load(filename string, line, context int) ([][]byte, int) { + fs.mu.Lock() + defer fs.mu.Unlock() + lines, ok := fs.cache[filename] if !ok { data, err := ioutil.ReadFile(filename) if err != nil { // cache errors as nil slice: code below handles it correctly // otherwise when missing the source or running as a different user, we try // reading the file on each error which is unnecessary - fileCache[filename] = nil + fs.cache[filename] = nil return nil, 0 } lines = bytes.Split(data, []byte{'\n'}) - fileCache[filename] = lines + fs.cache[filename] = lines } if lines == nil { diff --git a/vendor/github.com/getsentry/sentry-go/.craft.yml b/vendor/github.com/getsentry/sentry-go/.craft.yml new file mode 100644 index 00000000..4af175ad --- /dev/null +++ b/vendor/github.com/getsentry/sentry-go/.craft.yml @@ -0,0 +1,11 @@ +minVersion: 0.23.1 +changelogPolicy: simple +artifactProvider: + name: none +targets: + - name: github + includeNames: /none/ + tagPrefix: v + - name: registry + sdks: + github:getsentry/sentry-go: diff --git a/vendor/github.com/getsentry/sentry-go/.gitattributes b/vendor/github.com/getsentry/sentry-go/.gitattributes new file mode 100644 index 00000000..bccfeeab --- /dev/null +++ b/vendor/github.com/getsentry/sentry-go/.gitattributes @@ -0,0 +1,5 @@ +# Tell Git to use LF for line endings on all platforms. +# Required to have correct test data on Windows. +# https://github.com/mvdan/github-actions-golang#caveats +# https://github.com/actions/checkout/issues/135#issuecomment-613361104 +* text eol=lf diff --git a/vendor/github.com/getsentry/sentry-go/.gitignore b/vendor/github.com/getsentry/sentry-go/.gitignore new file mode 100644 index 00000000..5d0e90c5 --- /dev/null +++ b/vendor/github.com/getsentry/sentry-go/.gitignore @@ -0,0 +1,10 @@ +coverage.txt + +# Just my personal way of tracking stuff — Kamil +FIXME.md +TODO.md +!NOTES.md + +# IDE system files +.idea +.vscode diff --git a/vendor/github.com/getsentry/sentry-go/.golangci.yml b/vendor/github.com/getsentry/sentry-go/.golangci.yml new file mode 100644 index 00000000..0deb9c0e --- /dev/null +++ b/vendor/github.com/getsentry/sentry-go/.golangci.yml @@ -0,0 +1,49 @@ +linters: + disable-all: true + enable: + - bodyclose + - deadcode + - depguard + - dogsled + - dupl + - errcheck + - exportloopref + - gochecknoinits + - goconst + - gocritic + - gocyclo + - godot + - gofmt + - goimports + - gosec + - gosimple + - govet + - ineffassign + - misspell + - nakedret + - prealloc + - revive + - staticcheck + - structcheck + - typecheck + - unconvert + - unparam + - unused + - varcheck + - whitespace +issues: + exclude-rules: + - path: _test\.go + linters: + - prealloc + - path: _test\.go + text: "G306:" + linters: + - gosec + - path: errors_test\.go + linters: + - unused + - path: http/example_test\.go + linters: + - errcheck + - bodyclose diff --git a/vendor/github.com/getsentry/sentry-go/CHANGELOG.md b/vendor/github.com/getsentry/sentry-go/CHANGELOG.md new file mode 100644 index 00000000..ae9a6c29 --- /dev/null +++ b/vendor/github.com/getsentry/sentry-go/CHANGELOG.md @@ -0,0 +1,400 @@ +# Changelog + +## 0.16.0 + +The Sentry SDK team is happy to announce the immediate availability of Sentry Go SDK v0.16.0. +Due to ongoing work towards a stable API for `v1.0.0`, we sadly had to include **two breaking changes** in this release. + +### Breaking Changes + +- Add `EnableTracing`, a boolean option flag to enable performance monitoring (`false` by default). + - If you're using `TracesSampleRate` or `TracesSampler`, this option is **required** to enable performance monitoring. + + ```go + sentry.Init(sentry.ClientOptions{ + EnableTracing: true, + TracesSampleRate: 1.0, + }) + ``` +- Unify TracesSampler [#498](https://github.com/getsentry/sentry-go/pull/498) + - `TracesSampler` was changed to a callback that must return a `float64` between `0.0` and `1.0`. + + For example, you can apply a sample rate of `1.0` (100%) to all `/api` transactions, and a sample rate of `0.5` (50%) to all other transactions. + You can read more about this in our [SDK docs](https://docs.sentry.io/platforms/go/configuration/filtering/#using-sampling-to-filter-transaction-events). + + ```go + sentry.Init(sentry.ClientOptions{ + TracesSampler: sentry.TracesSampler(func(ctx sentry.SamplingContext) float64 { + hub := sentry.GetHubFromContext(ctx.Span.Context()) + name := hub.Scope().Transaction() + + if strings.HasPrefix(name, "GET /api") { + return 1.0 + } + + return 0.5 + }), + } + ``` + +### Features + +- Send errors logged with [Logrus](https://github.com/sirupsen/logrus) to Sentry. + - Have a look at our [logrus examples](https://github.com/getsentry/sentry-go/blob/master/example/logrus/main.go) on how to use the integration. +- Add support for Dynamic Sampling [#491](https://github.com/getsentry/sentry-go/pull/491) + - You can read more about Dynamic Sampling in our [product docs](https://docs.sentry.io/product/data-management-settings/dynamic-sampling/). +- Add detailed logging about the reason transactions are being dropped. + - You can enable SDK logging via `sentry.ClientOptions.Debug: true`. + +### Bug Fixes + +- Do not clone the hub when calling `StartTransaction` [#505](https://github.com/getsentry/sentry-go/pull/505) + - Fixes [#502](https://github.com/getsentry/sentry-go/issues/502) + +## 0.15.0 + +- fix: Scope values should not override Event values (#446) +- feat: Make maximum amount of spans configurable (#460) +- feat: Add a method to start a transaction (#482) +- feat: Extend User interface by adding Data, Name and Segment (#483) +- feat: Add ClientOptions.SendDefaultPII (#485) + +## 0.14.0 + +- feat: Add function to continue from trace string (#434) +- feat: Add `max-depth` options (#428) +- *[breaking]* ref: Use a `Context` type mapping to a `map[string]interface{}` for all event contexts (#444) +- *[breaking]* ref: Replace deprecated `ioutil` pkg with `os` & `io` (#454) +- ref: Optimize `stacktrace.go` from size and speed (#467) +- ci: Test against `go1.19` and `go1.18`, drop `go1.16` and `go1.15` support (#432, #477) +- deps: Dependency update to fix CVEs (#462, #464, #477) + +_NOTE:_ This version drops support for Go 1.16 and Go 1.15. The currently supported Go versions are the last 3 stable releases: 1.19, 1.18 and 1.17. + +## v0.13.0 + +- ref: Change DSN ProjectID to be a string (#420) +- fix: When extracting PCs from stack frames, try the `PC` field (#393) +- build: Bump gin-gonic/gin from v1.4.0 to v1.7.7 (#412) +- build: Bump Go version in go.mod (#410) +- ci: Bump golangci-lint version in GH workflow (#419) +- ci: Update GraphQL config with appropriate permissions (#417) +- ci: ci: Add craft release automation (#422) + +## v0.12.0 + +- feat: Automatic Release detection (#363, #369, #386, #400) +- fix: Do not change Hub.lastEventID for transactions (#379) +- fix: Do not clear LastEventID when events are dropped (#382) +- Updates to documentation (#366, #385) + +_NOTE:_ +This version drops support for Go 1.14, however no changes have been made that would make the SDK not work with Go 1.14. The currently supported Go versions are the last 3 stable releases: 1.15, 1.16 and 1.17. +There are two behavior changes related to `LastEventID`, both of which were intended to align the behavior of the Sentry Go SDK with other Sentry SDKs. +The new [automatic release detection feature](https://github.com/getsentry/sentry-go/issues/335) makes it easier to use Sentry and separate events per release without requiring extra work from users. We intend to improve this functionality in a future release by utilizing information that will be available in runtime starting with Go 1.18. The tracking issue is [#401](https://github.com/getsentry/sentry-go/issues/401). + +## v0.11.0 + +- feat(transports): Category-based Rate Limiting ([#354](https://github.com/getsentry/sentry-go/pull/354)) +- feat(transports): Report User-Agent identifying SDK ([#357](https://github.com/getsentry/sentry-go/pull/357)) +- fix(scope): Include event processors in clone ([#349](https://github.com/getsentry/sentry-go/pull/349)) +- Improvements to `go doc` documentation ([#344](https://github.com/getsentry/sentry-go/pull/344), [#350](https://github.com/getsentry/sentry-go/pull/350), [#351](https://github.com/getsentry/sentry-go/pull/351)) +- Miscellaneous changes to our testing infrastructure with GitHub Actions + ([57123a40](https://github.com/getsentry/sentry-go/commit/57123a409be55f61b1d5a6da93c176c55a399ad0), [#128](https://github.com/getsentry/sentry-go/pull/128), [#338](https://github.com/getsentry/sentry-go/pull/338), [#345](https://github.com/getsentry/sentry-go/pull/345), [#346](https://github.com/getsentry/sentry-go/pull/346), [#352](https://github.com/getsentry/sentry-go/pull/352), [#353](https://github.com/getsentry/sentry-go/pull/353), [#355](https://github.com/getsentry/sentry-go/pull/355)) + +_NOTE:_ +This version drops support for Go 1.13. The currently supported Go versions are the last 3 stable releases: 1.14, 1.15 and 1.16. +Users of the tracing functionality (`StartSpan`, etc) should upgrade to this version to benefit from separate rate limits for errors and transactions. +There are no breaking changes and upgrading should be a smooth experience for all users. + +## v0.10.0 + +- feat: Debug connection reuse (#323) +- fix: Send root span data as `Event.Extra` (#329) +- fix: Do not double sample transactions (#328) +- fix: Do not override trace context of transactions (#327) +- fix: Drain and close API response bodies (#322) +- ci: Run tests against Go tip (#319) +- ci: Move away from Travis in favor of GitHub Actions (#314) (#321) + +## v0.9.0 + +- feat: Initial tracing and performance monitoring support (#285) +- doc: Revamp sentryhttp documentation (#304) +- fix: Hub.PopScope never empties the scope stack (#300) +- ref: Report Event.Timestamp in local time (#299) +- ref: Report Breadcrumb.Timestamp in local time (#299) + +_NOTE:_ +This version introduces support for [Sentry's Performance Monitoring](https://docs.sentry.io/platforms/go/performance/). +The new tracing capabilities are beta, and we plan to expand them on future versions. Feedback is welcome, please open new issues on GitHub. +The `sentryhttp` package got better API docs, an [updated usage example](https://github.com/getsentry/sentry-go/tree/master/example/http) and support for creating automatic transactions as part of Performance Monitoring. + +## v0.8.0 + +- build: Bump required version of Iris (#296) +- fix: avoid unnecessary allocation in Client.processEvent (#293) +- doc: Remove deprecation of sentryhttp.HandleFunc (#284) +- ref: Update sentryhttp example (#283) +- doc: Improve documentation of sentryhttp package (#282) +- doc: Clarify SampleRate documentation (#279) +- fix: Remove RawStacktrace (#278) +- docs: Add example of custom HTTP transport +- ci: Test against go1.15, drop go1.12 support (#271) + +_NOTE:_ +This version comes with a few updates. Some examples and documentation have been +improved. We've bumped the supported version of the Iris framework to avoid +LGPL-licensed modules in the module dependency graph. +The `Exception.RawStacktrace` and `Thread.RawStacktrace` fields have been +removed to conform to Sentry's ingestion protocol, only `Exception.Stacktrace` +and `Thread.Stacktrace` should appear in user code. + +## v0.7.0 + +- feat: Include original error when event cannot be encoded as JSON (#258) +- feat: Use Hub from request context when available (#217, #259) +- feat: Extract stack frames from golang.org/x/xerrors (#262) +- feat: Make Environment Integration preserve existing context data (#261) +- feat: Recover and RecoverWithContext with arbitrary types (#268) +- feat: Report bad usage of CaptureMessage and CaptureEvent (#269) +- feat: Send debug logging to stderr by default (#266) +- feat: Several improvements to documentation (#223, #245, #250, #265) +- feat: Example of Recover followed by panic (#241, #247) +- feat: Add Transactions and Spans (to support OpenTelemetry Sentry Exporter) (#235, #243, #254) +- fix: Set either Frame.Filename or Frame.AbsPath (#233) +- fix: Clone requestBody to new Scope (#244) +- fix: Synchronize access and mutation of Hub.lastEventID (#264) +- fix: Avoid repeated syscalls in prepareEvent (#256) +- fix: Do not allocate new RNG for every event (#256) +- fix: Remove stale replace directive in go.mod (#255) +- fix(http): Deprecate HandleFunc, remove duplication (#260) + +_NOTE:_ +This version comes packed with several fixes and improvements and no breaking +changes. +Notably, there is a change in how the SDK reports file names in stack traces +that should resolve any ambiguity when looking at stack traces and using the +Suspect Commits feature. +We recommend all users to upgrade. + +## v0.6.1 + +- fix: Use NewEvent to init Event struct (#220) + +_NOTE:_ +A change introduced in v0.6.0 with the intent of avoiding allocations made a +pattern used in official examples break in certain circumstances (attempting +to write to a nil map). +This release reverts the change such that maps in the Event struct are always +allocated. + +## v0.6.0 + +- feat: Read module dependencies from runtime/debug (#199) +- feat: Support chained errors using Unwrap (#206) +- feat: Report chain of errors when available (#185) +- **[breaking]** fix: Accept http.RoundTripper to customize transport (#205) + Before the SDK accepted a concrete value of type `*http.Transport` in + `ClientOptions`, now it accepts any value implementing the `http.RoundTripper` + interface. Note that `*http.Transport` implements `http.RoundTripper`, so most + code bases will continue to work unchanged. + Users of custom transport gain the ability to pass in other implementations of + `http.RoundTripper` and may be able to simplify their code bases. +- fix: Do not panic when scope event processor drops event (#192) +- **[breaking]** fix: Use time.Time for timestamps (#191) + Users of sentry-go typically do not need to manipulate timestamps manually. + For those who do, the field type changed from `int64` to `time.Time`, which + should be more convenient to use. The recommended way to get the current time + is `time.Now().UTC()`. +- fix: Report usage error including stack trace (#189) +- feat: Add Exception.ThreadID field (#183) +- ci: Test against Go 1.14, drop 1.11 (#170) +- feat: Limit reading bytes from request bodies (#168) +- **[breaking]** fix: Rename fasthttp integration package sentryhttp => sentryfasthttp + The current recommendation is to use a named import, in which case existing + code should not require any change: + ```go + package main + + import ( + "fmt" + + "github.com/getsentry/sentry-go" + sentryfasthttp "github.com/getsentry/sentry-go/fasthttp" + "github.com/valyala/fasthttp" + ) + ``` + +_NOTE:_ +This version includes some new features and a few breaking changes, none of +which should pose troubles with upgrading. Most code bases should be able to +upgrade without any changes. + +## v0.5.1 + +- fix: Ignore err.Cause() when it is nil (#160) + +## v0.5.0 + +- fix: Synchronize access to HTTPTransport.disabledUntil (#158) +- docs: Update Flush documentation (#153) +- fix: HTTPTransport.Flush panic and data race (#140) + +_NOTE:_ +This version changes the implementation of the default transport, modifying the +behavior of `sentry.Flush`. The previous behavior was to wait until there were +no buffered events; new concurrent events kept `Flush` from returning. The new +behavior is to wait until the last event prior to the call to `Flush` has been +sent or the timeout; new concurrent events have no effect. The new behavior is +inline with the [Unified API +Guidelines](https://docs.sentry.io/development/sdk-dev/unified-api/). + +We have updated the documentation and examples to clarify that `Flush` is meant +to be called typically only once before program termination, to wait for +in-flight events to be sent to Sentry. Calling `Flush` after every event is not +recommended, as it introduces unnecessary latency to the surrounding function. +Please verify the usage of `sentry.Flush` in your code base. + +## v0.4.0 + +- fix(stacktrace): Correctly report package names (#127) +- fix(stacktrace): Do not rely on AbsPath of files (#123) +- build: Require github.com/ugorji/go@v1.1.7 (#110) +- fix: Correctly store last event id (#99) +- fix: Include request body in event payload (#94) +- build: Reset go.mod version to 1.11 (#109) +- fix: Eliminate data race in modules integration (#105) +- feat: Add support for path prefixes in the DSN (#102) +- feat: Add HTTPClient option (#86) +- feat: Extract correct type and value from top-most error (#85) +- feat: Check for broken pipe errors in Gin integration (#82) +- fix: Client.CaptureMessage accept nil EventModifier (#72) + +## v0.3.1 + +- feat: Send extra information exposed by the Go runtime (#76) +- fix: Handle new lines in module integration (#65) +- fix: Make sure that cache is locked when updating for contextifyFramesIntegration +- ref: Update Iris integration and example to version 12 +- misc: Remove indirect dependencies in order to move them to separate go.mod files + +## v0.3.0 + +- feat: Retry event marshaling without contextual data if the first pass fails +- fix: Include `url.Parse` error in `DsnParseError` +- fix: Make more `Scope` methods safe for concurrency +- fix: Synchronize concurrent access to `Hub.client` +- ref: Remove mutex from `Scope` exported API +- ref: Remove mutex from `Hub` exported API +- ref: Compile regexps for `filterFrames` only once +- ref: Change `SampleRate` type to `float64` +- doc: `Scope.Clear` not safe for concurrent use +- ci: Test sentry-go with `go1.13`, drop `go1.10` + +_NOTE:_ +This version removes some of the internal APIs that landed publicly (namely `Hub/Scope` mutex structs) and may require (but shouldn't) some changes to your code. +It's not done through major version update, as we are still in `0.x` stage. + +## v0.2.1 + +- fix: Run `Contextify` integration on `Threads` as well + +## v0.2.0 + +- feat: Add `SetTransaction()` method on the `Scope` +- feat: `fasthttp` framework support with `sentryfasthttp` package +- fix: Add `RWMutex` locks to internal `Hub` and `Scope` changes + +## v0.1.3 + +- feat: Move frames context reading into `contextifyFramesIntegration` (#28) + +_NOTE:_ +In case of any performance issues due to source contexts IO, you can let us know and turn off the integration in the meantime with: + +```go +sentry.Init(sentry.ClientOptions{ + Integrations: func(integrations []sentry.Integration) []sentry.Integration { + var filteredIntegrations []sentry.Integration + for _, integration := range integrations { + if integration.Name() == "ContextifyFrames" { + continue + } + filteredIntegrations = append(filteredIntegrations, integration) + } + return filteredIntegrations + }, +}) +``` + +## v0.1.2 + +- feat: Better source code location resolution and more useful inapp frames (#26) +- feat: Use `noopTransport` when no `Dsn` provided (#27) +- ref: Allow empty `Dsn` instead of returning an error (#22) +- fix: Use `NewScope` instead of literal struct inside a `scope.Clear` call (#24) +- fix: Add to `WaitGroup` before the request is put inside a buffer (#25) + +## v0.1.1 + +- fix: Check for initialized `Client` in `AddBreadcrumbs` (#20) +- build: Bump version when releasing with Craft (#19) + +## v0.1.0 + +- First stable release! \o/ + +## v0.0.1-beta.5 + +- feat: **[breaking]** Add `NewHTTPTransport` and `NewHTTPSyncTransport` which accepts all transport options +- feat: New `HTTPSyncTransport` that blocks after each call +- feat: New `Echo` integration +- ref: **[breaking]** Remove `BufferSize` option from `ClientOptions` and move it to `HTTPTransport` instead +- ref: Export default `HTTPTransport` +- ref: Export `net/http` integration handler +- ref: Set `Request` instantly in the package handlers, not in `recoverWithSentry` so it can be accessed later on +- ci: Add craft config + +## v0.0.1-beta.4 + +- feat: `IgnoreErrors` client option and corresponding integration +- ref: Reworked `net/http` integration, wrote better example and complete readme +- ref: Reworked `Gin` integration, wrote better example and complete readme +- ref: Reworked `Iris` integration, wrote better example and complete readme +- ref: Reworked `Negroni` integration, wrote better example and complete readme +- ref: Reworked `Martini` integration, wrote better example and complete readme +- ref: Remove `Handle()` from frameworks handlers and return it directly from New + +## v0.0.1-beta.3 + +- feat: `Iris` framework support with `sentryiris` package +- feat: `Gin` framework support with `sentrygin` package +- feat: `Martini` framework support with `sentrymartini` package +- feat: `Negroni` framework support with `sentrynegroni` package +- feat: Add `Hub.Clone()` for easier frameworks integration +- feat: Return `EventID` from `Recovery` methods +- feat: Add `NewScope` and `NewEvent` functions and use them in the whole codebase +- feat: Add `AddEventProcessor` to the `Client` +- fix: Operate on requests body copy instead of the original +- ref: Try to read source files from the root directory, based on the filename as well, to make it work on AWS Lambda +- ref: Remove `gocertifi` dependence and document how to provide your own certificates +- ref: **[breaking]** Remove `Decorate` and `DecorateFunc` methods in favor of `sentryhttp` package +- ref: **[breaking]** Allow for integrations to live on the client, by passing client instance in `SetupOnce` method +- ref: **[breaking]** Remove `GetIntegration` from the `Hub` +- ref: **[breaking]** Remove `GlobalEventProcessors` getter from the public API + +## v0.0.1-beta.2 + +- feat: Add `AttachStacktrace` client option to include stacktrace for messages +- feat: Add `BufferSize` client option to configure transport buffer size +- feat: Add `SetRequest` method on a `Scope` to control `Request` context data +- feat: Add `FromHTTPRequest` for `Request` type for easier extraction +- ref: Extract `Request` information more accurately +- fix: Attach `ServerName`, `Release`, `Dist`, `Environment` options to the event +- fix: Don't log events dropped due to full transport buffer as sent +- fix: Don't panic and create an appropriate event when called `CaptureException` or `Recover` with `nil` value + +## v0.0.1-beta + +- Initial release diff --git a/vendor/github.com/getsentry/sentry-go/CONTRIBUTING.md b/vendor/github.com/getsentry/sentry-go/CONTRIBUTING.md new file mode 100644 index 00000000..094f5211 --- /dev/null +++ b/vendor/github.com/getsentry/sentry-go/CONTRIBUTING.md @@ -0,0 +1,96 @@ +# Contributing to sentry-go + +Hey, thank you if you're reading this, we welcome your contribution! + +## Sending a Pull Request + +Please help us save time when reviewing your PR by following this simple +process: + +1. Is your PR a simple typo fix? Read no further, **click that green "Create + pull request" button**! + +2. For more complex PRs that involve behavior changes or new APIs, please + consider [opening an **issue**][new-issue] describing the problem you're + trying to solve if there's not one already. + + A PR is often one specific solution to a problem and sometimes talking about + the problem unfolds new possible solutions. Remember we will be responsible + for maintaining the changes later. + +3. Fixing a bug and changing a behavior? Please add automated tests to prevent + future regression. + +4. Practice writing good commit messages. We have [commit + guidelines][commit-guide]. + +5. We have [guidelines for PR submitters][pr-guide]. A short summary: + + - Good PR descriptions are very helpful and most of the time they include + **why** something is done and why done in this particular way. Also list + other possible solutions that were considered and discarded. + - Be your own first reviewer. Make sure your code compiles and passes the + existing tests. + +[new-issue]: https://github.com/getsentry/sentry-go/issues/new/choose +[commit-guide]: https://develop.sentry.dev/code-review/#commit-guidelines +[pr-guide]: https://develop.sentry.dev/code-review/#guidelines-for-submitters + +Please also read through our [SDK Development docs](https://develop.sentry.dev/sdk/). +It contains information about SDK features, expected payloads and best practices for +contributing to Sentry SDKs. + +## Community + +The public-facing channels for support and development of Sentry SDKs can be found on [Discord](https://discord.gg/Ww9hbqr). + +## Testing + +```console +$ go test +``` + +### Watch mode + +Use: https://github.com/cespare/reflex + +```console +$ reflex -g '*.go' -d "none" -- sh -c 'printf "\n"; go test' +``` + +### With data race detection + +```console +$ go test -race +``` + +### Coverage + +```console +$ go test -race -coverprofile=coverage.txt -covermode=atomic && go tool cover -html coverage.txt +``` + +## Linting + +```console +$ golangci-lint run +``` + +## Release + +1. Update `CHANGELOG.md` with new version in `vX.X.X` format title and list of changes. + + The command below can be used to get a list of changes since the last tag, with the format used in `CHANGELOG.md`: + + ```console + $ git log --no-merges --format=%s $(git describe --abbrev=0).. | sed 's/^/- /' + ``` + +2. Commit with `misc: vX.X.X changelog` commit message and push to `master`. + +3. Let [`craft`](https://github.com/getsentry/craft) do the rest: + + ```console + $ craft prepare X.X.X + $ craft publish X.X.X + ``` diff --git a/vendor/github.com/getsentry/sentry-go/LICENSE b/vendor/github.com/getsentry/sentry-go/LICENSE new file mode 100644 index 00000000..3e66f28d --- /dev/null +++ b/vendor/github.com/getsentry/sentry-go/LICENSE @@ -0,0 +1,9 @@ +Copyright (c) 2019 Sentry (https://sentry.io) and individual contributors. +All rights reserved. + +Redistribution and use in source and binary forms, with or without modification, are permitted provided that the following conditions are met: + +* Redistributions of source code must retain the above copyright notice, this list of conditions and the following disclaimer. +* Redistributions in binary form must reproduce the above copyright notice, this list of conditions and the following disclaimer in the documentation and/or other materials provided with the distribution. + +THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS "AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT HOLDER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. diff --git a/vendor/github.com/getsentry/sentry-go/MIGRATION.md b/vendor/github.com/getsentry/sentry-go/MIGRATION.md new file mode 100644 index 00000000..2c30d628 --- /dev/null +++ b/vendor/github.com/getsentry/sentry-go/MIGRATION.md @@ -0,0 +1,3 @@ +# `raven-go` to `sentry-go` Migration Guide + +A [`raven-go` to `sentry-go` migration guide](https://docs.sentry.io/platforms/go/migration/) is available at the official Sentry documentation site. diff --git a/vendor/github.com/getsentry/sentry-go/README.md b/vendor/github.com/getsentry/sentry-go/README.md new file mode 100644 index 00000000..7bc1c705 --- /dev/null +++ b/vendor/github.com/getsentry/sentry-go/README.md @@ -0,0 +1,105 @@ +

+ + + + + Sentry + + +

+ +# Official Sentry SDK for Go + +[![Build Status](https://github.com/getsentry/sentry-go/workflows/go-workflow/badge.svg)](https://github.com/getsentry/sentry-go/actions?query=workflow%3Ago-workflow) +[![Go Report Card](https://goreportcard.com/badge/github.com/getsentry/sentry-go)](https://goreportcard.com/report/github.com/getsentry/sentry-go) +[![Discord](https://img.shields.io/discord/621778831602221064)](https://discord.gg/Ww9hbqr) +[![GoDoc](https://godoc.org/github.com/getsentry/sentry-go?status.svg)](https://godoc.org/github.com/getsentry/sentry-go) +[![go.dev](https://img.shields.io/badge/go.dev-pkg-007d9c.svg?style=flat)](https://pkg.go.dev/github.com/getsentry/sentry-go) + +`sentry-go` provides a Sentry client implementation for the Go programming +language. This is the next generation of the Go SDK for [Sentry](https://sentry.io/), +intended to replace the `raven-go` package. + +> Looking for the old `raven-go` SDK documentation? See the Legacy client section [here](https://docs.sentry.io/clients/go/). +> If you want to start using `sentry-go` instead, check out the [migration guide](https://docs.sentry.io/platforms/go/migration/). + +## Requirements + +The only requirement is a Go compiler. + +We verify this package against the 3 most recent releases of Go. Those are the +supported versions. The exact versions are defined in +[`GitHub workflow`](.github/workflows/test.yml). + +In addition, we run tests against the current master branch of the Go toolchain, +though support for this configuration is best-effort. + +## Installation + +`sentry-go` can be installed like any other Go library through `go get`: + +```console +$ go get github.com/getsentry/sentry-go@latest +``` + +Check out the [list of released versions](https://pkg.go.dev/github.com/getsentry/sentry-go?tab=versions). + +## Configuration + +To use `sentry-go`, you’ll need to import the `sentry-go` package and initialize +it with your DSN and other [options](https://pkg.go.dev/github.com/getsentry/sentry-go#ClientOptions). + +If not specified in the SDK initialization, the +[DSN](https://docs.sentry.io/product/sentry-basics/dsn-explainer/), +[Release](https://docs.sentry.io/product/releases/) and +[Environment](https://docs.sentry.io/product/sentry-basics/environments/) +are read from the environment variables `SENTRY_DSN`, `SENTRY_RELEASE` and +`SENTRY_ENVIRONMENT`, respectively. + +More on this in the [Configuration section of the official Sentry Go SDK documentation](https://docs.sentry.io/platforms/go/configuration/). + +## Usage + +The SDK supports reporting errors and tracking application performance. + +To get started, have a look at one of our [examples](example/): +- [Basic error instrumentation](example/basic/main.go) +- [Error and tracing for HTTP servers](example/http/main.go) + +We also provide a [complete API reference](https://pkg.go.dev/github.com/getsentry/sentry-go). + +For more detailed information about how to get the most out of `sentry-go`, +checkout the official documentation: + +- [Sentry Go SDK documentation](https://docs.sentry.io/platforms/go/) +- Guides: + - [net/http](https://docs.sentry.io/platforms/go/guides/http/) + - [echo](https://docs.sentry.io/platforms/go/guides/echo/) + - [fasthttp](https://docs.sentry.io/platforms/go/guides/fasthttp/) + - [gin](https://docs.sentry.io/platforms/go/guides/gin/) + - [iris](https://docs.sentry.io/platforms/go/guides/iris/) + - [martini](https://docs.sentry.io/platforms/go/guides/martini/) + - [negroni](https://docs.sentry.io/platforms/go/guides/negroni/) + +## Resources + +- [Bug Tracker](https://github.com/getsentry/sentry-go/issues) +- [GitHub Project](https://github.com/getsentry/sentry-go) +- [![GoDoc](https://godoc.org/github.com/getsentry/sentry-go?status.svg)](https://godoc.org/github.com/getsentry/sentry-go) +- [![go.dev](https://img.shields.io/badge/go.dev-pkg-007d9c.svg?style=flat)](https://pkg.go.dev/github.com/getsentry/sentry-go) +- [![Documentation](https://img.shields.io/badge/documentation-sentry.io-green.svg)](https://docs.sentry.io/platforms/go/) +- [![Discussions](https://img.shields.io/github/discussions/getsentry/sentry-go.svg)](https://github.com/getsentry/sentry-go/discussions) +- [![Discord](https://img.shields.io/discord/621778831602221064)](https://discord.gg/Ww9hbqr) +- [![Stack Overflow](https://img.shields.io/badge/stack%20overflow-sentry-green.svg)](http://stackoverflow.com/questions/tagged/sentry) +- [![Twitter Follow](https://img.shields.io/twitter/follow/getsentry?label=getsentry&style=social)](https://twitter.com/intent/follow?screen_name=getsentry) + +## License + +Licensed under +[The 2-Clause BSD License](https://opensource.org/licenses/BSD-2-Clause), see +[`LICENSE`](LICENSE). + +## Community + +Join Sentry's [`#go` channel on Discord](https://discord.gg/Ww9hbqr) to get +involved and help us improve the SDK! diff --git a/vendor/github.com/getsentry/sentry-go/client.go b/vendor/github.com/getsentry/sentry-go/client.go new file mode 100644 index 00000000..2c580b03 --- /dev/null +++ b/vendor/github.com/getsentry/sentry-go/client.go @@ -0,0 +1,682 @@ +package sentry + +import ( + "context" + "crypto/x509" + "fmt" + "io" + "log" + "math/rand" + "net/http" + "os" + "reflect" + "sort" + "strings" + "sync" + "time" + + "github.com/getsentry/sentry-go/internal/debug" +) + +// maxErrorDepth is the maximum number of errors reported in a chain of errors. +// This protects the SDK from an arbitrarily long chain of wrapped errors. +// +// An additional consideration is that arguably reporting a long chain of errors +// is of little use when debugging production errors with Sentry. The Sentry UI +// is not optimized for long chains either. The top-level error together with a +// stack trace is often the most useful information. +const maxErrorDepth = 10 + +// defaultMaxSpans limits the default number of recorded spans per transaction. The limit is +// meant to bound memory usage and prevent too large transaction events that +// would be rejected by Sentry. +const defaultMaxSpans = 1000 + +// hostname is the host name reported by the kernel. It is precomputed once to +// avoid syscalls when capturing events. +// +// The error is ignored because retrieving the host name is best-effort. If the +// error is non-nil, there is nothing to do other than retrying. We choose not +// to retry for now. +var hostname, _ = os.Hostname() + +// lockedRand is a random number generator safe for concurrent use. Its API is +// intentionally limited and it is not meant as a full replacement for a +// rand.Rand. +type lockedRand struct { + mu sync.Mutex + r *rand.Rand +} + +// Float64 returns a pseudo-random number in [0.0,1.0). +func (r *lockedRand) Float64() float64 { + r.mu.Lock() + defer r.mu.Unlock() + return r.r.Float64() +} + +// rng is the internal random number generator. +// +// We do not use the global functions from math/rand because, while they are +// safe for concurrent use, any package in a build could change the seed and +// affect the generated numbers, for instance making them deterministic. On the +// other hand, the source returned from rand.NewSource is not safe for +// concurrent use, so we need to couple its use with a sync.Mutex. +var rng = &lockedRand{ + // #nosec G404 -- We are fine using transparent, non-secure value here. + r: rand.New(rand.NewSource(time.Now().UnixNano())), +} + +// usageError is used to report to Sentry an SDK usage error. +// +// It is not exported because it is never returned by any function or method in +// the exported API. +type usageError struct { + error +} + +// Logger is an instance of log.Logger that is use to provide debug information about running Sentry Client +// can be enabled by either using Logger.SetOutput directly or with Debug client option. +var Logger = log.New(io.Discard, "[Sentry] ", log.LstdFlags) + +// EventProcessor is a function that processes an event. +// Event processors are used to change an event before it is sent to Sentry. +type EventProcessor func(event *Event, hint *EventHint) *Event + +// EventModifier is the interface that wraps the ApplyToEvent method. +// +// ApplyToEvent changes an event based on external data and/or +// an event hint. +type EventModifier interface { + ApplyToEvent(event *Event, hint *EventHint) *Event +} + +var globalEventProcessors []EventProcessor + +// AddGlobalEventProcessor adds processor to the global list of event +// processors. Global event processors apply to all events. +// +// AddGlobalEventProcessor is deprecated. Most users will prefer to initialize +// the SDK with Init and provide a ClientOptions.BeforeSend function or use +// Scope.AddEventProcessor instead. +func AddGlobalEventProcessor(processor EventProcessor) { + globalEventProcessors = append(globalEventProcessors, processor) +} + +// Integration allows for registering a functions that modify or discard captured events. +type Integration interface { + Name() string + SetupOnce(client *Client) +} + +// ClientOptions that configures a SDK Client. +type ClientOptions struct { + // The DSN to use. If the DSN is not set, the client is effectively + // disabled. + Dsn string + // In debug mode, the debug information is printed to stdout to help you + // understand what sentry is doing. + Debug bool + // Configures whether SDK should generate and attach stacktraces to pure + // capture message calls. + AttachStacktrace bool + // The sample rate for event submission in the range [0.0, 1.0]. By default, + // all events are sent. Thus, as a historical special case, the sample rate + // 0.0 is treated as if it was 1.0. To drop all events, set the DSN to the + // empty string. + SampleRate float64 + // Enable performance tracing. + EnableTracing bool + // The sample rate for sampling traces in the range [0.0, 1.0]. + TracesSampleRate float64 + // Used to customize the sampling of traces, overrides TracesSampleRate. + TracesSampler TracesSampler + // List of regexp strings that will be used to match against event's message + // and if applicable, caught errors type and value. + // If the match is found, then a whole event will be dropped. + IgnoreErrors []string + // If this flag is enabled, certain personally identifiable information (PII) is added by active integrations. + // By default, no such data is sent. + SendDefaultPII bool + // BeforeSend is called before error events are sent to Sentry. + // Use it to mutate the event or return nil to discard the event. + // See EventProcessor if you need to mutate transactions. + BeforeSend func(event *Event, hint *EventHint) *Event + // Before breadcrumb add callback. + BeforeBreadcrumb func(breadcrumb *Breadcrumb, hint *BreadcrumbHint) *Breadcrumb + // Integrations to be installed on the current Client, receives default + // integrations. + Integrations func([]Integration) []Integration + // io.Writer implementation that should be used with the Debug mode. + DebugWriter io.Writer + // The transport to use. Defaults to HTTPTransport. + Transport Transport + // The server name to be reported. + ServerName string + // The release to be sent with events. + // + // Some Sentry features are built around releases, and, thus, reporting + // events with a non-empty release improves the product experience. See + // https://docs.sentry.io/product/releases/. + // + // If Release is not set, the SDK will try to derive a default value + // from environment variables or the Git repository in the working + // directory. + // + // If you distribute a compiled binary, it is recommended to set the + // Release value explicitly at build time. As an example, you can use: + // + // go build -ldflags='-X main.release=VALUE' + // + // That will set the value of a predeclared variable 'release' in the + // 'main' package to 'VALUE'. Then, use that variable when initializing + // the SDK: + // + // sentry.Init(ClientOptions{Release: release}) + // + // See https://golang.org/cmd/go/ and https://golang.org/cmd/link/ for + // the official documentation of -ldflags and -X, respectively. + Release string + // The dist to be sent with events. + Dist string + // The environment to be sent with events. + Environment string + // Maximum number of breadcrumbs + // when MaxBreadcrumbs is negative then ignore breadcrumbs. + MaxBreadcrumbs int + // Maximum number of spans. + // + // See https://develop.sentry.dev/sdk/envelopes/#size-limits for size limits + // applied during event ingestion. Events that exceed these limits might get dropped. + MaxSpans int + // An optional pointer to http.Client that will be used with a default + // HTTPTransport. Using your own client will make HTTPTransport, HTTPProxy, + // HTTPSProxy and CaCerts options ignored. + HTTPClient *http.Client + // An optional pointer to http.Transport that will be used with a default + // HTTPTransport. Using your own transport will make HTTPProxy, HTTPSProxy + // and CaCerts options ignored. + HTTPTransport http.RoundTripper + // An optional HTTP proxy to use. + // This will default to the HTTP_PROXY environment variable. + HTTPProxy string + // An optional HTTPS proxy to use. + // This will default to the HTTPS_PROXY environment variable. + // HTTPS_PROXY takes precedence over HTTP_PROXY for https requests. + HTTPSProxy string + // An optional set of SSL certificates to use. + CaCerts *x509.CertPool + // MaxErrorDepth is the maximum number of errors reported in a chain of errors. + // This protects the SDK from an arbitrarily long chain of wrapped errors. + // + // An additional consideration is that arguably reporting a long chain of errors + // is of little use when debugging production errors with Sentry. The Sentry UI + // is not optimized for long chains either. The top-level error together with a + // stack trace is often the most useful information. + MaxErrorDepth int +} + +// Client is the underlying processor that is used by the main API and Hub +// instances. It must be created with NewClient. +type Client struct { + options ClientOptions + dsn *Dsn + eventProcessors []EventProcessor + integrations []Integration + // Transport is read-only. Replacing the transport of an existing client is + // not supported, create a new client instead. + Transport Transport +} + +// NewClient creates and returns an instance of Client configured using +// ClientOptions. +// +// Most users will not create clients directly. Instead, initialize the SDK with +// Init and use the package-level functions (for simple programs that run on a +// single goroutine) or hub methods (for concurrent programs, for example web +// servers). +func NewClient(options ClientOptions) (*Client, error) { + if options.Debug { + debugWriter := options.DebugWriter + if debugWriter == nil { + debugWriter = os.Stderr + } + Logger.SetOutput(debugWriter) + } + + if options.Dsn == "" { + options.Dsn = os.Getenv("SENTRY_DSN") + } + + if options.Release == "" { + options.Release = defaultRelease() + } + + if options.Environment == "" { + options.Environment = os.Getenv("SENTRY_ENVIRONMENT") + } + + if options.MaxErrorDepth == 0 { + options.MaxErrorDepth = maxErrorDepth + } + + if options.MaxSpans == 0 { + options.MaxSpans = defaultMaxSpans + } + + // SENTRYGODEBUG is a comma-separated list of key=value pairs (similar + // to GODEBUG). It is not a supported feature: recognized debug options + // may change any time. + // + // The intended public is SDK developers. It is orthogonal to + // options.Debug, which is also available for SDK users. + dbg := strings.Split(os.Getenv("SENTRYGODEBUG"), ",") + sort.Strings(dbg) + // dbgOpt returns true when the given debug option is enabled, for + // example SENTRYGODEBUG=someopt=1. + dbgOpt := func(opt string) bool { + s := opt + "=1" + return dbg[sort.SearchStrings(dbg, s)%len(dbg)] == s + } + if dbgOpt("httpdump") || dbgOpt("httptrace") { + options.HTTPTransport = &debug.Transport{ + RoundTripper: http.DefaultTransport, + Output: os.Stderr, + Dump: dbgOpt("httpdump"), + Trace: dbgOpt("httptrace"), + } + } + + var dsn *Dsn + if options.Dsn != "" { + var err error + dsn, err = NewDsn(options.Dsn) + if err != nil { + return nil, err + } + } + + client := Client{ + options: options, + dsn: dsn, + } + + client.setupTransport() + client.setupIntegrations() + + return &client, nil +} + +func (client *Client) setupTransport() { + opts := client.options + transport := opts.Transport + + if transport == nil { + if opts.Dsn == "" { + transport = new(noopTransport) + } else { + httpTransport := NewHTTPTransport() + // When tracing is enabled, use larger buffer to + // accommodate more concurrent events. + // TODO(tracing): consider using separate buffers per + // event type. + if opts.EnableTracing { + httpTransport.BufferSize = 1000 + } + transport = httpTransport + } + } + + transport.Configure(opts) + client.Transport = transport +} + +func (client *Client) setupIntegrations() { + integrations := []Integration{ + new(contextifyFramesIntegration), + new(environmentIntegration), + new(modulesIntegration), + new(ignoreErrorsIntegration), + } + + if client.options.Integrations != nil { + integrations = client.options.Integrations(integrations) + } + + for _, integration := range integrations { + if client.integrationAlreadyInstalled(integration.Name()) { + Logger.Printf("Integration %s is already installed\n", integration.Name()) + continue + } + client.integrations = append(client.integrations, integration) + integration.SetupOnce(client) + Logger.Printf("Integration installed: %s\n", integration.Name()) + } + + sort.Slice(client.integrations, func(i, j int) bool { + return client.integrations[i].Name() < client.integrations[j].Name() + }) +} + +// AddEventProcessor adds an event processor to the client. It must not be +// called from concurrent goroutines. Most users will prefer to use +// ClientOptions.BeforeSend or Scope.AddEventProcessor instead. +// +// Note that typical programs have only a single client created by Init and the +// client is shared among multiple hubs, one per goroutine, such that adding an +// event processor to the client affects all hubs that share the client. +func (client *Client) AddEventProcessor(processor EventProcessor) { + client.eventProcessors = append(client.eventProcessors, processor) +} + +// Options return ClientOptions for the current Client. +func (client Client) Options() ClientOptions { + return client.options +} + +// CaptureMessage captures an arbitrary message. +func (client *Client) CaptureMessage(message string, hint *EventHint, scope EventModifier) *EventID { + event := client.eventFromMessage(message, LevelInfo) + return client.CaptureEvent(event, hint, scope) +} + +// CaptureException captures an error. +func (client *Client) CaptureException(exception error, hint *EventHint, scope EventModifier) *EventID { + event := client.eventFromException(exception, LevelError) + return client.CaptureEvent(event, hint, scope) +} + +// CaptureEvent captures an event on the currently active client if any. +// +// The event must already be assembled. Typically code would instead use +// the utility methods like CaptureException. The return value is the +// event ID. In case Sentry is disabled or event was dropped, the return value will be nil. +func (client *Client) CaptureEvent(event *Event, hint *EventHint, scope EventModifier) *EventID { + return client.processEvent(event, hint, scope) +} + +// Recover captures a panic. +// Returns EventID if successfully, or nil if there's no error to recover from. +func (client *Client) Recover(err interface{}, hint *EventHint, scope EventModifier) *EventID { + if err == nil { + err = recover() + } + + // Normally we would not pass a nil Context, but RecoverWithContext doesn't + // use the Context for communicating deadline nor cancelation. All it does + // is store the Context in the EventHint and there nil means the Context is + // not available. + // nolint: staticcheck + return client.RecoverWithContext(nil, err, hint, scope) +} + +// RecoverWithContext captures a panic and passes relevant context object. +// Returns EventID if successfully, or nil if there's no error to recover from. +func (client *Client) RecoverWithContext( + ctx context.Context, + err interface{}, + hint *EventHint, + scope EventModifier, +) *EventID { + if err == nil { + err = recover() + } + if err == nil { + return nil + } + + if ctx != nil { + if hint == nil { + hint = &EventHint{} + } + if hint.Context == nil { + hint.Context = ctx + } + } + + var event *Event + switch err := err.(type) { + case error: + event = client.eventFromException(err, LevelFatal) + case string: + event = client.eventFromMessage(err, LevelFatal) + default: + event = client.eventFromMessage(fmt.Sprintf("%#v", err), LevelFatal) + } + return client.CaptureEvent(event, hint, scope) +} + +// Flush waits until the underlying Transport sends any buffered events to the +// Sentry server, blocking for at most the given timeout. It returns false if +// the timeout was reached. In that case, some events may not have been sent. +// +// Flush should be called before terminating the program to avoid +// unintentionally dropping events. +// +// Do not call Flush indiscriminately after every call to CaptureEvent, +// CaptureException or CaptureMessage. Instead, to have the SDK send events over +// the network synchronously, configure it to use the HTTPSyncTransport in the +// call to Init. +func (client *Client) Flush(timeout time.Duration) bool { + return client.Transport.Flush(timeout) +} + +func (client *Client) eventFromMessage(message string, level Level) *Event { + if message == "" { + err := usageError{fmt.Errorf("%s called with empty message", callerFunctionName())} + return client.eventFromException(err, level) + } + event := NewEvent() + event.Level = level + event.Message = message + + if client.Options().AttachStacktrace { + event.Threads = []Thread{{ + Stacktrace: NewStacktrace(), + Crashed: false, + Current: true, + }} + } + + return event +} + +func (client *Client) eventFromException(exception error, level Level) *Event { + err := exception + if err == nil { + err = usageError{fmt.Errorf("%s called with nil error", callerFunctionName())} + } + + event := NewEvent() + event.Level = level + + for i := 0; i < client.options.MaxErrorDepth && err != nil; i++ { + event.Exception = append(event.Exception, Exception{ + Value: err.Error(), + Type: reflect.TypeOf(err).String(), + Stacktrace: ExtractStacktrace(err), + }) + switch previous := err.(type) { + case interface{ Unwrap() error }: + err = previous.Unwrap() + case interface{ Cause() error }: + err = previous.Cause() + default: + err = nil + } + } + + // Add a trace of the current stack to the most recent error in a chain if + // it doesn't have a stack trace yet. + // We only add to the most recent error to avoid duplication and because the + // current stack is most likely unrelated to errors deeper in the chain. + if event.Exception[0].Stacktrace == nil { + event.Exception[0].Stacktrace = NewStacktrace() + } + + // event.Exception should be sorted such that the most recent error is last. + reverse(event.Exception) + + return event +} + +// reverse reverses the slice a in place. +func reverse(a []Exception) { + for i := len(a)/2 - 1; i >= 0; i-- { + opp := len(a) - 1 - i + a[i], a[opp] = a[opp], a[i] + } +} + +func (client *Client) processEvent(event *Event, hint *EventHint, scope EventModifier) *EventID { + if event == nil { + err := usageError{fmt.Errorf("%s called with nil event", callerFunctionName())} + return client.CaptureException(err, hint, scope) + } + + options := client.Options() + + // The default error event sample rate for all SDKs is 1.0 (send all). + // + // In Go, the zero value (default) for float64 is 0.0, which means that + // constructing a client with NewClient(ClientOptions{}), or, equivalently, + // initializing the SDK with Init(ClientOptions{}) without an explicit + // SampleRate would drop all events. + // + // To retain the desired default behavior, we exceptionally flip SampleRate + // from 0.0 to 1.0 here. Setting the sample rate to 0.0 is not very useful + // anyway, and the same end result can be achieved in many other ways like + // not initializing the SDK, setting the DSN to the empty string or using an + // event processor that always returns nil. + // + // An alternative API could be such that default options don't need to be + // the same as Go's zero values, for example using the Functional Options + // pattern. That would either require a breaking change if we want to reuse + // the obvious NewClient name, or a new function as an alternative + // constructor. + if options.SampleRate == 0.0 { + options.SampleRate = 1.0 + } + + // Transactions are sampled by options.TracesSampleRate or + // options.TracesSampler when they are started. All other events + // (errors, messages) are sampled here. + if event.Type != transactionType && !sample(options.SampleRate) { + Logger.Println("Event dropped due to SampleRate hit.") + return nil + } + + if event = client.prepareEvent(event, hint, scope); event == nil { + return nil + } + + // As per spec, transactions do not go through BeforeSend. + if event.Type != transactionType && options.BeforeSend != nil { + if hint == nil { + hint = &EventHint{} + } + if event = options.BeforeSend(event, hint); event == nil { + Logger.Println("Event dropped due to BeforeSend callback.") + return nil + } + } + + client.Transport.SendEvent(event) + + return &event.EventID +} + +func (client *Client) prepareEvent(event *Event, hint *EventHint, scope EventModifier) *Event { + if event.EventID == "" { + event.EventID = EventID(uuid()) + } + + if event.Timestamp.IsZero() { + event.Timestamp = time.Now() + } + + if event.Level == "" { + event.Level = LevelInfo + } + + if event.ServerName == "" { + event.ServerName = client.Options().ServerName + + if event.ServerName == "" { + event.ServerName = hostname + } + } + + if event.Release == "" { + event.Release = client.Options().Release + } + + if event.Dist == "" { + event.Dist = client.Options().Dist + } + + if event.Environment == "" { + event.Environment = client.Options().Environment + } + + event.Platform = "go" + event.Sdk = SdkInfo{ + Name: SDKIdentifier, + Version: SDKVersion, + Integrations: client.listIntegrations(), + Packages: []SdkPackage{{ + Name: "sentry-go", + Version: SDKVersion, + }}, + } + + if scope != nil { + event = scope.ApplyToEvent(event, hint) + if event == nil { + return nil + } + } + + for _, processor := range client.eventProcessors { + id := event.EventID + event = processor(event, hint) + if event == nil { + Logger.Printf("Event dropped by one of the Client EventProcessors: %s\n", id) + return nil + } + } + + for _, processor := range globalEventProcessors { + id := event.EventID + event = processor(event, hint) + if event == nil { + Logger.Printf("Event dropped by one of the Global EventProcessors: %s\n", id) + return nil + } + } + + return event +} + +func (client Client) listIntegrations() []string { + integrations := make([]string, len(client.integrations)) + for i, integration := range client.integrations { + integrations[i] = integration.Name() + } + return integrations +} + +func (client Client) integrationAlreadyInstalled(name string) bool { + for _, integration := range client.integrations { + if integration.Name() == name { + return true + } + } + return false +} + +// sample returns true with the given probability, which must be in the range +// [0.0, 1.0]. +func sample(probability float64) bool { + return rng.Float64() < probability +} diff --git a/vendor/github.com/getsentry/sentry-go/doc.go b/vendor/github.com/getsentry/sentry-go/doc.go new file mode 100644 index 00000000..f80fd402 --- /dev/null +++ b/vendor/github.com/getsentry/sentry-go/doc.go @@ -0,0 +1,64 @@ +/* +Package sentry is the official Sentry SDK for Go. + +Use it to report errors and track application performance through distributed +tracing. + +For more information about Sentry and SDK features please have a look at the +documentation site https://docs.sentry.io/platforms/go/. + +# Basic Usage + +The first step is to initialize the SDK, providing at a minimum the DSN of your +Sentry project. This step is accomplished through a call to sentry.Init. + + func main() { + err := sentry.Init(...) + ... + } + +A more detailed yet simple example is available at +https://github.com/getsentry/sentry-go/blob/master/example/basic/main.go. + +# Error Reporting + +The Capture* functions report messages and errors to Sentry. + + sentry.CaptureMessage(...) + sentry.CaptureException(...) + sentry.CaptureEvent(...) + +Use similarly named functions in the Hub for concurrent programs like web +servers. + +# Performance Monitoring + +You can use Sentry to monitor your application's performance. More information +on the product page https://docs.sentry.io/product/performance/. + +The StartSpan function creates new spans. + + span := sentry.StartSpan(ctx, "operation") + ... + span.Finish() + +# Integrations + +The SDK has support for several Go frameworks, available as subpackages. + +# Getting Support + +For paid Sentry.io accounts, head out to https://sentry.io/support. + +For all users, support channels include: + + Forum: https://forum.sentry.io + Discord: https://discord.gg/Ww9hbqr (#go channel) + +If you found an issue with the SDK, please report through +https://github.com/getsentry/sentry-go/issues/new/choose. + +For responsibly disclosing a security issue, please follow the steps in +https://sentry.io/security/#vulnerability-disclosure. +*/ +package sentry diff --git a/vendor/github.com/getsentry/sentry-go/dsn.go b/vendor/github.com/getsentry/sentry-go/dsn.go new file mode 100644 index 00000000..5f5a13ce --- /dev/null +++ b/vendor/github.com/getsentry/sentry-go/dsn.go @@ -0,0 +1,204 @@ +package sentry + +import ( + "encoding/json" + "fmt" + "net/url" + "strconv" + "strings" + "time" +) + +type scheme string + +const ( + schemeHTTP scheme = "http" + schemeHTTPS scheme = "https" +) + +func (scheme scheme) defaultPort() int { + switch scheme { + case schemeHTTPS: + return 443 + case schemeHTTP: + return 80 + default: + return 80 + } +} + +// DsnParseError represents an error that occurs if a Sentry +// DSN cannot be parsed. +type DsnParseError struct { + Message string +} + +func (e DsnParseError) Error() string { + return "[Sentry] DsnParseError: " + e.Message +} + +// Dsn is used as the remote address source to client transport. +type Dsn struct { + scheme scheme + publicKey string + secretKey string + host string + port int + path string + projectID string +} + +// NewDsn creates a Dsn by parsing rawURL. Most users will never call this +// function directly. It is provided for use in custom Transport +// implementations. +func NewDsn(rawURL string) (*Dsn, error) { + // Parse + parsedURL, err := url.Parse(rawURL) + if err != nil { + return nil, &DsnParseError{fmt.Sprintf("invalid url: %v", err)} + } + + // Scheme + var scheme scheme + switch parsedURL.Scheme { + case "http": + scheme = schemeHTTP + case "https": + scheme = schemeHTTPS + default: + return nil, &DsnParseError{"invalid scheme"} + } + + // PublicKey + publicKey := parsedURL.User.Username() + if publicKey == "" { + return nil, &DsnParseError{"empty username"} + } + + // SecretKey + var secretKey string + if parsedSecretKey, ok := parsedURL.User.Password(); ok { + secretKey = parsedSecretKey + } + + // Host + host := parsedURL.Hostname() + if host == "" { + return nil, &DsnParseError{"empty host"} + } + + // Port + var port int + if parsedURL.Port() != "" { + parsedPort, err := strconv.Atoi(parsedURL.Port()) + if err != nil { + return nil, &DsnParseError{"invalid port"} + } + port = parsedPort + } else { + port = scheme.defaultPort() + } + + // ProjectID + if parsedURL.Path == "" || parsedURL.Path == "/" { + return nil, &DsnParseError{"empty project id"} + } + pathSegments := strings.Split(parsedURL.Path[1:], "/") + projectID := pathSegments[len(pathSegments)-1] + + if projectID == "" { + return nil, &DsnParseError{"empty project id"} + } + + // Path + var path string + if len(pathSegments) > 1 { + path = "/" + strings.Join(pathSegments[0:len(pathSegments)-1], "/") + } + + return &Dsn{ + scheme: scheme, + publicKey: publicKey, + secretKey: secretKey, + host: host, + port: port, + path: path, + projectID: projectID, + }, nil +} + +// String formats Dsn struct into a valid string url. +func (dsn Dsn) String() string { + var url string + url += fmt.Sprintf("%s://%s", dsn.scheme, dsn.publicKey) + if dsn.secretKey != "" { + url += fmt.Sprintf(":%s", dsn.secretKey) + } + url += fmt.Sprintf("@%s", dsn.host) + if dsn.port != dsn.scheme.defaultPort() { + url += fmt.Sprintf(":%d", dsn.port) + } + if dsn.path != "" { + url += dsn.path + } + url += fmt.Sprintf("/%s", dsn.projectID) + return url +} + +// StoreAPIURL returns the URL of the store endpoint of the project associated +// with the DSN. +func (dsn Dsn) StoreAPIURL() *url.URL { + return dsn.getAPIURL("store") +} + +// EnvelopeAPIURL returns the URL of the envelope endpoint of the project +// associated with the DSN. +func (dsn Dsn) EnvelopeAPIURL() *url.URL { + return dsn.getAPIURL("envelope") +} + +func (dsn Dsn) getAPIURL(s string) *url.URL { + var rawURL string + rawURL += fmt.Sprintf("%s://%s", dsn.scheme, dsn.host) + if dsn.port != dsn.scheme.defaultPort() { + rawURL += fmt.Sprintf(":%d", dsn.port) + } + if dsn.path != "" { + rawURL += dsn.path + } + rawURL += fmt.Sprintf("/api/%s/%s/", dsn.projectID, s) + parsedURL, _ := url.Parse(rawURL) + return parsedURL +} + +// RequestHeaders returns all the necessary headers that have to be used in the transport. +func (dsn Dsn) RequestHeaders() map[string]string { + auth := fmt.Sprintf("Sentry sentry_version=%s, sentry_timestamp=%d, "+ + "sentry_client=sentry.go/%s, sentry_key=%s", apiVersion, time.Now().Unix(), Version, dsn.publicKey) + + if dsn.secretKey != "" { + auth = fmt.Sprintf("%s, sentry_secret=%s", auth, dsn.secretKey) + } + + return map[string]string{ + "Content-Type": "application/json", + "X-Sentry-Auth": auth, + } +} + +// MarshalJSON converts the Dsn struct to JSON. +func (dsn Dsn) MarshalJSON() ([]byte, error) { + return json.Marshal(dsn.String()) +} + +// UnmarshalJSON converts JSON data to the Dsn struct. +func (dsn *Dsn) UnmarshalJSON(data []byte) error { + var str string + _ = json.Unmarshal(data, &str) + newDsn, err := NewDsn(str) + if err != nil { + return err + } + *dsn = *newDsn + return nil +} diff --git a/vendor/github.com/getsentry/sentry-go/dynamic_sampling_context.go b/vendor/github.com/getsentry/sentry-go/dynamic_sampling_context.go new file mode 100644 index 00000000..3e54839b --- /dev/null +++ b/vendor/github.com/getsentry/sentry-go/dynamic_sampling_context.go @@ -0,0 +1,110 @@ +package sentry + +import ( + "strconv" + "strings" + + "github.com/getsentry/sentry-go/internal/otel/baggage" +) + +const ( + sentryPrefix = "sentry-" +) + +// DynamicSamplingContext holds information about the current event that can be used to make dynamic sampling decisions. +type DynamicSamplingContext struct { + Entries map[string]string + Frozen bool +} + +func DynamicSamplingContextFromHeader(header []byte) (DynamicSamplingContext, error) { + bag, err := baggage.Parse(string(header)) + if err != nil { + return DynamicSamplingContext{}, err + } + + entries := map[string]string{} + for _, member := range bag.Members() { + // We only store baggage members if their key starts with "sentry-". + if k, v := member.Key(), member.Value(); strings.HasPrefix(k, sentryPrefix) { + entries[strings.TrimPrefix(k, sentryPrefix)] = v + } + } + + return DynamicSamplingContext{ + Entries: entries, + Frozen: true, + }, nil +} + +func DynamicSamplingContextFromTransaction(span *Span) DynamicSamplingContext { + entries := map[string]string{} + + hub := hubFromContext(span.Context()) + scope := hub.Scope() + client := hub.Client() + options := client.Options() + + if traceID := span.TraceID.String(); traceID != "" { + entries["trace_id"] = traceID + } + if sampleRate := span.sampleRate; sampleRate != 0 { + entries["sample_rate"] = strconv.FormatFloat(sampleRate, 'f', -1, 64) + } + + if dsn := client.dsn; dsn != nil { + if publicKey := dsn.publicKey; publicKey != "" { + entries["public_key"] = publicKey + } + } + if release := options.Release; release != "" { + entries["release"] = release + } + if environment := options.Environment; environment != "" { + entries["environment"] = environment + } + + // Only include the transaction name if it's of good quality (not empty and not SourceURL) + if span.Source != "" && span.Source != SourceURL { + if transactionName := scope.Transaction(); transactionName != "" { + entries["transaction"] = transactionName + } + } + + if userSegment := scope.user.Segment; userSegment != "" { + entries["user_segment"] = userSegment + } + + return DynamicSamplingContext{ + Entries: entries, + Frozen: true, + } +} + +func (d DynamicSamplingContext) HasEntries() bool { + return len(d.Entries) > 0 +} + +func (d DynamicSamplingContext) IsFrozen() bool { + return d.Frozen +} + +func (d DynamicSamplingContext) String() string { + members := []baggage.Member{} + for k, entry := range d.Entries { + member, err := baggage.NewMember(sentryPrefix+k, entry) + if err != nil { + continue + } + members = append(members, member) + } + if len(members) > 0 { + baggage, err := baggage.New(members...) + if err != nil { + return "" + } + return baggage.String() + } + + return "" +} diff --git a/vendor/github.com/getsentry/sentry-go/hub.go b/vendor/github.com/getsentry/sentry-go/hub.go new file mode 100644 index 00000000..71608df3 --- /dev/null +++ b/vendor/github.com/getsentry/sentry-go/hub.go @@ -0,0 +1,384 @@ +package sentry + +import ( + "context" + "sync" + "time" +) + +type contextKey int + +// Keys used to store values in a Context. Use with Context.Value to access +// values stored by the SDK. +const ( + // HubContextKey is the key used to store the current Hub. + HubContextKey = contextKey(1) + // RequestContextKey is the key used to store the current http.Request. + RequestContextKey = contextKey(2) +) + +// defaultMaxBreadcrumbs is the default maximum number of breadcrumbs added to +// an event. Can be overwritten with the maxBreadcrumbs option. +const defaultMaxBreadcrumbs = 30 + +// maxBreadcrumbs is the absolute maximum number of breadcrumbs added to an +// event. The maxBreadcrumbs option cannot be set higher than this value. +const maxBreadcrumbs = 100 + +// currentHub is the initial Hub with no Client bound and an empty Scope. +var currentHub = NewHub(nil, NewScope()) + +// Hub is the central object that manages scopes and clients. +// +// This can be used to capture events and manage the scope. +// The default hub that is available automatically. +// +// In most situations developers do not need to interface the hub. Instead +// toplevel convenience functions are exposed that will automatically dispatch +// to global (CurrentHub) hub. In some situations this might not be +// possible in which case it might become necessary to manually work with the +// hub. This is for instance the case when working with async code. +type Hub struct { + mu sync.RWMutex + stack *stack + lastEventID EventID +} + +type layer struct { + // mu protects concurrent reads and writes to client. + mu sync.RWMutex + client *Client + // scope is read-only, not protected by mu. + scope *Scope +} + +// Client returns the layer's client. Safe for concurrent use. +func (l *layer) Client() *Client { + l.mu.RLock() + defer l.mu.RUnlock() + return l.client +} + +// SetClient sets the layer's client. Safe for concurrent use. +func (l *layer) SetClient(c *Client) { + l.mu.Lock() + defer l.mu.Unlock() + l.client = c +} + +type stack []*layer + +// NewHub returns an instance of a Hub with provided Client and Scope bound. +func NewHub(client *Client, scope *Scope) *Hub { + hub := Hub{ + stack: &stack{{ + client: client, + scope: scope, + }}, + } + return &hub +} + +// CurrentHub returns an instance of previously initialized Hub stored in the global namespace. +func CurrentHub() *Hub { + return currentHub +} + +// LastEventID returns the ID of the last event (error or message) captured +// through the hub and sent to the underlying transport. +// +// Transactions and events dropped by sampling or event processors do not change +// the last event ID. +// +// LastEventID is a convenience method to cover use cases in which errors are +// captured indirectly and the ID is needed. For example, it can be used as part +// of an HTTP middleware to log the ID of the last error, if any. +// +// For more flexibility, consider instead using the ClientOptions.BeforeSend +// function or event processors. +func (hub *Hub) LastEventID() EventID { + hub.mu.RLock() + defer hub.mu.RUnlock() + + return hub.lastEventID +} + +// stackTop returns the top layer of the hub stack. Valid hubs always have at +// least one layer, therefore stackTop always return a non-nil pointer. +func (hub *Hub) stackTop() *layer { + hub.mu.RLock() + defer hub.mu.RUnlock() + + stack := hub.stack + stackLen := len(*stack) + top := (*stack)[stackLen-1] + return top +} + +// Clone returns a copy of the current Hub with top-most scope and client copied over. +func (hub *Hub) Clone() *Hub { + top := hub.stackTop() + scope := top.scope + if scope != nil { + scope = scope.Clone() + } + return NewHub(top.Client(), scope) +} + +// Scope returns top-level Scope of the current Hub or nil if no Scope is bound. +func (hub *Hub) Scope() *Scope { + top := hub.stackTop() + return top.scope +} + +// Client returns top-level Client of the current Hub or nil if no Client is bound. +func (hub *Hub) Client() *Client { + top := hub.stackTop() + return top.Client() +} + +// PushScope pushes a new scope for the current Hub and reuses previously bound Client. +func (hub *Hub) PushScope() *Scope { + top := hub.stackTop() + + var scope *Scope + if top.scope != nil { + scope = top.scope.Clone() + } else { + scope = NewScope() + } + + hub.mu.Lock() + defer hub.mu.Unlock() + + *hub.stack = append(*hub.stack, &layer{ + client: top.Client(), + scope: scope, + }) + + return scope +} + +// PopScope drops the most recent scope. +// +// Calls to PopScope must be coordinated with PushScope. For most cases, using +// WithScope should be more convenient. +// +// Calls to PopScope that do not match previous calls to PushScope are silently +// ignored. +func (hub *Hub) PopScope() { + hub.mu.Lock() + defer hub.mu.Unlock() + + stack := *hub.stack + stackLen := len(stack) + if stackLen > 1 { + // Never pop the last item off the stack, the stack should always have + // at least one item. + *hub.stack = stack[0 : stackLen-1] + } +} + +// BindClient binds a new Client for the current Hub. +func (hub *Hub) BindClient(client *Client) { + top := hub.stackTop() + top.SetClient(client) +} + +// WithScope runs f in an isolated temporary scope. +// +// It is useful when extra data should be sent with a single capture call, for +// instance a different level or tags. +// +// The scope passed to f starts as a clone of the current scope and can be +// freely modified without affecting the current scope. +// +// It is a shorthand for PushScope followed by PopScope. +func (hub *Hub) WithScope(f func(scope *Scope)) { + scope := hub.PushScope() + defer hub.PopScope() + f(scope) +} + +// ConfigureScope runs f in the current scope. +// +// It is useful to set data that applies to all events that share the current +// scope. +// +// Modifying the scope affects all references to the current scope. +// +// See also WithScope for making isolated temporary changes. +func (hub *Hub) ConfigureScope(f func(scope *Scope)) { + scope := hub.Scope() + f(scope) +} + +// CaptureEvent calls the method of a same name on currently bound Client instance +// passing it a top-level Scope. +// Returns EventID if successfully, or nil if there's no Scope or Client available. +func (hub *Hub) CaptureEvent(event *Event) *EventID { + client, scope := hub.Client(), hub.Scope() + if client == nil || scope == nil { + return nil + } + eventID := client.CaptureEvent(event, nil, scope) + + if event.Type != transactionType && eventID != nil { + hub.mu.Lock() + hub.lastEventID = *eventID + hub.mu.Unlock() + } + return eventID +} + +// CaptureMessage calls the method of a same name on currently bound Client instance +// passing it a top-level Scope. +// Returns EventID if successfully, or nil if there's no Scope or Client available. +func (hub *Hub) CaptureMessage(message string) *EventID { + client, scope := hub.Client(), hub.Scope() + if client == nil || scope == nil { + return nil + } + eventID := client.CaptureMessage(message, nil, scope) + + if eventID != nil { + hub.mu.Lock() + hub.lastEventID = *eventID + hub.mu.Unlock() + } + return eventID +} + +// CaptureException calls the method of a same name on currently bound Client instance +// passing it a top-level Scope. +// Returns EventID if successfully, or nil if there's no Scope or Client available. +func (hub *Hub) CaptureException(exception error) *EventID { + client, scope := hub.Client(), hub.Scope() + if client == nil || scope == nil { + return nil + } + eventID := client.CaptureException(exception, &EventHint{OriginalException: exception}, scope) + + if eventID != nil { + hub.mu.Lock() + hub.lastEventID = *eventID + hub.mu.Unlock() + } + return eventID +} + +// AddBreadcrumb records a new breadcrumb. +// +// The total number of breadcrumbs that can be recorded are limited by the +// configuration on the client. +func (hub *Hub) AddBreadcrumb(breadcrumb *Breadcrumb, hint *BreadcrumbHint) { + client := hub.Client() + + // If there's no client, just store it on the scope straight away + if client == nil { + hub.Scope().AddBreadcrumb(breadcrumb, maxBreadcrumbs) + return + } + + options := client.Options() + max := options.MaxBreadcrumbs + if max < 0 { + return + } + + if options.BeforeBreadcrumb != nil { + if hint == nil { + hint = &BreadcrumbHint{} + } + if breadcrumb = options.BeforeBreadcrumb(breadcrumb, hint); breadcrumb == nil { + Logger.Println("breadcrumb dropped due to BeforeBreadcrumb callback.") + return + } + } + + if max == 0 { + max = defaultMaxBreadcrumbs + } else if max > maxBreadcrumbs { + max = maxBreadcrumbs + } + + hub.Scope().AddBreadcrumb(breadcrumb, max) +} + +// Recover calls the method of a same name on currently bound Client instance +// passing it a top-level Scope. +// Returns EventID if successfully, or nil if there's no Scope or Client available. +func (hub *Hub) Recover(err interface{}) *EventID { + if err == nil { + err = recover() + } + client, scope := hub.Client(), hub.Scope() + if client == nil || scope == nil { + return nil + } + return client.Recover(err, &EventHint{RecoveredException: err}, scope) +} + +// RecoverWithContext calls the method of a same name on currently bound Client instance +// passing it a top-level Scope. +// Returns EventID if successfully, or nil if there's no Scope or Client available. +func (hub *Hub) RecoverWithContext(ctx context.Context, err interface{}) *EventID { + if err == nil { + err = recover() + } + client, scope := hub.Client(), hub.Scope() + if client == nil || scope == nil { + return nil + } + return client.RecoverWithContext(ctx, err, &EventHint{RecoveredException: err}, scope) +} + +// Flush waits until the underlying Transport sends any buffered events to the +// Sentry server, blocking for at most the given timeout. It returns false if +// the timeout was reached. In that case, some events may not have been sent. +// +// Flush should be called before terminating the program to avoid +// unintentionally dropping events. +// +// Do not call Flush indiscriminately after every call to CaptureEvent, +// CaptureException or CaptureMessage. Instead, to have the SDK send events over +// the network synchronously, configure it to use the HTTPSyncTransport in the +// call to Init. +func (hub *Hub) Flush(timeout time.Duration) bool { + client := hub.Client() + + if client == nil { + return false + } + + return client.Flush(timeout) +} + +// HasHubOnContext checks whether Hub instance is bound to a given Context struct. +func HasHubOnContext(ctx context.Context) bool { + _, ok := ctx.Value(HubContextKey).(*Hub) + return ok +} + +// GetHubFromContext tries to retrieve Hub instance from the given Context struct +// or return nil if one is not found. +func GetHubFromContext(ctx context.Context) *Hub { + if hub, ok := ctx.Value(HubContextKey).(*Hub); ok { + return hub + } + return nil +} + +// hubFromContext returns either a hub stored in the context or the current hub. +// The return value is guaranteed to be non-nil, unlike GetHubFromContext. +func hubFromContext(ctx context.Context) *Hub { + if hub, ok := ctx.Value(HubContextKey).(*Hub); ok { + return hub + } + return currentHub +} + +// SetHubOnContext stores given Hub instance on the Context struct and returns a new Context. +func SetHubOnContext(ctx context.Context, hub *Hub) context.Context { + return context.WithValue(ctx, HubContextKey, hub) +} diff --git a/vendor/github.com/getsentry/sentry-go/integrations.go b/vendor/github.com/getsentry/sentry-go/integrations.go new file mode 100644 index 00000000..6a9e55a2 --- /dev/null +++ b/vendor/github.com/getsentry/sentry-go/integrations.go @@ -0,0 +1,293 @@ +package sentry + +import ( + "fmt" + "regexp" + "runtime" + "runtime/debug" + "strings" + "sync" +) + +// ================================ +// Modules Integration +// ================================ + +type modulesIntegration struct { + once sync.Once + modules map[string]string +} + +func (mi *modulesIntegration) Name() string { + return "Modules" +} + +func (mi *modulesIntegration) SetupOnce(client *Client) { + client.AddEventProcessor(mi.processor) +} + +func (mi *modulesIntegration) processor(event *Event, hint *EventHint) *Event { + if len(event.Modules) == 0 { + mi.once.Do(func() { + info, ok := debug.ReadBuildInfo() + if !ok { + Logger.Print("The Modules integration is not available in binaries built without module support.") + return + } + mi.modules = extractModules(info) + }) + } + event.Modules = mi.modules + return event +} + +func extractModules(info *debug.BuildInfo) map[string]string { + modules := map[string]string{ + info.Main.Path: info.Main.Version, + } + for _, dep := range info.Deps { + ver := dep.Version + if dep.Replace != nil { + ver += fmt.Sprintf(" => %s %s", dep.Replace.Path, dep.Replace.Version) + } + modules[dep.Path] = strings.TrimSuffix(ver, " ") + } + return modules +} + +// ================================ +// Environment Integration +// ================================ + +type environmentIntegration struct{} + +func (ei *environmentIntegration) Name() string { + return "Environment" +} + +func (ei *environmentIntegration) SetupOnce(client *Client) { + client.AddEventProcessor(ei.processor) +} + +func (ei *environmentIntegration) processor(event *Event, hint *EventHint) *Event { + // Initialize maps as necessary. + contextNames := []string{"device", "os", "runtime"} + if event.Contexts == nil { + event.Contexts = make(map[string]Context, len(contextNames)) + } + for _, name := range contextNames { + if event.Contexts[name] == nil { + event.Contexts[name] = make(Context) + } + } + + // Set contextual information preserving existing data. For each context, if + // the existing value is not of type map[string]interface{}, then no + // additional information is added. + if deviceContext, ok := event.Contexts["device"]; ok { + if _, ok := deviceContext["arch"]; !ok { + deviceContext["arch"] = runtime.GOARCH + } + if _, ok := deviceContext["num_cpu"]; !ok { + deviceContext["num_cpu"] = runtime.NumCPU() + } + } + if osContext, ok := event.Contexts["os"]; ok { + if _, ok := osContext["name"]; !ok { + osContext["name"] = runtime.GOOS + } + } + if runtimeContext, ok := event.Contexts["runtime"]; ok { + if _, ok := runtimeContext["name"]; !ok { + runtimeContext["name"] = "go" + } + if _, ok := runtimeContext["version"]; !ok { + runtimeContext["version"] = runtime.Version() + } + if _, ok := runtimeContext["go_numroutines"]; !ok { + runtimeContext["go_numroutines"] = runtime.NumGoroutine() + } + if _, ok := runtimeContext["go_maxprocs"]; !ok { + runtimeContext["go_maxprocs"] = runtime.GOMAXPROCS(0) + } + if _, ok := runtimeContext["go_numcgocalls"]; !ok { + runtimeContext["go_numcgocalls"] = runtime.NumCgoCall() + } + } + return event +} + +// ================================ +// Ignore Errors Integration +// ================================ + +type ignoreErrorsIntegration struct { + ignoreErrors []*regexp.Regexp +} + +func (iei *ignoreErrorsIntegration) Name() string { + return "IgnoreErrors" +} + +func (iei *ignoreErrorsIntegration) SetupOnce(client *Client) { + iei.ignoreErrors = transformStringsIntoRegexps(client.Options().IgnoreErrors) + client.AddEventProcessor(iei.processor) +} + +func (iei *ignoreErrorsIntegration) processor(event *Event, hint *EventHint) *Event { + suspects := getIgnoreErrorsSuspects(event) + + for _, suspect := range suspects { + for _, pattern := range iei.ignoreErrors { + if pattern.Match([]byte(suspect)) { + Logger.Printf("Event dropped due to being matched by `IgnoreErrors` option."+ + "| Value matched: %s | Filter used: %s", suspect, pattern) + return nil + } + } + } + + return event +} + +func transformStringsIntoRegexps(strings []string) []*regexp.Regexp { + var exprs []*regexp.Regexp + + for _, s := range strings { + r, err := regexp.Compile(s) + if err == nil { + exprs = append(exprs, r) + } + } + + return exprs +} + +func getIgnoreErrorsSuspects(event *Event) []string { + suspects := []string{} + + if event.Message != "" { + suspects = append(suspects, event.Message) + } + + for _, ex := range event.Exception { + suspects = append(suspects, ex.Type, ex.Value) + } + + return suspects +} + +// ================================ +// Contextify Frames Integration +// ================================ + +type contextifyFramesIntegration struct { + sr sourceReader + contextLines int + cachedLocations sync.Map +} + +func (cfi *contextifyFramesIntegration) Name() string { + return "ContextifyFrames" +} + +func (cfi *contextifyFramesIntegration) SetupOnce(client *Client) { + cfi.sr = newSourceReader() + cfi.contextLines = 5 + + client.AddEventProcessor(cfi.processor) +} + +func (cfi *contextifyFramesIntegration) processor(event *Event, hint *EventHint) *Event { + // Range over all exceptions + for _, ex := range event.Exception { + // If it has no stacktrace, just bail out + if ex.Stacktrace == nil { + continue + } + + // If it does, it should have frames, so try to contextify them + ex.Stacktrace.Frames = cfi.contextify(ex.Stacktrace.Frames) + } + + // Range over all threads + for _, th := range event.Threads { + // If it has no stacktrace, just bail out + if th.Stacktrace == nil { + continue + } + + // If it does, it should have frames, so try to contextify them + th.Stacktrace.Frames = cfi.contextify(th.Stacktrace.Frames) + } + + return event +} + +func (cfi *contextifyFramesIntegration) contextify(frames []Frame) []Frame { + contextifiedFrames := make([]Frame, 0, len(frames)) + + for _, frame := range frames { + if !frame.InApp { + contextifiedFrames = append(contextifiedFrames, frame) + continue + } + + var path string + + if cachedPath, ok := cfi.cachedLocations.Load(frame.AbsPath); ok { + if p, ok := cachedPath.(string); ok { + path = p + } + } else { + // Optimize for happy path here + if fileExists(frame.AbsPath) { + path = frame.AbsPath + } else { + path = cfi.findNearbySourceCodeLocation(frame.AbsPath) + } + } + + if path == "" { + contextifiedFrames = append(contextifiedFrames, frame) + continue + } + + lines, contextLine := cfi.sr.readContextLines(path, frame.Lineno, cfi.contextLines) + contextifiedFrames = append(contextifiedFrames, cfi.addContextLinesToFrame(frame, lines, contextLine)) + } + + return contextifiedFrames +} + +func (cfi *contextifyFramesIntegration) findNearbySourceCodeLocation(originalPath string) string { + trimmedPath := strings.TrimPrefix(originalPath, "/") + components := strings.Split(trimmedPath, "/") + + for len(components) > 0 { + components = components[1:] + possibleLocation := strings.Join(components, "/") + + if fileExists(possibleLocation) { + cfi.cachedLocations.Store(originalPath, possibleLocation) + return possibleLocation + } + } + + cfi.cachedLocations.Store(originalPath, "") + return "" +} + +func (cfi *contextifyFramesIntegration) addContextLinesToFrame(frame Frame, lines [][]byte, contextLine int) Frame { + for i, line := range lines { + switch { + case i < contextLine: + frame.PreContext = append(frame.PreContext, string(line)) + case i == contextLine: + frame.ContextLine = string(line) + default: + frame.PostContext = append(frame.PostContext, string(line)) + } + } + return frame +} diff --git a/vendor/github.com/getsentry/sentry-go/interfaces.go b/vendor/github.com/getsentry/sentry-go/interfaces.go new file mode 100644 index 00000000..0d20ba39 --- /dev/null +++ b/vendor/github.com/getsentry/sentry-go/interfaces.go @@ -0,0 +1,392 @@ +package sentry + +import ( + "context" + "encoding/json" + "fmt" + "net" + "net/http" + "strings" + "time" +) + +// Protocol Docs (kinda) +// https://github.com/getsentry/rust-sentry-types/blob/master/src/protocol/v7.rs + +// transactionType is the type of a transaction event. +const transactionType = "transaction" + +// Level marks the severity of the event. +type Level string + +// Describes the severity of the event. +const ( + LevelDebug Level = "debug" + LevelInfo Level = "info" + LevelWarning Level = "warning" + LevelError Level = "error" + LevelFatal Level = "fatal" +) + +func getSensitiveHeaders() map[string]bool { + return map[string]bool{ + "Authorization": true, + "Cookie": true, + "X-Forwarded-For": true, + "X-Real-Ip": true, + } +} + +// SdkInfo contains all metadata about about the SDK being used. +type SdkInfo struct { + Name string `json:"name,omitempty"` + Version string `json:"version,omitempty"` + Integrations []string `json:"integrations,omitempty"` + Packages []SdkPackage `json:"packages,omitempty"` +} + +// SdkPackage describes a package that was installed. +type SdkPackage struct { + Name string `json:"name,omitempty"` + Version string `json:"version,omitempty"` +} + +// TODO: This type could be more useful, as map of interface{} is too generic +// and requires a lot of type assertions in beforeBreadcrumb calls +// plus it could just be map[string]interface{} then. + +// BreadcrumbHint contains information that can be associated with a Breadcrumb. +type BreadcrumbHint map[string]interface{} + +// Breadcrumb specifies an application event that occurred before a Sentry event. +// An event may contain one or more breadcrumbs. +type Breadcrumb struct { + Type string `json:"type,omitempty"` + Category string `json:"category,omitempty"` + Message string `json:"message,omitempty"` + Data map[string]interface{} `json:"data,omitempty"` + Level Level `json:"level,omitempty"` + Timestamp time.Time `json:"timestamp"` +} + +// TODO: provide constants for known breadcrumb types. +// See https://develop.sentry.dev/sdk/event-payloads/breadcrumbs/#breadcrumb-types. + +// MarshalJSON converts the Breadcrumb struct to JSON. +func (b *Breadcrumb) MarshalJSON() ([]byte, error) { + // We want to omit time.Time zero values, otherwise the server will try to + // interpret dates too far in the past. However, encoding/json doesn't + // support the "omitempty" option for struct types. See + // https://golang.org/issues/11939. + // + // We overcome the limitation and achieve what we want by shadowing fields + // and a few type tricks. + + // breadcrumb aliases Breadcrumb to allow calling json.Marshal without an + // infinite loop. It preserves all fields while none of the attached + // methods. + type breadcrumb Breadcrumb + + if b.Timestamp.IsZero() { + return json.Marshal(struct { + // Embed all of the fields of Breadcrumb. + *breadcrumb + // Timestamp shadows the original Timestamp field and is meant to + // remain nil, triggering the omitempty behavior. + Timestamp json.RawMessage `json:"timestamp,omitempty"` + }{breadcrumb: (*breadcrumb)(b)}) + } + return json.Marshal((*breadcrumb)(b)) +} + +// User describes the user associated with an Event. If this is used, at least +// an ID or an IP address should be provided. +type User struct { + ID string `json:"id,omitempty"` + Email string `json:"email,omitempty"` + IPAddress string `json:"ip_address,omitempty"` + Username string `json:"username,omitempty"` + Name string `json:"name,omitempty"` + Segment string `json:"segment,omitempty"` + Data map[string]string `json:"data,omitempty"` +} + +func (u User) IsEmpty() bool { + if len(u.ID) > 0 { + return false + } + + if len(u.Email) > 0 { + return false + } + + if len(u.IPAddress) > 0 { + return false + } + + if len(u.Username) > 0 { + return false + } + + if len(u.Name) > 0 { + return false + } + + if len(u.Segment) > 0 { + return false + } + + if len(u.Data) > 0 { + return false + } + + return true +} + +// Request contains information on a HTTP request related to the event. +type Request struct { + URL string `json:"url,omitempty"` + Method string `json:"method,omitempty"` + Data string `json:"data,omitempty"` + QueryString string `json:"query_string,omitempty"` + Cookies string `json:"cookies,omitempty"` + Headers map[string]string `json:"headers,omitempty"` + Env map[string]string `json:"env,omitempty"` +} + +// NewRequest returns a new Sentry Request from the given http.Request. +// +// NewRequest avoids operations that depend on network access. In particular, it +// does not read r.Body. +func NewRequest(r *http.Request) *Request { + protocol := schemeHTTP + if r.TLS != nil || r.Header.Get("X-Forwarded-Proto") == "https" { + protocol = schemeHTTPS + } + url := fmt.Sprintf("%s://%s%s", protocol, r.Host, r.URL.Path) + + var cookies string + var env map[string]string + headers := map[string]string{} + + if client := CurrentHub().Client(); client != nil { + if client.Options().SendDefaultPII { + // We read only the first Cookie header because of the specification: + // https://tools.ietf.org/html/rfc6265#section-5.4 + // When the user agent generates an HTTP request, the user agent MUST NOT + // attach more than one Cookie header field. + cookies = r.Header.Get("Cookie") + + for k, v := range r.Header { + headers[k] = strings.Join(v, ",") + } + + if addr, port, err := net.SplitHostPort(r.RemoteAddr); err == nil { + env = map[string]string{"REMOTE_ADDR": addr, "REMOTE_PORT": port} + } + } + } else { + sensitiveHeaders := getSensitiveHeaders() + for k, v := range r.Header { + if _, ok := sensitiveHeaders[k]; !ok { + headers[k] = strings.Join(v, ",") + } + } + } + + headers["Host"] = r.Host + + return &Request{ + URL: url, + Method: r.Method, + QueryString: r.URL.RawQuery, + Cookies: cookies, + Headers: headers, + Env: env, + } +} + +// Exception specifies an error that occurred. +type Exception struct { + Type string `json:"type,omitempty"` // used as the main issue title + Value string `json:"value,omitempty"` // used as the main issue subtitle + Module string `json:"module,omitempty"` + ThreadID string `json:"thread_id,omitempty"` + Stacktrace *Stacktrace `json:"stacktrace,omitempty"` +} + +// SDKMetaData is a struct to stash data which is needed at some point in the SDK's event processing pipeline +// but which shouldn't get send to Sentry. +type SDKMetaData struct { + dsc DynamicSamplingContext +} + +// Contains information about how the name of the transaction was determined. +type TransactionInfo struct { + Source TransactionSource `json:"source,omitempty"` +} + +// EventID is a hexadecimal string representing a unique uuid4 for an Event. +// An EventID must be 32 characters long, lowercase and not have any dashes. +type EventID string + +type Context = map[string]interface{} + +// Event is the fundamental data structure that is sent to Sentry. +type Event struct { + Breadcrumbs []*Breadcrumb `json:"breadcrumbs,omitempty"` + Contexts map[string]Context `json:"contexts,omitempty"` + Dist string `json:"dist,omitempty"` + Environment string `json:"environment,omitempty"` + EventID EventID `json:"event_id,omitempty"` + Extra map[string]interface{} `json:"extra,omitempty"` + Fingerprint []string `json:"fingerprint,omitempty"` + Level Level `json:"level,omitempty"` + Message string `json:"message,omitempty"` + Platform string `json:"platform,omitempty"` + Release string `json:"release,omitempty"` + Sdk SdkInfo `json:"sdk,omitempty"` + ServerName string `json:"server_name,omitempty"` + Threads []Thread `json:"threads,omitempty"` + Tags map[string]string `json:"tags,omitempty"` + Timestamp time.Time `json:"timestamp"` + Transaction string `json:"transaction,omitempty"` + User User `json:"user,omitempty"` + Logger string `json:"logger,omitempty"` + Modules map[string]string `json:"modules,omitempty"` + Request *Request `json:"request,omitempty"` + Exception []Exception `json:"exception,omitempty"` + + // The fields below are only relevant for transactions. + + Type string `json:"type,omitempty"` + StartTime time.Time `json:"start_timestamp"` + Spans []*Span `json:"spans,omitempty"` + TransactionInfo *TransactionInfo `json:"transaction_info,omitempty"` + + // The fields below are not part of the final JSON payload. + + sdkMetaData SDKMetaData +} + +// TODO: Event.Contexts map[string]interface{} => map[string]EventContext, +// to prevent accidentally storing T when we mean *T. +// For example, the TraceContext must be stored as *TraceContext to pick up the +// MarshalJSON method (and avoid copying). +// type EventContext interface{ EventContext() } + +// MarshalJSON converts the Event struct to JSON. +func (e *Event) MarshalJSON() ([]byte, error) { + // We want to omit time.Time zero values, otherwise the server will try to + // interpret dates too far in the past. However, encoding/json doesn't + // support the "omitempty" option for struct types. See + // https://golang.org/issues/11939. + // + // We overcome the limitation and achieve what we want by shadowing fields + // and a few type tricks. + if e.Type == transactionType { + return e.transactionMarshalJSON() + } + return e.defaultMarshalJSON() +} + +func (e *Event) defaultMarshalJSON() ([]byte, error) { + // event aliases Event to allow calling json.Marshal without an infinite + // loop. It preserves all fields while none of the attached methods. + type event Event + + // errorEvent is like Event with shadowed fields for customizing JSON + // marshaling. + type errorEvent struct { + *event + + // Timestamp shadows the original Timestamp field. It allows us to + // include the timestamp when non-zero and omit it otherwise. + Timestamp json.RawMessage `json:"timestamp,omitempty"` + + // The fields below are not part of error events and only make sense to + // be sent for transactions. They shadow the respective fields in Event + // and are meant to remain nil, triggering the omitempty behavior. + + Type json.RawMessage `json:"type,omitempty"` + StartTime json.RawMessage `json:"start_timestamp,omitempty"` + Spans json.RawMessage `json:"spans,omitempty"` + TransactionInfo json.RawMessage `json:"transaction_info,omitempty"` + } + + x := errorEvent{event: (*event)(e)} + if !e.Timestamp.IsZero() { + b, err := e.Timestamp.MarshalJSON() + if err != nil { + return nil, err + } + x.Timestamp = b + } + return json.Marshal(x) +} + +func (e *Event) transactionMarshalJSON() ([]byte, error) { + // event aliases Event to allow calling json.Marshal without an infinite + // loop. It preserves all fields while none of the attached methods. + type event Event + + // transactionEvent is like Event with shadowed fields for customizing JSON + // marshaling. + type transactionEvent struct { + *event + + // The fields below shadow the respective fields in Event. They allow us + // to include timestamps when non-zero and omit them otherwise. + + StartTime json.RawMessage `json:"start_timestamp,omitempty"` + Timestamp json.RawMessage `json:"timestamp,omitempty"` + } + + x := transactionEvent{event: (*event)(e)} + if !e.Timestamp.IsZero() { + b, err := e.Timestamp.MarshalJSON() + if err != nil { + return nil, err + } + x.Timestamp = b + } + if !e.StartTime.IsZero() { + b, err := e.StartTime.MarshalJSON() + if err != nil { + return nil, err + } + x.StartTime = b + } + return json.Marshal(x) +} + +// NewEvent creates a new Event. +func NewEvent() *Event { + event := Event{ + Contexts: make(map[string]Context), + Extra: make(map[string]interface{}), + Tags: make(map[string]string), + Modules: make(map[string]string), + } + return &event +} + +// Thread specifies threads that were running at the time of an event. +type Thread struct { + ID string `json:"id,omitempty"` + Name string `json:"name,omitempty"` + Stacktrace *Stacktrace `json:"stacktrace,omitempty"` + Crashed bool `json:"crashed,omitempty"` + Current bool `json:"current,omitempty"` +} + +// EventHint contains information that can be associated with an Event. +type EventHint struct { + Data interface{} + EventID string + OriginalException error + RecoveredException interface{} + Context context.Context + Request *http.Request + Response *http.Response +} diff --git a/vendor/github.com/getsentry/sentry-go/internal/debug/transport.go b/vendor/github.com/getsentry/sentry-go/internal/debug/transport.go new file mode 100644 index 00000000..199c3a30 --- /dev/null +++ b/vendor/github.com/getsentry/sentry-go/internal/debug/transport.go @@ -0,0 +1,79 @@ +package debug + +import ( + "bytes" + "fmt" + "io" + "net/http" + "net/http/httptrace" + "net/http/httputil" +) + +// Transport implements http.RoundTripper and can be used to wrap other HTTP +// transports for debugging, normally http.DefaultTransport. +type Transport struct { + http.RoundTripper + Output io.Writer + // Dump controls whether to dump HTTP request and responses. + Dump bool + // Trace enables usage of net/http/httptrace. + Trace bool +} + +func (t *Transport) RoundTrip(req *http.Request) (*http.Response, error) { + var buf bytes.Buffer + if t.Dump { + b, err := httputil.DumpRequestOut(req, true) + if err != nil { + panic(err) + } + _, err = buf.Write(ensureTrailingNewline(b)) + if err != nil { + panic(err) + } + } + if t.Trace { + trace := &httptrace.ClientTrace{ + DNSDone: func(di httptrace.DNSDoneInfo) { + fmt.Fprintf(&buf, "* DNS %v → %v\n", req.Host, di.Addrs) + }, + GotConn: func(ci httptrace.GotConnInfo) { + fmt.Fprintf(&buf, "* Connection local=%v remote=%v", ci.Conn.LocalAddr(), ci.Conn.RemoteAddr()) + if ci.Reused { + fmt.Fprint(&buf, " (reused)") + } + if ci.WasIdle { + fmt.Fprintf(&buf, " (idle %v)", ci.IdleTime) + } + fmt.Fprintln(&buf) + }, + } + req = req.WithContext(httptrace.WithClientTrace(req.Context(), trace)) + } + resp, err := t.RoundTripper.RoundTrip(req) + if err != nil { + return nil, err + } + if t.Dump { + b, err := httputil.DumpResponse(resp, true) + if err != nil { + panic(err) + } + _, err = buf.Write(ensureTrailingNewline(b)) + if err != nil { + panic(err) + } + } + _, err = io.Copy(t.Output, &buf) + if err != nil { + panic(err) + } + return resp, nil +} + +func ensureTrailingNewline(b []byte) []byte { + if len(b) > 0 && b[len(b)-1] != '\n' { + b = append(b, '\n') + } + return b +} diff --git a/vendor/github.com/getsentry/sentry-go/internal/otel/baggage/baggage.go b/vendor/github.com/getsentry/sentry-go/internal/otel/baggage/baggage.go new file mode 100644 index 00000000..16e8ed0c --- /dev/null +++ b/vendor/github.com/getsentry/sentry-go/internal/otel/baggage/baggage.go @@ -0,0 +1,573 @@ +// This file was vendored in unmodified from +// https://github.com/open-telemetry/opentelemetry-go/blob/c21b6b6bb31a2f74edd06e262f1690f3f6ea3d5c/baggage/baggage.go +// +// # Copyright The OpenTelemetry Authors +// +// Licensed under the Apache License, Version 2.0 (the "License"); +// you may not use this file except in compliance with the License. +// You may obtain a copy of the License at +// +// http://www.apache.org/licenses/LICENSE-2.0 +// +// Unless required by applicable law or agreed to in writing, software +// distributed under the License is distributed on an "AS IS" BASIS, +// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +// See the License for the specific language governing permissions and +// limitations under the License. + +package baggage + +import ( + "errors" + "fmt" + "net/url" + "regexp" + "strings" + + "github.com/getsentry/sentry-go/internal/otel/baggage/internal/baggage" +) + +const ( + maxMembers = 180 + maxBytesPerMembers = 4096 + maxBytesPerBaggageString = 8192 + + listDelimiter = "," + keyValueDelimiter = "=" + propertyDelimiter = ";" + + keyDef = `([\x21\x23-\x27\x2A\x2B\x2D\x2E\x30-\x39\x41-\x5a\x5e-\x7a\x7c\x7e]+)` + valueDef = `([\x21\x23-\x2b\x2d-\x3a\x3c-\x5B\x5D-\x7e]*)` + keyValueDef = `\s*` + keyDef + `\s*` + keyValueDelimiter + `\s*` + valueDef + `\s*` +) + +var ( + keyRe = regexp.MustCompile(`^` + keyDef + `$`) + valueRe = regexp.MustCompile(`^` + valueDef + `$`) + propertyRe = regexp.MustCompile(`^(?:\s*` + keyDef + `\s*|` + keyValueDef + `)$`) +) + +var ( + errInvalidKey = errors.New("invalid key") + errInvalidValue = errors.New("invalid value") + errInvalidProperty = errors.New("invalid baggage list-member property") + errInvalidMember = errors.New("invalid baggage list-member") + errMemberNumber = errors.New("too many list-members in baggage-string") + errMemberBytes = errors.New("list-member too large") + errBaggageBytes = errors.New("baggage-string too large") +) + +// Property is an additional metadata entry for a baggage list-member. +type Property struct { + key, value string + + // hasValue indicates if a zero-value value means the property does not + // have a value or if it was the zero-value. + hasValue bool + + // hasData indicates whether the created property contains data or not. + // Properties that do not contain data are invalid with no other check + // required. + hasData bool +} + +// NewKeyProperty returns a new Property for key. +// +// If key is invalid, an error will be returned. +func NewKeyProperty(key string) (Property, error) { + if !keyRe.MatchString(key) { + return newInvalidProperty(), fmt.Errorf("%w: %q", errInvalidKey, key) + } + + p := Property{key: key, hasData: true} + return p, nil +} + +// NewKeyValueProperty returns a new Property for key with value. +// +// If key or value are invalid, an error will be returned. +func NewKeyValueProperty(key, value string) (Property, error) { + if !keyRe.MatchString(key) { + return newInvalidProperty(), fmt.Errorf("%w: %q", errInvalidKey, key) + } + if !valueRe.MatchString(value) { + return newInvalidProperty(), fmt.Errorf("%w: %q", errInvalidValue, value) + } + + p := Property{ + key: key, + value: value, + hasValue: true, + hasData: true, + } + return p, nil +} + +func newInvalidProperty() Property { + return Property{} +} + +// parseProperty attempts to decode a Property from the passed string. It +// returns an error if the input is invalid according to the W3C Baggage +// specification. +func parseProperty(property string) (Property, error) { + if property == "" { + return newInvalidProperty(), nil + } + + match := propertyRe.FindStringSubmatch(property) + if len(match) != 4 { + return newInvalidProperty(), fmt.Errorf("%w: %q", errInvalidProperty, property) + } + + p := Property{hasData: true} + if match[1] != "" { + p.key = match[1] + } else { + p.key = match[2] + p.value = match[3] + p.hasValue = true + } + + return p, nil +} + +// validate ensures p conforms to the W3C Baggage specification, returning an +// error otherwise. +func (p Property) validate() error { + errFunc := func(err error) error { + return fmt.Errorf("invalid property: %w", err) + } + + if !p.hasData { + return errFunc(fmt.Errorf("%w: %q", errInvalidProperty, p)) + } + + if !keyRe.MatchString(p.key) { + return errFunc(fmt.Errorf("%w: %q", errInvalidKey, p.key)) + } + if p.hasValue && !valueRe.MatchString(p.value) { + return errFunc(fmt.Errorf("%w: %q", errInvalidValue, p.value)) + } + if !p.hasValue && p.value != "" { + return errFunc(errors.New("inconsistent value")) + } + return nil +} + +// Key returns the Property key. +func (p Property) Key() string { + return p.key +} + +// Value returns the Property value. Additionally, a boolean value is returned +// indicating if the returned value is the empty if the Property has a value +// that is empty or if the value is not set. +func (p Property) Value() (string, bool) { + return p.value, p.hasValue +} + +// String encodes Property into a string compliant with the W3C Baggage +// specification. +func (p Property) String() string { + if p.hasValue { + return fmt.Sprintf("%s%s%v", p.key, keyValueDelimiter, p.value) + } + return p.key +} + +type properties []Property + +func fromInternalProperties(iProps []baggage.Property) properties { + if len(iProps) == 0 { + return nil + } + + props := make(properties, len(iProps)) + for i, p := range iProps { + props[i] = Property{ + key: p.Key, + value: p.Value, + hasValue: p.HasValue, + } + } + return props +} + +func (p properties) asInternal() []baggage.Property { + if len(p) == 0 { + return nil + } + + iProps := make([]baggage.Property, len(p)) + for i, prop := range p { + iProps[i] = baggage.Property{ + Key: prop.key, + Value: prop.value, + HasValue: prop.hasValue, + } + } + return iProps +} + +func (p properties) Copy() properties { + if len(p) == 0 { + return nil + } + + props := make(properties, len(p)) + copy(props, p) + return props +} + +// validate ensures each Property in p conforms to the W3C Baggage +// specification, returning an error otherwise. +func (p properties) validate() error { + for _, prop := range p { + if err := prop.validate(); err != nil { + return err + } + } + return nil +} + +// String encodes properties into a string compliant with the W3C Baggage +// specification. +func (p properties) String() string { + props := make([]string, len(p)) + for i, prop := range p { + props[i] = prop.String() + } + return strings.Join(props, propertyDelimiter) +} + +// Member is a list-member of a baggage-string as defined by the W3C Baggage +// specification. +type Member struct { + key, value string + properties properties + + // hasData indicates whether the created property contains data or not. + // Properties that do not contain data are invalid with no other check + // required. + hasData bool +} + +// NewMember returns a new Member from the passed arguments. The key will be +// used directly while the value will be url decoded after validation. An error +// is returned if the created Member would be invalid according to the W3C +// Baggage specification. +func NewMember(key, value string, props ...Property) (Member, error) { + m := Member{ + key: key, + value: value, + properties: properties(props).Copy(), + hasData: true, + } + if err := m.validate(); err != nil { + return newInvalidMember(), err + } + decodedValue, err := url.QueryUnescape(value) + if err != nil { + return newInvalidMember(), fmt.Errorf("%w: %q", errInvalidValue, value) + } + m.value = decodedValue + return m, nil +} + +func newInvalidMember() Member { + return Member{} +} + +// parseMember attempts to decode a Member from the passed string. It returns +// an error if the input is invalid according to the W3C Baggage +// specification. +func parseMember(member string) (Member, error) { + if n := len(member); n > maxBytesPerMembers { + return newInvalidMember(), fmt.Errorf("%w: %d", errMemberBytes, n) + } + + var ( + key, value string + props properties + ) + + parts := strings.SplitN(member, propertyDelimiter, 2) + switch len(parts) { + case 2: + // Parse the member properties. + for _, pStr := range strings.Split(parts[1], propertyDelimiter) { + p, err := parseProperty(pStr) + if err != nil { + return newInvalidMember(), err + } + props = append(props, p) + } + fallthrough + case 1: + // Parse the member key/value pair. + + // Take into account a value can contain equal signs (=). + kv := strings.SplitN(parts[0], keyValueDelimiter, 2) + if len(kv) != 2 { + return newInvalidMember(), fmt.Errorf("%w: %q", errInvalidMember, member) + } + // "Leading and trailing whitespaces are allowed but MUST be trimmed + // when converting the header into a data structure." + key = strings.TrimSpace(kv[0]) + var err error + value, err = url.QueryUnescape(strings.TrimSpace(kv[1])) + if err != nil { + return newInvalidMember(), fmt.Errorf("%w: %q", err, value) + } + if !keyRe.MatchString(key) { + return newInvalidMember(), fmt.Errorf("%w: %q", errInvalidKey, key) + } + if !valueRe.MatchString(value) { + return newInvalidMember(), fmt.Errorf("%w: %q", errInvalidValue, value) + } + default: + // This should never happen unless a developer has changed the string + // splitting somehow. Panic instead of failing silently and allowing + // the bug to slip past the CI checks. + panic("failed to parse baggage member") + } + + return Member{key: key, value: value, properties: props, hasData: true}, nil +} + +// validate ensures m conforms to the W3C Baggage specification. +// A key is just an ASCII string, but a value must be URL encoded UTF-8, +// returning an error otherwise. +func (m Member) validate() error { + if !m.hasData { + return fmt.Errorf("%w: %q", errInvalidMember, m) + } + + if !keyRe.MatchString(m.key) { + return fmt.Errorf("%w: %q", errInvalidKey, m.key) + } + if !valueRe.MatchString(m.value) { + return fmt.Errorf("%w: %q", errInvalidValue, m.value) + } + return m.properties.validate() +} + +// Key returns the Member key. +func (m Member) Key() string { return m.key } + +// Value returns the Member value. +func (m Member) Value() string { return m.value } + +// Properties returns a copy of the Member properties. +func (m Member) Properties() []Property { return m.properties.Copy() } + +// String encodes Member into a string compliant with the W3C Baggage +// specification. +func (m Member) String() string { + // A key is just an ASCII string, but a value is URL encoded UTF-8. + s := fmt.Sprintf("%s%s%s", m.key, keyValueDelimiter, url.QueryEscape(m.value)) + if len(m.properties) > 0 { + s = fmt.Sprintf("%s%s%s", s, propertyDelimiter, m.properties.String()) + } + return s +} + +// Baggage is a list of baggage members representing the baggage-string as +// defined by the W3C Baggage specification. +type Baggage struct { //nolint:golint + list baggage.List +} + +// New returns a new valid Baggage. It returns an error if it results in a +// Baggage exceeding limits set in that specification. +// +// It expects all the provided members to have already been validated. +func New(members ...Member) (Baggage, error) { + if len(members) == 0 { + return Baggage{}, nil + } + + b := make(baggage.List) + for _, m := range members { + if !m.hasData { + return Baggage{}, errInvalidMember + } + + // OpenTelemetry resolves duplicates by last-one-wins. + b[m.key] = baggage.Item{ + Value: m.value, + Properties: m.properties.asInternal(), + } + } + + // Check member numbers after deduplication. + if len(b) > maxMembers { + return Baggage{}, errMemberNumber + } + + bag := Baggage{b} + if n := len(bag.String()); n > maxBytesPerBaggageString { + return Baggage{}, fmt.Errorf("%w: %d", errBaggageBytes, n) + } + + return bag, nil +} + +// Parse attempts to decode a baggage-string from the passed string. It +// returns an error if the input is invalid according to the W3C Baggage +// specification. +// +// If there are duplicate list-members contained in baggage, the last one +// defined (reading left-to-right) will be the only one kept. This diverges +// from the W3C Baggage specification which allows duplicate list-members, but +// conforms to the OpenTelemetry Baggage specification. +func Parse(bStr string) (Baggage, error) { + if bStr == "" { + return Baggage{}, nil + } + + if n := len(bStr); n > maxBytesPerBaggageString { + return Baggage{}, fmt.Errorf("%w: %d", errBaggageBytes, n) + } + + b := make(baggage.List) + for _, memberStr := range strings.Split(bStr, listDelimiter) { + m, err := parseMember(memberStr) + if err != nil { + return Baggage{}, err + } + // OpenTelemetry resolves duplicates by last-one-wins. + b[m.key] = baggage.Item{ + Value: m.value, + Properties: m.properties.asInternal(), + } + } + + // OpenTelemetry does not allow for duplicate list-members, but the W3C + // specification does. Now that we have deduplicated, ensure the baggage + // does not exceed list-member limits. + if len(b) > maxMembers { + return Baggage{}, errMemberNumber + } + + return Baggage{b}, nil +} + +// Member returns the baggage list-member identified by key. +// +// If there is no list-member matching the passed key the returned Member will +// be a zero-value Member. +// The returned member is not validated, as we assume the validation happened +// when it was added to the Baggage. +func (b Baggage) Member(key string) Member { + v, ok := b.list[key] + if !ok { + // We do not need to worry about distinguishing between the situation + // where a zero-valued Member is included in the Baggage because a + // zero-valued Member is invalid according to the W3C Baggage + // specification (it has an empty key). + return newInvalidMember() + } + + return Member{ + key: key, + value: v.Value, + properties: fromInternalProperties(v.Properties), + hasData: true, + } +} + +// Members returns all the baggage list-members. +// The order of the returned list-members does not have significance. +// +// The returned members are not validated, as we assume the validation happened +// when they were added to the Baggage. +func (b Baggage) Members() []Member { + if len(b.list) == 0 { + return nil + } + + members := make([]Member, 0, len(b.list)) + for k, v := range b.list { + members = append(members, Member{ + key: k, + value: v.Value, + properties: fromInternalProperties(v.Properties), + hasData: true, + }) + } + return members +} + +// SetMember returns a copy the Baggage with the member included. If the +// baggage contains a Member with the same key the existing Member is +// replaced. +// +// If member is invalid according to the W3C Baggage specification, an error +// is returned with the original Baggage. +func (b Baggage) SetMember(member Member) (Baggage, error) { + if !member.hasData { + return b, errInvalidMember + } + + n := len(b.list) + if _, ok := b.list[member.key]; !ok { + n++ + } + list := make(baggage.List, n) + + for k, v := range b.list { + // Do not copy if we are just going to overwrite. + if k == member.key { + continue + } + list[k] = v + } + + list[member.key] = baggage.Item{ + Value: member.value, + Properties: member.properties.asInternal(), + } + + return Baggage{list: list}, nil +} + +// DeleteMember returns a copy of the Baggage with the list-member identified +// by key removed. +func (b Baggage) DeleteMember(key string) Baggage { + n := len(b.list) + if _, ok := b.list[key]; ok { + n-- + } + list := make(baggage.List, n) + + for k, v := range b.list { + if k == key { + continue + } + list[k] = v + } + + return Baggage{list: list} +} + +// Len returns the number of list-members in the Baggage. +func (b Baggage) Len() int { + return len(b.list) +} + +// String encodes Baggage into a string compliant with the W3C Baggage +// specification. The returned string will be invalid if the Baggage contains +// any invalid list-members. +func (b Baggage) String() string { + members := make([]string, 0, len(b.list)) + for k, v := range b.list { + members = append(members, Member{ + key: k, + value: v.Value, + properties: fromInternalProperties(v.Properties), + }.String()) + } + return strings.Join(members, listDelimiter) +} diff --git a/vendor/github.com/getsentry/sentry-go/internal/otel/baggage/internal/baggage/baggage.go b/vendor/github.com/getsentry/sentry-go/internal/otel/baggage/internal/baggage/baggage.go new file mode 100644 index 00000000..04e41402 --- /dev/null +++ b/vendor/github.com/getsentry/sentry-go/internal/otel/baggage/internal/baggage/baggage.go @@ -0,0 +1,46 @@ +// This file was vendored in unmodified from +// https://github.com/open-telemetry/opentelemetry-go/blob/c21b6b6bb31a2f74edd06e262f1690f3f6ea3d5c/internal/baggage/baggage.go +// +// Copyright The OpenTelemetry Authors +// +// Licensed under the Apache License, Version 2.0 (the "License"); +// you may not use this file except in compliance with the License. +// You may obtain a copy of the License at +// +// http://www.apache.org/licenses/LICENSE-2.0 +// +// Unless required by applicable law or agreed to in writing, software +// distributed under the License is distributed on an "AS IS" BASIS, +// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. +// See the License for the specific language governing permissions and +// limitations under the License. + +/* +Package baggage provides base types and functionality to store and retrieve +baggage in Go context. This package exists because the OpenTracing bridge to +OpenTelemetry needs to synchronize state whenever baggage for a context is +modified and that context contains an OpenTracing span. If it were not for +this need this package would not need to exist and the +`go.opentelemetry.io/otel/baggage` package would be the singular place where +W3C baggage is handled. +*/ +package baggage + +// List is the collection of baggage members. The W3C allows for duplicates, +// but OpenTelemetry does not, therefore, this is represented as a map. +type List map[string]Item + +// Item is the value and metadata properties part of a list-member. +type Item struct { + Value string + Properties []Property +} + +// Property is a metadata entry for a list-member. +type Property struct { + Key, Value string + + // HasValue indicates if a zero-value value means the property does not + // have a value or if it was the zero-value. + HasValue bool +} diff --git a/vendor/github.com/getsentry/sentry-go/internal/ratelimit/category.go b/vendor/github.com/getsentry/sentry-go/internal/ratelimit/category.go new file mode 100644 index 00000000..cf5dff50 --- /dev/null +++ b/vendor/github.com/getsentry/sentry-go/internal/ratelimit/category.go @@ -0,0 +1,46 @@ +package ratelimit + +import ( + "strings" + + "golang.org/x/text/cases" + "golang.org/x/text/language" +) + +// Reference: +// https://github.com/getsentry/relay/blob/0424a2e017d193a93918053c90cdae9472d164bf/relay-common/src/constants.rs#L116-L127 + +// Category classifies supported payload types that can be ingested by Sentry +// and, therefore, rate limited. +type Category string + +// Known rate limit categories. As a special case, the CategoryAll applies to +// all known payload types. +const ( + CategoryAll Category = "" + CategoryError Category = "error" + CategoryTransaction Category = "transaction" +) + +// knownCategories is the set of currently known categories. Other categories +// are ignored for the purpose of rate-limiting. +var knownCategories = map[Category]struct{}{ + CategoryAll: {}, + CategoryError: {}, + CategoryTransaction: {}, +} + +// String returns the category formatted for debugging. +func (c Category) String() string { + switch c { + case "": + return "CategoryAll" + default: + caser := cases.Title(language.English) + rv := "Category" + for _, w := range strings.Fields(string(c)) { + rv += caser.String(w) + } + return rv + } +} diff --git a/vendor/github.com/getsentry/sentry-go/internal/ratelimit/deadline.go b/vendor/github.com/getsentry/sentry-go/internal/ratelimit/deadline.go new file mode 100644 index 00000000..c0025833 --- /dev/null +++ b/vendor/github.com/getsentry/sentry-go/internal/ratelimit/deadline.go @@ -0,0 +1,22 @@ +package ratelimit + +import "time" + +// A Deadline is a time instant when a rate limit expires. +type Deadline time.Time + +// After reports whether the deadline d is after other. +func (d Deadline) After(other Deadline) bool { + return time.Time(d).After(time.Time(other)) +} + +// Equal reports whether d and e represent the same deadline. +func (d Deadline) Equal(e Deadline) bool { + return time.Time(d).Equal(time.Time(e)) +} + +// String returns the deadline formatted for debugging. +func (d Deadline) String() string { + // Like time.Time.String, but without the monotonic clock reading. + return time.Time(d).Round(0).String() +} diff --git a/vendor/github.com/getsentry/sentry-go/internal/ratelimit/doc.go b/vendor/github.com/getsentry/sentry-go/internal/ratelimit/doc.go new file mode 100644 index 00000000..80b9fdda --- /dev/null +++ b/vendor/github.com/getsentry/sentry-go/internal/ratelimit/doc.go @@ -0,0 +1,3 @@ +// Package ratelimit provides tools to work with rate limits imposed by Sentry's +// data ingestion pipeline. +package ratelimit diff --git a/vendor/github.com/getsentry/sentry-go/internal/ratelimit/map.go b/vendor/github.com/getsentry/sentry-go/internal/ratelimit/map.go new file mode 100644 index 00000000..e590430e --- /dev/null +++ b/vendor/github.com/getsentry/sentry-go/internal/ratelimit/map.go @@ -0,0 +1,64 @@ +package ratelimit + +import ( + "net/http" + "time" +) + +// Map maps categories to rate limit deadlines. +// +// A rate limit is in effect for a given category if either the category's +// deadline or the deadline for the special CategoryAll has not yet expired. +// +// Use IsRateLimited to check whether a category is rate-limited. +type Map map[Category]Deadline + +// IsRateLimited returns true if the category is currently rate limited. +func (m Map) IsRateLimited(c Category) bool { + return m.isRateLimited(c, time.Now()) +} + +func (m Map) isRateLimited(c Category, now time.Time) bool { + return m.Deadline(c).After(Deadline(now)) +} + +// Deadline returns the deadline when the rate limit for the given category or +// the special CategoryAll expire, whichever is furthest into the future. +func (m Map) Deadline(c Category) Deadline { + categoryDeadline := m[c] + allDeadline := m[CategoryAll] + if categoryDeadline.After(allDeadline) { + return categoryDeadline + } + return allDeadline +} + +// Merge merges the other map into m. +// +// If a category appears in both maps, the deadline that is furthest into the +// future is preserved. +func (m Map) Merge(other Map) { + for c, d := range other { + if d.After(m[c]) { + m[c] = d + } + } +} + +// FromResponse returns a rate limit map from an HTTP response. +func FromResponse(r *http.Response) Map { + return fromResponse(r, time.Now()) +} + +func fromResponse(r *http.Response, now time.Time) Map { + s := r.Header.Get("X-Sentry-Rate-Limits") + if s != "" { + return parseXSentryRateLimits(s, now) + } + if r.StatusCode == http.StatusTooManyRequests { + s := r.Header.Get("Retry-After") + deadline, _ := parseRetryAfter(s, now) + return Map{CategoryAll: deadline} + } + return Map{} +} diff --git a/vendor/github.com/getsentry/sentry-go/internal/ratelimit/rate_limits.go b/vendor/github.com/getsentry/sentry-go/internal/ratelimit/rate_limits.go new file mode 100644 index 00000000..2dcda27c --- /dev/null +++ b/vendor/github.com/getsentry/sentry-go/internal/ratelimit/rate_limits.go @@ -0,0 +1,76 @@ +package ratelimit + +import ( + "errors" + "math" + "strconv" + "strings" + "time" +) + +var errInvalidXSRLRetryAfter = errors.New("invalid retry-after value") + +// parseXSentryRateLimits returns a RateLimits map by parsing an input string in +// the format of the X-Sentry-Rate-Limits header. +// +// Example +// +// X-Sentry-Rate-Limits: 60:transaction, 2700:default;error;security +// +// This will rate limit transactions for the next 60 seconds and errors for the +// next 2700 seconds. +// +// Limits for unknown categories are ignored. +func parseXSentryRateLimits(s string, now time.Time) Map { + // https://github.com/getsentry/relay/blob/0424a2e017d193a93918053c90cdae9472d164bf/relay-server/src/utils/rate_limits.rs#L44-L82 + m := make(Map, len(knownCategories)) + for _, limit := range strings.Split(s, ",") { + limit = strings.TrimSpace(limit) + if limit == "" { + continue + } + components := strings.Split(limit, ":") + if len(components) == 0 { + continue + } + retryAfter, err := parseXSRLRetryAfter(strings.TrimSpace(components[0]), now) + if err != nil { + continue + } + categories := "" + if len(components) > 1 { + categories = components[1] + } + for _, category := range strings.Split(categories, ";") { + c := Category(strings.ToLower(strings.TrimSpace(category))) + if _, ok := knownCategories[c]; !ok { + // skip unknown categories, keep m small + continue + } + // always keep the deadline furthest into the future + if retryAfter.After(m[c]) { + m[c] = retryAfter + } + } + } + return m +} + +// parseXSRLRetryAfter parses a string into a retry-after rate limit deadline. +// +// Valid input is a number, possibly signed and possibly floating-point, +// indicating the number of seconds to wait before sending another request. +// Negative values are treated as zero. Fractional values are rounded to the +// next integer. +func parseXSRLRetryAfter(s string, now time.Time) (Deadline, error) { + // https://github.com/getsentry/relay/blob/0424a2e017d193a93918053c90cdae9472d164bf/relay-quotas/src/rate_limit.rs#L88-L96 + f, err := strconv.ParseFloat(s, 64) + if err != nil { + return Deadline{}, errInvalidXSRLRetryAfter + } + d := time.Duration(math.Ceil(math.Max(f, 0.0))) * time.Second + if d < 0 { + d = 0 + } + return Deadline(now.Add(d)), nil +} diff --git a/vendor/github.com/getsentry/sentry-go/internal/ratelimit/retry_after.go b/vendor/github.com/getsentry/sentry-go/internal/ratelimit/retry_after.go new file mode 100644 index 00000000..576e29dc --- /dev/null +++ b/vendor/github.com/getsentry/sentry-go/internal/ratelimit/retry_after.go @@ -0,0 +1,40 @@ +package ratelimit + +import ( + "errors" + "strconv" + "time" +) + +const defaultRetryAfter = 1 * time.Minute + +var errInvalidRetryAfter = errors.New("invalid input") + +// parseRetryAfter parses a string s as in the standard Retry-After HTTP header +// and returns a deadline until when requests are rate limited and therefore new +// requests should not be sent. The input may be either a date or a non-negative +// integer number of seconds. +// +// See https://developer.mozilla.org/en-US/docs/Web/HTTP/Headers/Retry-After +// +// parseRetryAfter always returns a usable deadline, even in case of an error. +// +// This is the original rate limiting mechanism used by Sentry, superseeded by +// the X-Sentry-Rate-Limits response header. +func parseRetryAfter(s string, now time.Time) (Deadline, error) { + if s == "" { + goto invalid + } + if n, err := strconv.Atoi(s); err == nil { + if n < 0 { + goto invalid + } + d := time.Duration(n) * time.Second + return Deadline(now.Add(d)), nil + } + if date, err := time.Parse(time.RFC1123, s); err == nil { + return Deadline(date), nil + } +invalid: + return Deadline(now.Add(defaultRetryAfter)), errInvalidRetryAfter +} diff --git a/vendor/github.com/getsentry/sentry-go/scope.go b/vendor/github.com/getsentry/sentry-go/scope.go new file mode 100644 index 00000000..063047b9 --- /dev/null +++ b/vendor/github.com/getsentry/sentry-go/scope.go @@ -0,0 +1,428 @@ +package sentry + +import ( + "bytes" + "io" + "net/http" + "sync" + "time" +) + +// Scope holds contextual data for the current scope. +// +// The scope is an object that can cloned efficiently and stores data that is +// locally relevant to an event. For instance the scope will hold recorded +// breadcrumbs and similar information. +// +// The scope can be interacted with in two ways. First, the scope is routinely +// updated with information by functions such as AddBreadcrumb which will modify +// the current scope. Second, the current scope can be configured through the +// ConfigureScope function or Hub method of the same name. +// +// The scope is meant to be modified but not inspected directly. When preparing +// an event for reporting, the current client adds information from the current +// scope into the event. +type Scope struct { + mu sync.RWMutex + breadcrumbs []*Breadcrumb + user User + tags map[string]string + contexts map[string]Context + extra map[string]interface{} + fingerprint []string + level Level + transaction string + request *http.Request + // requestBody holds a reference to the original request.Body. + requestBody interface { + // Bytes returns bytes from the original body, lazily buffered as the + // original body is read. + Bytes() []byte + // Overflow returns true if the body is larger than the maximum buffer + // size. + Overflow() bool + } + eventProcessors []EventProcessor +} + +// NewScope creates a new Scope. +func NewScope() *Scope { + scope := Scope{ + breadcrumbs: make([]*Breadcrumb, 0), + tags: make(map[string]string), + contexts: make(map[string]Context), + extra: make(map[string]interface{}), + fingerprint: make([]string, 0), + } + + return &scope +} + +// AddBreadcrumb adds new breadcrumb to the current scope +// and optionally throws the old one if limit is reached. +func (scope *Scope) AddBreadcrumb(breadcrumb *Breadcrumb, limit int) { + if breadcrumb.Timestamp.IsZero() { + breadcrumb.Timestamp = time.Now() + } + + scope.mu.Lock() + defer scope.mu.Unlock() + + scope.breadcrumbs = append(scope.breadcrumbs, breadcrumb) + if len(scope.breadcrumbs) > limit { + scope.breadcrumbs = scope.breadcrumbs[1 : limit+1] + } +} + +// ClearBreadcrumbs clears all breadcrumbs from the current scope. +func (scope *Scope) ClearBreadcrumbs() { + scope.mu.Lock() + defer scope.mu.Unlock() + + scope.breadcrumbs = []*Breadcrumb{} +} + +// SetUser sets the user for the current scope. +func (scope *Scope) SetUser(user User) { + scope.mu.Lock() + defer scope.mu.Unlock() + + scope.user = user +} + +// SetRequest sets the request for the current scope. +func (scope *Scope) SetRequest(r *http.Request) { + scope.mu.Lock() + defer scope.mu.Unlock() + + scope.request = r + + if r == nil { + return + } + + // Don't buffer request body if we know it is oversized. + if r.ContentLength > maxRequestBodyBytes { + return + } + // Don't buffer if there is no body. + if r.Body == nil || r.Body == http.NoBody { + return + } + buf := &limitedBuffer{Capacity: maxRequestBodyBytes} + r.Body = readCloser{ + Reader: io.TeeReader(r.Body, buf), + Closer: r.Body, + } + scope.requestBody = buf +} + +// SetRequestBody sets the request body for the current scope. +// +// This method should only be called when the body bytes are already available +// in memory. Typically, the request body is buffered lazily from the +// Request.Body from SetRequest. +func (scope *Scope) SetRequestBody(b []byte) { + scope.mu.Lock() + defer scope.mu.Unlock() + + capacity := maxRequestBodyBytes + overflow := false + if len(b) > capacity { + overflow = true + b = b[:capacity] + } + scope.requestBody = &limitedBuffer{ + Capacity: capacity, + Buffer: *bytes.NewBuffer(b), + overflow: overflow, + } +} + +// maxRequestBodyBytes is the default maximum request body size to send to +// Sentry. +const maxRequestBodyBytes = 10 * 1024 + +// A limitedBuffer is like a bytes.Buffer, but limited to store at most Capacity +// bytes. Any writes past the capacity are silently discarded, similar to +// io.Discard. +type limitedBuffer struct { + Capacity int + + bytes.Buffer + overflow bool +} + +// Write implements io.Writer. +func (b *limitedBuffer) Write(p []byte) (n int, err error) { + // Silently ignore writes after overflow. + if b.overflow { + return len(p), nil + } + left := b.Capacity - b.Len() + if left < 0 { + left = 0 + } + if len(p) > left { + b.overflow = true + p = p[:left] + } + return b.Buffer.Write(p) +} + +// Overflow returns true if the limitedBuffer discarded bytes written to it. +func (b *limitedBuffer) Overflow() bool { + return b.overflow +} + +// readCloser combines an io.Reader and an io.Closer to implement io.ReadCloser. +type readCloser struct { + io.Reader + io.Closer +} + +// SetTag adds a tag to the current scope. +func (scope *Scope) SetTag(key, value string) { + scope.mu.Lock() + defer scope.mu.Unlock() + + scope.tags[key] = value +} + +// SetTags assigns multiple tags to the current scope. +func (scope *Scope) SetTags(tags map[string]string) { + scope.mu.Lock() + defer scope.mu.Unlock() + + for k, v := range tags { + scope.tags[k] = v + } +} + +// RemoveTag removes a tag from the current scope. +func (scope *Scope) RemoveTag(key string) { + scope.mu.Lock() + defer scope.mu.Unlock() + + delete(scope.tags, key) +} + +// SetContext adds a context to the current scope. +func (scope *Scope) SetContext(key string, value Context) { + scope.mu.Lock() + defer scope.mu.Unlock() + + scope.contexts[key] = value +} + +// SetContexts assigns multiple contexts to the current scope. +func (scope *Scope) SetContexts(contexts map[string]Context) { + scope.mu.Lock() + defer scope.mu.Unlock() + + for k, v := range contexts { + scope.contexts[k] = v + } +} + +// RemoveContext removes a context from the current scope. +func (scope *Scope) RemoveContext(key string) { + scope.mu.Lock() + defer scope.mu.Unlock() + + delete(scope.contexts, key) +} + +// SetExtra adds an extra to the current scope. +func (scope *Scope) SetExtra(key string, value interface{}) { + scope.mu.Lock() + defer scope.mu.Unlock() + + scope.extra[key] = value +} + +// SetExtras assigns multiple extras to the current scope. +func (scope *Scope) SetExtras(extra map[string]interface{}) { + scope.mu.Lock() + defer scope.mu.Unlock() + + for k, v := range extra { + scope.extra[k] = v + } +} + +// RemoveExtra removes a extra from the current scope. +func (scope *Scope) RemoveExtra(key string) { + scope.mu.Lock() + defer scope.mu.Unlock() + + delete(scope.extra, key) +} + +// SetFingerprint sets new fingerprint for the current scope. +func (scope *Scope) SetFingerprint(fingerprint []string) { + scope.mu.Lock() + defer scope.mu.Unlock() + + scope.fingerprint = fingerprint +} + +// SetLevel sets new level for the current scope. +func (scope *Scope) SetLevel(level Level) { + scope.mu.Lock() + defer scope.mu.Unlock() + + scope.level = level +} + +// SetTransaction sets the transaction name for the current transaction. +func (scope *Scope) SetTransaction(name string) { + scope.mu.Lock() + defer scope.mu.Unlock() + + scope.transaction = name +} + +// Transaction returns the transaction name for the current transaction. +func (scope *Scope) Transaction() (name string) { + scope.mu.RLock() + defer scope.mu.RUnlock() + + return scope.transaction +} + +// Clone returns a copy of the current scope with all data copied over. +func (scope *Scope) Clone() *Scope { + scope.mu.RLock() + defer scope.mu.RUnlock() + + clone := NewScope() + clone.user = scope.user + clone.breadcrumbs = make([]*Breadcrumb, len(scope.breadcrumbs)) + copy(clone.breadcrumbs, scope.breadcrumbs) + for key, value := range scope.tags { + clone.tags[key] = value + } + for key, value := range scope.contexts { + clone.contexts[key] = value + } + for key, value := range scope.extra { + clone.extra[key] = value + } + clone.fingerprint = make([]string, len(scope.fingerprint)) + copy(clone.fingerprint, scope.fingerprint) + clone.level = scope.level + clone.transaction = scope.transaction + clone.request = scope.request + clone.requestBody = scope.requestBody + clone.eventProcessors = scope.eventProcessors + return clone +} + +// Clear removes the data from the current scope. Not safe for concurrent use. +func (scope *Scope) Clear() { + *scope = *NewScope() +} + +// AddEventProcessor adds an event processor to the current scope. +func (scope *Scope) AddEventProcessor(processor EventProcessor) { + scope.mu.Lock() + defer scope.mu.Unlock() + + scope.eventProcessors = append(scope.eventProcessors, processor) +} + +// ApplyToEvent takes the data from the current scope and attaches it to the event. +func (scope *Scope) ApplyToEvent(event *Event, hint *EventHint) *Event { + scope.mu.RLock() + defer scope.mu.RUnlock() + + if len(scope.breadcrumbs) > 0 { + event.Breadcrumbs = append(event.Breadcrumbs, scope.breadcrumbs...) + } + + if len(scope.tags) > 0 { + if event.Tags == nil { + event.Tags = make(map[string]string, len(scope.tags)) + } + + for key, value := range scope.tags { + event.Tags[key] = value + } + } + + if len(scope.contexts) > 0 { + if event.Contexts == nil { + event.Contexts = make(map[string]Context) + } + + for key, value := range scope.contexts { + if key == "trace" && event.Type == transactionType { + // Do not override trace context of + // transactions, otherwise it breaks the + // transaction event representation. + // For error events, the trace context is used + // to link errors and traces/spans in Sentry. + continue + } + + // Ensure we are not overwriting event fields + if _, ok := event.Contexts[key]; !ok { + event.Contexts[key] = value + } + } + } + + if len(scope.extra) > 0 { + if event.Extra == nil { + event.Extra = make(map[string]interface{}, len(scope.extra)) + } + + for key, value := range scope.extra { + event.Extra[key] = value + } + } + + if event.User.IsEmpty() { + event.User = scope.user + } + + if len(event.Fingerprint) == 0 { + event.Fingerprint = append(event.Fingerprint, scope.fingerprint...) + } + + if scope.level != "" { + event.Level = scope.level + } + + if scope.transaction != "" { + event.Transaction = scope.transaction + } + + if event.Request == nil && scope.request != nil { + event.Request = NewRequest(scope.request) + // NOTE: The SDK does not attempt to send partial request body data. + // + // The reason being that Sentry's ingest pipeline and UI are optimized + // to show structured data. Additionally, tooling around PII scrubbing + // relies on structured data; truncated request bodies would create + // invalid payloads that are more prone to leaking PII data. + // + // Users can still send more data along their events if they want to, + // for example using Event.Extra. + if scope.requestBody != nil && !scope.requestBody.Overflow() { + event.Request.Data = string(scope.requestBody.Bytes()) + } + } + + for _, processor := range scope.eventProcessors { + id := event.EventID + event = processor(event, hint) + if event == nil { + Logger.Printf("Event dropped by one of the Scope EventProcessors: %s\n", id) + return nil + } + } + + return event +} diff --git a/vendor/github.com/getsentry/sentry-go/sentry.go b/vendor/github.com/getsentry/sentry-go/sentry.go new file mode 100644 index 00000000..ccceca85 --- /dev/null +++ b/vendor/github.com/getsentry/sentry-go/sentry.go @@ -0,0 +1,136 @@ +package sentry + +import ( + "context" + "time" +) + +// Deprecated: Use SDKVersion instead. +const Version = SDKVersion + +// Version is the version of the SDK. +const SDKVersion = "0.16.0" + +// The identifier of the SDK. +const SDKIdentifier = "sentry.go" + +// apiVersion is the minimum version of the Sentry API compatible with the +// sentry-go SDK. +const apiVersion = "7" + +// userAgent is the User-Agent of outgoing HTTP requests. +const userAgent = "sentry-go/" + SDKVersion + +// Init initializes the SDK with options. The returned error is non-nil if +// options is invalid, for instance if a malformed DSN is provided. +func Init(options ClientOptions) error { + hub := CurrentHub() + client, err := NewClient(options) + if err != nil { + return err + } + hub.BindClient(client) + return nil +} + +// AddBreadcrumb records a new breadcrumb. +// +// The total number of breadcrumbs that can be recorded are limited by the +// configuration on the client. +func AddBreadcrumb(breadcrumb *Breadcrumb) { + hub := CurrentHub() + hub.AddBreadcrumb(breadcrumb, nil) +} + +// CaptureMessage captures an arbitrary message. +func CaptureMessage(message string) *EventID { + hub := CurrentHub() + return hub.CaptureMessage(message) +} + +// CaptureException captures an error. +func CaptureException(exception error) *EventID { + hub := CurrentHub() + return hub.CaptureException(exception) +} + +// CaptureEvent captures an event on the currently active client if any. +// +// The event must already be assembled. Typically code would instead use +// the utility methods like CaptureException. The return value is the +// event ID. In case Sentry is disabled or event was dropped, the return value will be nil. +func CaptureEvent(event *Event) *EventID { + hub := CurrentHub() + return hub.CaptureEvent(event) +} + +// Recover captures a panic. +func Recover() *EventID { + if err := recover(); err != nil { + hub := CurrentHub() + return hub.Recover(err) + } + return nil +} + +// RecoverWithContext captures a panic and passes relevant context object. +func RecoverWithContext(ctx context.Context) *EventID { + if err := recover(); err != nil { + var hub *Hub + + if HasHubOnContext(ctx) { + hub = GetHubFromContext(ctx) + } else { + hub = CurrentHub() + } + + return hub.RecoverWithContext(ctx, err) + } + return nil +} + +// WithScope is a shorthand for CurrentHub().WithScope. +func WithScope(f func(scope *Scope)) { + hub := CurrentHub() + hub.WithScope(f) +} + +// ConfigureScope is a shorthand for CurrentHub().ConfigureScope. +func ConfigureScope(f func(scope *Scope)) { + hub := CurrentHub() + hub.ConfigureScope(f) +} + +// PushScope is a shorthand for CurrentHub().PushScope. +func PushScope() { + hub := CurrentHub() + hub.PushScope() +} + +// PopScope is a shorthand for CurrentHub().PopScope. +func PopScope() { + hub := CurrentHub() + hub.PopScope() +} + +// Flush waits until the underlying Transport sends any buffered events to the +// Sentry server, blocking for at most the given timeout. It returns false if +// the timeout was reached. In that case, some events may not have been sent. +// +// Flush should be called before terminating the program to avoid +// unintentionally dropping events. +// +// Do not call Flush indiscriminately after every call to CaptureEvent, +// CaptureException or CaptureMessage. Instead, to have the SDK send events over +// the network synchronously, configure it to use the HTTPSyncTransport in the +// call to Init. +func Flush(timeout time.Duration) bool { + hub := CurrentHub() + return hub.Flush(timeout) +} + +// LastEventID returns an ID of last captured event. +func LastEventID() EventID { + hub := CurrentHub() + return hub.LastEventID() +} diff --git a/vendor/github.com/getsentry/sentry-go/sourcereader.go b/vendor/github.com/getsentry/sentry-go/sourcereader.go new file mode 100644 index 00000000..74a08384 --- /dev/null +++ b/vendor/github.com/getsentry/sentry-go/sourcereader.go @@ -0,0 +1,70 @@ +package sentry + +import ( + "bytes" + "os" + "sync" +) + +type sourceReader struct { + mu sync.Mutex + cache map[string][][]byte +} + +func newSourceReader() sourceReader { + return sourceReader{ + cache: make(map[string][][]byte), + } +} + +func (sr *sourceReader) readContextLines(filename string, line, context int) ([][]byte, int) { + sr.mu.Lock() + defer sr.mu.Unlock() + + lines, ok := sr.cache[filename] + + if !ok { + data, err := os.ReadFile(filename) + if err != nil { + sr.cache[filename] = nil + return nil, 0 + } + lines = bytes.Split(data, []byte{'\n'}) + sr.cache[filename] = lines + } + + return sr.calculateContextLines(lines, line, context) +} + +func (sr *sourceReader) calculateContextLines(lines [][]byte, line, context int) ([][]byte, int) { + // Stacktrace lines are 1-indexed, slices are 0-indexed + line-- + + // contextLine points to a line that caused an issue itself, in relation to + // returned slice. + contextLine := context + + if lines == nil || line >= len(lines) || line < 0 { + return nil, 0 + } + + if context < 0 { + context = 0 + contextLine = 0 + } + + start := line - context + + if start < 0 { + contextLine += start + start = 0 + } + + end := line + context + 1 + + if end > len(lines) { + end = len(lines) + } + + return lines[start:end], contextLine +} diff --git a/vendor/github.com/getsentry/sentry-go/span_recorder.go b/vendor/github.com/getsentry/sentry-go/span_recorder.go new file mode 100644 index 00000000..137aa233 --- /dev/null +++ b/vendor/github.com/getsentry/sentry-go/span_recorder.go @@ -0,0 +1,56 @@ +package sentry + +import ( + "sync" +) + +// A spanRecorder stores a span tree that makes up a transaction. Safe for +// concurrent use. It is okay to add child spans from multiple goroutines. +type spanRecorder struct { + mu sync.Mutex + spans []*Span + overflowOnce sync.Once +} + +// record stores a span. The first stored span is assumed to be the root of a +// span tree. +func (r *spanRecorder) record(s *Span) { + maxSpans := defaultMaxSpans + if client := CurrentHub().Client(); client != nil { + maxSpans = client.Options().MaxSpans + } + r.mu.Lock() + defer r.mu.Unlock() + if len(r.spans) >= maxSpans { + r.overflowOnce.Do(func() { + root := r.spans[0] + Logger.Printf("Too many spans: dropping spans from transaction with TraceID=%s SpanID=%s limit=%d", + root.TraceID, root.SpanID, maxSpans) + }) + // TODO(tracing): mark the transaction event in some way to + // communicate that spans were dropped. + return + } + r.spans = append(r.spans, s) +} + +// root returns the first recorded span. Returns nil if none have been recorded. +func (r *spanRecorder) root() *Span { + r.mu.Lock() + defer r.mu.Unlock() + if len(r.spans) == 0 { + return nil + } + return r.spans[0] +} + +// children returns a list of all recorded spans, except the root. Returns nil +// if there are no children. +func (r *spanRecorder) children() []*Span { + r.mu.Lock() + defer r.mu.Unlock() + if len(r.spans) < 2 { + return nil + } + return r.spans[1:] +} diff --git a/vendor/github.com/getsentry/sentry-go/stacktrace.go b/vendor/github.com/getsentry/sentry-go/stacktrace.go new file mode 100644 index 00000000..8c256ec9 --- /dev/null +++ b/vendor/github.com/getsentry/sentry-go/stacktrace.go @@ -0,0 +1,343 @@ +package sentry + +import ( + "go/build" + "path/filepath" + "reflect" + "runtime" + "strings" +) + +const unknown string = "unknown" + +// The module download is split into two parts: downloading the go.mod and downloading the actual code. +// If you have dependencies only needed for tests, then they will show up in your go.mod, +// and go get will download their go.mods, but it will not download their code. +// The test-only dependencies get downloaded only when you need it, such as the first time you run go test. +// +// https://github.com/golang/go/issues/26913#issuecomment-411976222 + +// Stacktrace holds information about the frames of the stack. +type Stacktrace struct { + Frames []Frame `json:"frames,omitempty"` + FramesOmitted []uint `json:"frames_omitted,omitempty"` +} + +// NewStacktrace creates a stacktrace using runtime.Callers. +func NewStacktrace() *Stacktrace { + pcs := make([]uintptr, 100) + n := runtime.Callers(1, pcs) + + if n == 0 { + return nil + } + + frames := extractFrames(pcs[:n]) + frames = filterFrames(frames) + + stacktrace := Stacktrace{ + Frames: frames, + } + + return &stacktrace +} + +// TODO: Make it configurable so that anyone can provide their own implementation? +// Use of reflection allows us to not have a hard dependency on any given +// package, so we don't have to import it. + +// ExtractStacktrace creates a new Stacktrace based on the given error. +func ExtractStacktrace(err error) *Stacktrace { + method := extractReflectedStacktraceMethod(err) + + var pcs []uintptr + + if method.IsValid() { + pcs = extractPcs(method) + } else { + pcs = extractXErrorsPC(err) + } + + if len(pcs) == 0 { + return nil + } + + frames := extractFrames(pcs) + frames = filterFrames(frames) + + stacktrace := Stacktrace{ + Frames: frames, + } + + return &stacktrace +} + +func extractReflectedStacktraceMethod(err error) reflect.Value { + errValue := reflect.ValueOf(err) + + // https://github.com/go-errors/errors + methodStackFrames := errValue.MethodByName("StackFrames") + if methodStackFrames.IsValid() { + return methodStackFrames + } + + // https://github.com/pkg/errors + methodStackTrace := errValue.MethodByName("StackTrace") + if methodStackTrace.IsValid() { + return methodStackTrace + } + + // https://github.com/pingcap/errors + methodGetStackTracer := errValue.MethodByName("GetStackTracer") + if methodGetStackTracer.IsValid() { + stacktracer := methodGetStackTracer.Call(nil)[0] + stacktracerStackTrace := reflect.ValueOf(stacktracer).MethodByName("StackTrace") + + if stacktracerStackTrace.IsValid() { + return stacktracerStackTrace + } + } + + return reflect.Value{} +} + +func extractPcs(method reflect.Value) []uintptr { + var pcs []uintptr + + stacktrace := method.Call(nil)[0] + + if stacktrace.Kind() != reflect.Slice { + return nil + } + + for i := 0; i < stacktrace.Len(); i++ { + pc := stacktrace.Index(i) + + switch pc.Kind() { + case reflect.Uintptr: + pcs = append(pcs, uintptr(pc.Uint())) + case reflect.Struct: + for _, fieldName := range []string{"ProgramCounter", "PC"} { + field := pc.FieldByName(fieldName) + if !field.IsValid() { + continue + } + if field.Kind() == reflect.Uintptr { + pcs = append(pcs, uintptr(field.Uint())) + break + } + } + } + } + + return pcs +} + +// extractXErrorsPC extracts program counters from error values compatible with +// the error types from golang.org/x/xerrors. +// +// It returns nil if err is not compatible with errors from that package or if +// no program counters are stored in err. +func extractXErrorsPC(err error) []uintptr { + // This implementation uses the reflect package to avoid a hard dependency + // on third-party packages. + + // We don't know if err matches the expected type. For simplicity, instead + // of trying to account for all possible ways things can go wrong, some + // assumptions are made and if they are violated the code will panic. We + // recover from any panic and ignore it, returning nil. + //nolint: errcheck + defer func() { recover() }() + + field := reflect.ValueOf(err).Elem().FieldByName("frame") // type Frame struct{ frames [3]uintptr } + field = field.FieldByName("frames") + field = field.Slice(1, field.Len()) // drop first pc pointing to xerrors.New + pc := make([]uintptr, field.Len()) + for i := 0; i < field.Len(); i++ { + pc[i] = uintptr(field.Index(i).Uint()) + } + return pc +} + +// Frame represents a function call and it's metadata. Frames are associated +// with a Stacktrace. +type Frame struct { + Function string `json:"function,omitempty"` + Symbol string `json:"symbol,omitempty"` + // Module is, despite the name, the Sentry protocol equivalent of a Go + // package's import path. + Module string `json:"module,omitempty"` + // Package is not used for Go stack trace frames. In other platforms it + // refers to a container where the Module can be found. For example, a + // Java JAR, a .NET Assembly, or a native dynamic library. + // It exists for completeness, allowing the construction and reporting + // of custom event payloads. + Package string `json:"package,omitempty"` + Filename string `json:"filename,omitempty"` + AbsPath string `json:"abs_path,omitempty"` + Lineno int `json:"lineno,omitempty"` + Colno int `json:"colno,omitempty"` + PreContext []string `json:"pre_context,omitempty"` + ContextLine string `json:"context_line,omitempty"` + PostContext []string `json:"post_context,omitempty"` + InApp bool `json:"in_app,omitempty"` + Vars map[string]interface{} `json:"vars,omitempty"` +} + +// NewFrame assembles a stacktrace frame out of runtime.Frame. +func NewFrame(f runtime.Frame) Frame { + var abspath, relpath string + // NOTE: f.File paths historically use forward slash as path separator even + // on Windows, though this is not yet documented, see + // https://golang.org/issues/3335. In any case, filepath.IsAbs can work with + // paths with either slash or backslash on Windows. + switch { + case f.File == "": + relpath = unknown + // Leave abspath as the empty string to be omitted when serializing + // event as JSON. + abspath = "" + case filepath.IsAbs(f.File): + abspath = f.File + // TODO: in the general case, it is not trivial to come up with a + // "project relative" path with the data we have in run time. + // We shall not use filepath.Base because it creates ambiguous paths and + // affects the "Suspect Commits" feature. + // For now, leave relpath empty to be omitted when serializing the event + // as JSON. Improve this later. + relpath = "" + default: + // f.File is a relative path. This may happen when the binary is built + // with the -trimpath flag. + relpath = f.File + // Omit abspath when serializing the event as JSON. + abspath = "" + } + + function := f.Function + var pkg string + + if function != "" { + pkg, function = splitQualifiedFunctionName(function) + } + + frame := Frame{ + AbsPath: abspath, + Filename: relpath, + Lineno: f.Line, + Module: pkg, + Function: function, + } + + frame.InApp = isInAppFrame(frame) + + return frame +} + +// splitQualifiedFunctionName splits a package path-qualified function name into +// package name and function name. Such qualified names are found in +// runtime.Frame.Function values. +func splitQualifiedFunctionName(name string) (pkg string, fun string) { + pkg = packageName(name) + fun = strings.TrimPrefix(name, pkg+".") + return +} + +func extractFrames(pcs []uintptr) []Frame { + var frames = make([]Frame, 0, len(pcs)) + callersFrames := runtime.CallersFrames(pcs) + + for { + callerFrame, more := callersFrames.Next() + + frames = append(frames, NewFrame(callerFrame)) + + if !more { + break + } + } + + // reverse + for i, j := 0, len(frames)-1; i < j; i, j = i+1, j-1 { + frames[i], frames[j] = frames[j], frames[i] + } + + return frames +} + +// filterFrames filters out stack frames that are not meant to be reported to +// Sentry. Those are frames internal to the SDK or Go. +func filterFrames(frames []Frame) []Frame { + if len(frames) == 0 { + return nil + } + + // reuse + filteredFrames := frames[:0] + + for _, frame := range frames { + // Skip Go internal frames. + if frame.Module == "runtime" || frame.Module == "testing" { + continue + } + // Skip Sentry internal frames, except for frames in _test packages (for + // testing). + if strings.HasPrefix(frame.Module, "github.com/getsentry/sentry-go") && + !strings.HasSuffix(frame.Module, "_test") { + continue + } + filteredFrames = append(filteredFrames, frame) + } + + return filteredFrames +} + +func isInAppFrame(frame Frame) bool { + if strings.HasPrefix(frame.AbsPath, build.Default.GOROOT) || + strings.Contains(frame.Module, "vendor") || + strings.Contains(frame.Module, "third_party") { + return false + } + + return true +} + +func callerFunctionName() string { + pcs := make([]uintptr, 1) + runtime.Callers(3, pcs) + callersFrames := runtime.CallersFrames(pcs) + callerFrame, _ := callersFrames.Next() + return baseName(callerFrame.Function) +} + +// packageName returns the package part of the symbol name, or the empty string +// if there is none. +// It replicates https://golang.org/pkg/debug/gosym/#Sym.PackageName, avoiding a +// dependency on debug/gosym. +func packageName(name string) string { + // A prefix of "type." and "go." is a compiler-generated symbol that doesn't belong to any package. + // See variable reservedimports in cmd/compile/internal/gc/subr.go + if strings.HasPrefix(name, "go.") || strings.HasPrefix(name, "type.") { + return "" + } + + pathend := strings.LastIndex(name, "/") + if pathend < 0 { + pathend = 0 + } + + if i := strings.Index(name[pathend:], "."); i != -1 { + return name[:pathend+i] + } + return "" +} + +// baseName returns the symbol name without the package or receiver name. +// It replicates https://golang.org/pkg/debug/gosym/#Sym.BaseName, avoiding a +// dependency on debug/gosym. +func baseName(name string) string { + if i := strings.LastIndex(name, "."); i != -1 { + return name[i+1:] + } + return name +} diff --git a/vendor/github.com/getsentry/sentry-go/traces_sampler.go b/vendor/github.com/getsentry/sentry-go/traces_sampler.go new file mode 100644 index 00000000..69e7cb7f --- /dev/null +++ b/vendor/github.com/getsentry/sentry-go/traces_sampler.go @@ -0,0 +1,19 @@ +package sentry + +// A SamplingContext is passed to a TracesSampler to determine a sampling +// decision. +// +// TODO(tracing): possibly expand SamplingContext to include custom / +// user-provided data. +type SamplingContext struct { + Span *Span // The current span, always non-nil. + Parent *Span // The parent span, may be nil. +} + +// The TracesSample type is an adapter to allow the use of ordinary +// functions as a TracesSampler. +type TracesSampler func(ctx SamplingContext) float64 + +func (f TracesSampler) Sample(ctx SamplingContext) float64 { + return f(ctx) +} diff --git a/vendor/github.com/getsentry/sentry-go/tracing.go b/vendor/github.com/getsentry/sentry-go/tracing.go new file mode 100644 index 00000000..5a70c07b --- /dev/null +++ b/vendor/github.com/getsentry/sentry-go/tracing.go @@ -0,0 +1,776 @@ +package sentry + +import ( + "context" + "crypto/rand" + "encoding/hex" + "encoding/json" + "fmt" + "net/http" + "regexp" + "strings" + "time" +) + +// A Span is the building block of a Sentry transaction. Spans build up a tree +// structure of timed operations. The span tree makes up a transaction event +// that is sent to Sentry when the root span is finished. +// +// Spans must be started with either StartSpan or Span.StartChild. +type Span struct { //nolint: maligned // prefer readability over optimal memory layout (see note below *) + TraceID TraceID `json:"trace_id"` + SpanID SpanID `json:"span_id"` + ParentSpanID SpanID `json:"parent_span_id"` + Op string `json:"op,omitempty"` + Description string `json:"description,omitempty"` + Status SpanStatus `json:"status,omitempty"` + Tags map[string]string `json:"tags,omitempty"` + StartTime time.Time `json:"start_timestamp"` + EndTime time.Time `json:"timestamp"` + Data map[string]interface{} `json:"data,omitempty"` + Sampled Sampled `json:"-"` + Source TransactionSource `json:"-"` + + // sample rate the span was sampled with. + sampleRate float64 + // ctx is the context where the span was started. Always non-nil. + ctx context.Context + // Dynamic Sampling context + dynamicSamplingContext DynamicSamplingContext + // parent refers to the immediate local parent span. A remote parent span is + // only referenced by setting ParentSpanID. + parent *Span + // isTransaction is true only for the root span of a local span tree. The + // root span is the first span started in a context. Note that a local root + // span may have a remote parent belonging to the same trace, therefore + // isTransaction depends on ctx and not on parent. + isTransaction bool + // recorder stores all spans in a transaction. Guaranteed to be non-nil. + recorder *spanRecorder +} + +// (*) Note on maligned: +// +// We prefer readability over optimal memory layout. If we ever decide to +// reorder fields, we can use a tool: +// +// go run honnef.co/go/tools/cmd/structlayout -json . Span | go run honnef.co/go/tools/cmd/structlayout-optimize +// +// Other structs would deserve reordering as well, for example Event. + +// TODO: make Span.Tags and Span.Data opaque types (struct{unexported []slice}). +// An opaque type allows us to add methods and make it more convenient to use +// than maps, because maps require careful nil checks to use properly or rely on +// explicit initialization for every span, even when there might be no +// tags/data. For Span.Data, must gracefully handle values that cannot be +// marshaled into JSON (see transport.go:getRequestBodyFromEvent). + +// StartSpan starts a new span to describe an operation. The new span will be a +// child of the last span stored in ctx, if any. +// +// One or more options can be used to modify the span properties. Typically one +// option as a function literal is enough. Combining multiple options can be +// useful to define and reuse specific properties with named functions. +// +// Caller should call the Finish method on the span to mark its end. Finishing a +// root span sends the span and all of its children, recursively, as a +// transaction to Sentry. +func StartSpan(ctx context.Context, operation string, options ...SpanOption) *Span { + parent, hasParent := ctx.Value(spanContextKey{}).(*Span) + var span Span + span = Span{ + // defaults + Op: operation, + StartTime: time.Now(), + Sampled: SampledUndefined, + + ctx: context.WithValue(ctx, spanContextKey{}, &span), + parent: parent, + isTransaction: !hasParent, + } + if hasParent { + span.TraceID = parent.TraceID + } else { + // Only set the Source if this is a transaction + span.Source = SourceCustom + + // Implementation note: + // + // While math/rand is ~2x faster than crypto/rand (exact + // difference depends on hardware / OS), crypto/rand is probably + // fast enough and a safer choice. + // + // For reference, OpenTelemetry [1] uses crypto/rand to seed + // math/rand. AFAICT this approach does not preserve the + // properties from crypto/rand that make it suitable for + // cryptography. While it might be debatable whether those + // properties are important for us here, again, we're taking the + // safer path. + // + // See [2a] & [2b] for a discussion of some of the properties we + // obtain by using crypto/rand and [3a] & [3b] for why we avoid + // math/rand. + // + // Because the math/rand seed has only 64 bits (int64), if the + // first thing we do after seeding an RNG is to read in a random + // TraceID, there are only 2^64 possible values. Compared to + // UUID v4 that have 122 random bits, there is a much greater + // chance of collision [4a] & [4b]. + // + // [1]: https://github.com/open-telemetry/opentelemetry-go/blob/958041ddf619a128/sdk/trace/trace.go#L25-L31 + // [2a]: https://security.stackexchange.com/q/120352/246345 + // [2b]: https://security.stackexchange.com/a/120365/246345 + // [3a]: https://github.com/golang/go/issues/11871#issuecomment-126333686 + // [3b]: https://github.com/golang/go/issues/11871#issuecomment-126357889 + // [4a]: https://en.wikipedia.org/wiki/Universally_unique_identifier#Collisions + // [4b]: https://www.wolframalpha.com/input/?i=sqrt%282*2%5E64*ln%281%2F%281-0.5%29%29%29 + _, err := rand.Read(span.TraceID[:]) + if err != nil { + panic(err) + } + } + _, err := rand.Read(span.SpanID[:]) + if err != nil { + panic(err) + } + if hasParent { + span.ParentSpanID = parent.SpanID + } + + // Apply options to override defaults. + for _, option := range options { + option(&span) + } + + span.Sampled = span.sample() + + if hasParent { + span.recorder = parent.spanRecorder() + } else { + span.recorder = &spanRecorder{} + } + span.recorder.record(&span) + + // Update scope so that all events include a trace context, allowing + // Sentry to correlate errors to transactions/spans. + hubFromContext(ctx).Scope().SetContext("trace", span.traceContext().Map()) + + return &span +} + +// Finish sets the span's end time, unless already set. If the span is the root +// of a span tree, Finish sends the span tree to Sentry as a transaction. +func (s *Span) Finish() { + // TODO(tracing): maybe make Finish run at most once, such that + // (incorrectly) calling it twice never double sends to Sentry. + + if s.EndTime.IsZero() { + s.EndTime = monotonicTimeSince(s.StartTime) + } + if !s.Sampled.Bool() { + return + } + event := s.toEvent() + if event == nil { + return + } + + // TODO(tracing): add breadcrumbs + // (see https://github.com/getsentry/sentry-python/blob/f6f3525f8812f609/sentry_sdk/tracing.py#L372) + + hub := hubFromContext(s.ctx) + if hub.Scope().Transaction() == "" { + Logger.Printf("Missing transaction name for span with op = %q", s.Op) + } + hub.CaptureEvent(event) +} + +// Context returns the context containing the span. +func (s *Span) Context() context.Context { return s.ctx } + +// StartChild starts a new child span. +// +// The call span.StartChild(operation, options...) is a shortcut for +// StartSpan(span.Context(), operation, options...). +func (s *Span) StartChild(operation string, options ...SpanOption) *Span { + return StartSpan(s.Context(), operation, options...) +} + +// SetTag sets a tag on the span. It is recommended to use SetTag instead of +// accessing the tags map directly as SetTag takes care of initializing the map +// when necessary. +func (s *Span) SetTag(name, value string) { + if s.Tags == nil { + s.Tags = make(map[string]string) + } + s.Tags[name] = value +} + +// TODO(tracing): maybe add shortcuts to get/set transaction name. Right now the +// transaction name is in the Scope, as it has existed there historically, prior +// to tracing. +// +// See Scope.Transaction() and Scope.SetTransaction(). +// +// func (s *Span) TransactionName() string +// func (s *Span) SetTransactionName(name string) + +// ToSentryTrace returns the trace propagation value used with the sentry-trace +// HTTP header. +func (s *Span) ToSentryTrace() string { + // TODO(tracing): add instrumentation for outgoing HTTP requests using + // ToSentryTrace. + var b strings.Builder + fmt.Fprintf(&b, "%s-%s", s.TraceID.Hex(), s.SpanID.Hex()) + switch s.Sampled { + case SampledTrue: + b.WriteString("-1") + case SampledFalse: + b.WriteString("-0") + } + return b.String() +} + +func (s *Span) ToBaggage() string { + return s.dynamicSamplingContext.String() +} + +// sentryTracePattern matches either +// +// TRACE_ID - SPAN_ID +// [[:xdigit:]]{32}-[[:xdigit:]]{16} +// +// or +// +// TRACE_ID - SPAN_ID - SAMPLED +// [[:xdigit:]]{32}-[[:xdigit:]]{16}-[01] +var sentryTracePattern = regexp.MustCompile(`^([[:xdigit:]]{32})-([[:xdigit:]]{16})(?:-([01]))?$`) + +// updateFromSentryTrace parses a sentry-trace HTTP header (as returned by +// ToSentryTrace) and updates fields of the span. If the header cannot be +// recognized as valid, the span is left unchanged. +func (s *Span) updateFromSentryTrace(header []byte) { + m := sentryTracePattern.FindSubmatch(header) + if m == nil { + // no match + return + } + _, _ = hex.Decode(s.TraceID[:], m[1]) + _, _ = hex.Decode(s.ParentSpanID[:], m[2]) + if len(m[3]) != 0 { + switch m[3][0] { + case '0': + s.Sampled = SampledFalse + case '1': + s.Sampled = SampledTrue + } + } +} + +func (s *Span) updateFromBaggage(header []byte) { + if s.isTransaction { + dsc, err := DynamicSamplingContextFromHeader(header) + if err != nil { + return + } + + s.dynamicSamplingContext = dsc + } +} + +func (s *Span) MarshalJSON() ([]byte, error) { + // span aliases Span to allow calling json.Marshal without an infinite loop. + // It preserves all fields while none of the attached methods. + type span Span + var parentSpanID string + if s.ParentSpanID != zeroSpanID { + parentSpanID = s.ParentSpanID.String() + } + return json.Marshal(struct { + *span + ParentSpanID string `json:"parent_span_id,omitempty"` + }{ + span: (*span)(s), + ParentSpanID: parentSpanID, + }) +} + +func (s *Span) sample() Sampled { + hub := hubFromContext(s.ctx) + var clientOptions ClientOptions + client := hub.Client() + if client != nil { + clientOptions = hub.Client().Options() + } + + // https://develop.sentry.dev/sdk/performance/#sampling + // #1 tracing is not enabled. + if !clientOptions.EnableTracing { + Logger.Printf("Dropping transaction: EnableTracing is set to %t", clientOptions.EnableTracing) + s.sampleRate = 0.0 + return SampledFalse + } + + // #2 explicit sampling decision via StartSpan/StartTransaction options. + if s.Sampled != SampledUndefined { + Logger.Printf("Using explicit sampling decision from StartSpan/StartTransaction: %v", s.Sampled) + switch s.Sampled { + case SampledTrue: + s.sampleRate = 1.0 + case SampledFalse: + s.sampleRate = 0.0 + } + return s.Sampled + } + + // Variant for non-transaction spans: they inherit the parent decision. + // Note: non-transaction should always have a parent, but we check both + // conditions anyway -- the first for semantic meaning, the second to + // avoid a nil pointer dereference. + if !s.isTransaction && s.parent != nil { + return s.parent.Sampled + } + + // #3 use TracesSampler from ClientOptions. + sampler := clientOptions.TracesSampler + samplingContext := SamplingContext{Span: s, Parent: s.parent} + if sampler != nil { + tracesSamplerSampleRate := sampler.Sample(samplingContext) + s.sampleRate = tracesSamplerSampleRate + if tracesSamplerSampleRate < 0.0 || tracesSamplerSampleRate > 1.0 { + Logger.Printf("Dropping transaction: Returned TracesSampler rate is out of range [0.0, 1.0]: %f", tracesSamplerSampleRate) + return SampledFalse + } + if tracesSamplerSampleRate == 0 { + Logger.Printf("Dropping transaction: Returned TracesSampler rate is: %f", tracesSamplerSampleRate) + return SampledFalse + } + + if rng.Float64() < tracesSamplerSampleRate { + return SampledTrue + } + Logger.Printf("Dropping transaction: TracesSampler returned rate: %f", tracesSamplerSampleRate) + return SampledFalse + } + // #4 inherit parent decision. + if s.parent != nil { + Logger.Printf("Using sampling decision from parent: %v", s.parent.Sampled) + switch s.parent.Sampled { + case SampledTrue: + s.sampleRate = 1.0 + case SampledFalse: + s.sampleRate = 0.0 + } + return s.parent.Sampled + } + + // #5 use TracesSampleRate from ClientOptions. + sampleRate := clientOptions.TracesSampleRate + s.sampleRate = sampleRate + if sampleRate < 0.0 || sampleRate > 1.0 { + Logger.Printf("Dropping transaction: TracesSamplerRate out of range [0.0, 1.0]: %f", sampleRate) + return SampledFalse + } + if sampleRate == 0.0 { + Logger.Printf("Dropping transaction: TracesSampleRate rate is: %f", sampleRate) + return SampledFalse + } + + if rng.Float64() < sampleRate { + return SampledTrue + } + + return SampledFalse +} + +func (s *Span) toEvent() *Event { + if !s.isTransaction { + return nil // only transactions can be transformed into events + } + hub := hubFromContext(s.ctx) + + children := s.recorder.children() + finished := make([]*Span, 0, len(children)) + for _, child := range children { + if child.EndTime.IsZero() { + Logger.Printf("Dropped unfinished span: Op=%q TraceID=%s SpanID=%s", child.Op, child.TraceID, child.SpanID) + continue + } + finished = append(finished, child) + } + + // Create and attach a DynamicSamplingContext to the transaction. + // If the DynamicSamplingContext is not frozen at this point, we can assume being head of trace. + if !s.dynamicSamplingContext.IsFrozen() { + s.dynamicSamplingContext = DynamicSamplingContextFromTransaction(s) + } + + return &Event{ + Type: transactionType, + Transaction: hub.Scope().Transaction(), + Contexts: map[string]Context{ + "trace": s.traceContext().Map(), + }, + Tags: s.Tags, + Extra: s.Data, + Timestamp: s.EndTime, + StartTime: s.StartTime, + Spans: finished, + TransactionInfo: &TransactionInfo{ + Source: s.Source, + }, + sdkMetaData: SDKMetaData{ + dsc: s.dynamicSamplingContext, + }, + } +} + +func (s *Span) traceContext() *TraceContext { + return &TraceContext{ + TraceID: s.TraceID, + SpanID: s.SpanID, + ParentSpanID: s.ParentSpanID, + Op: s.Op, + Description: s.Description, + Status: s.Status, + } +} + +// spanRecorder stores the span tree. Guaranteed to be non-nil. +func (s *Span) spanRecorder() *spanRecorder { return s.recorder } + +// TraceID identifies a trace. +type TraceID [16]byte + +func (id TraceID) Hex() []byte { + b := make([]byte, hex.EncodedLen(len(id))) + hex.Encode(b, id[:]) + return b +} + +func (id TraceID) String() string { + return string(id.Hex()) +} + +func (id TraceID) MarshalText() ([]byte, error) { + return id.Hex(), nil +} + +// SpanID identifies a span. +type SpanID [8]byte + +func (id SpanID) Hex() []byte { + b := make([]byte, hex.EncodedLen(len(id))) + hex.Encode(b, id[:]) + return b +} + +func (id SpanID) String() string { + return string(id.Hex()) +} + +func (id SpanID) MarshalText() ([]byte, error) { + return id.Hex(), nil +} + +// Zero values of TraceID and SpanID used for comparisons. +var ( + zeroTraceID TraceID + zeroSpanID SpanID +) + +// Contains information about how the name of the transaction was determined. +type TransactionSource string + +const ( + SourceCustom TransactionSource = "custom" + SourceURL TransactionSource = "url" + SourceRoute TransactionSource = "route" + SourceView TransactionSource = "view" + SourceComponent TransactionSource = "component" + SourceTask TransactionSource = "task" +) + +// SpanStatus is the status of a span. +type SpanStatus uint8 + +// Implementation note: +// +// In Relay (ingestion), the SpanStatus type is an enum used as +// Annotated when embedded in structs, making it effectively +// Option. It means the status is either null or one of the known +// string values. +// +// In Snuba (search), the SpanStatus is stored as an uint8 and defaulted to 2 +// ("unknown") when not set. It means that Discover searches for +// `transaction.status:unknown` return both transactions/spans with status +// `null` or `"unknown"`. Searches for `transaction.status:""` return nothing. +// +// With that in mind, the Go SDK default is SpanStatusUndefined, which is +// null/omitted when serializing to JSON, but integrations may update the status +// automatically based on contextual information. + +const ( + SpanStatusUndefined SpanStatus = iota + SpanStatusOK + SpanStatusCanceled + SpanStatusUnknown + SpanStatusInvalidArgument + SpanStatusDeadlineExceeded + SpanStatusNotFound + SpanStatusAlreadyExists + SpanStatusPermissionDenied + SpanStatusResourceExhausted + SpanStatusFailedPrecondition + SpanStatusAborted + SpanStatusOutOfRange + SpanStatusUnimplemented + SpanStatusInternalError + SpanStatusUnavailable + SpanStatusDataLoss + SpanStatusUnauthenticated + maxSpanStatus +) + +func (ss SpanStatus) String() string { + if ss >= maxSpanStatus { + return "" + } + m := [maxSpanStatus]string{ + "", + "ok", + "cancelled", // [sic] + "unknown", + "invalid_argument", + "deadline_exceeded", + "not_found", + "already_exists", + "permission_denied", + "resource_exhausted", + "failed_precondition", + "aborted", + "out_of_range", + "unimplemented", + "internal_error", + "unavailable", + "data_loss", + "unauthenticated", + } + return m[ss] +} + +func (ss SpanStatus) MarshalJSON() ([]byte, error) { + s := ss.String() + if s == "" { + return []byte("null"), nil + } + return json.Marshal(s) +} + +// A TraceContext carries information about an ongoing trace and is meant to be +// stored in Event.Contexts (as *TraceContext). +type TraceContext struct { + TraceID TraceID `json:"trace_id"` + SpanID SpanID `json:"span_id"` + ParentSpanID SpanID `json:"parent_span_id"` + Op string `json:"op,omitempty"` + Description string `json:"description,omitempty"` + Status SpanStatus `json:"status,omitempty"` +} + +func (tc *TraceContext) MarshalJSON() ([]byte, error) { + // traceContext aliases TraceContext to allow calling json.Marshal without + // an infinite loop. It preserves all fields while none of the attached + // methods. + type traceContext TraceContext + var parentSpanID string + if tc.ParentSpanID != zeroSpanID { + parentSpanID = tc.ParentSpanID.String() + } + return json.Marshal(struct { + *traceContext + ParentSpanID string `json:"parent_span_id,omitempty"` + }{ + traceContext: (*traceContext)(tc), + ParentSpanID: parentSpanID, + }) +} + +func (tc TraceContext) Map() map[string]interface{} { + m := map[string]interface{}{ + "trace_id": tc.TraceID, + "span_id": tc.SpanID, + } + + if tc.ParentSpanID != [8]byte{} { + m["parent_span_id"] = tc.ParentSpanID + } + + if tc.Op != "" { + m["op"] = tc.Op + } + + if tc.Description != "" { + m["description"] = tc.Description + } + + if tc.Status > 0 && tc.Status < maxSpanStatus { + m["status"] = tc.Status + } + + return m +} + +// Sampled signifies a sampling decision. +type Sampled int8 + +// The possible trace sampling decisions are: SampledFalse, SampledUndefined +// (default) and SampledTrue. +const ( + SampledFalse Sampled = -1 + SampledUndefined Sampled = 0 + SampledTrue Sampled = 1 +) + +func (s Sampled) String() string { + switch s { + case SampledFalse: + return "SampledFalse" + case SampledUndefined: + return "SampledUndefined" + case SampledTrue: + return "SampledTrue" + default: + return fmt.Sprintf("SampledInvalid(%d)", s) + } +} + +// Bool returns true if the sample decision is SampledTrue, false otherwise. +func (s Sampled) Bool() bool { + return s == SampledTrue +} + +// A SpanOption is a function that can modify the properties of a span. +type SpanOption func(s *Span) + +// The TransactionName option sets the name of the current transaction. +// +// A span tree has a single transaction name, therefore using this option when +// starting a span affects the span tree as a whole, potentially overwriting a +// name set previously. +func TransactionName(name string) SpanOption { + return func(s *Span) { + hubFromContext(s.Context()).Scope().SetTransaction(name) + } +} + +// OpName sets the operation name for a given span. +func OpName(name string) SpanOption { + return func(s *Span) { + s.Op = name + } +} + +// TransctionSource sets the source of the transaction name. +func TransctionSource(source TransactionSource) SpanOption { + return func(s *Span) { + s.Source = source + } +} + +// ContinueFromRequest returns a span option that updates the span to continue +// an existing trace. If it cannot detect an existing trace in the request, the +// span will be left unchanged. +// +// ContinueFromRequest is an alias for: +// +// ContinueFromHeaders(r.Header.Get("sentry-trace"), r.Header.Get("baggage")). +func ContinueFromRequest(r *http.Request) SpanOption { + return ContinueFromHeaders(r.Header.Get("sentry-trace"), r.Header.Get("baggage")) +} + +// ContinueFromHeaders returns a span option that updates the span to continue +// an existing TraceID and propagates the Dynamic Sampling context. +func ContinueFromHeaders(trace, baggage string) SpanOption { + return func(s *Span) { + if trace != "" { + s.updateFromSentryTrace([]byte(trace)) + } + if baggage != "" { + s.updateFromBaggage([]byte(baggage)) + } + // In case a sentry-trace header is present but no baggage header, + // create an empty, frozen DynamicSamplingContext. + if trace != "" && baggage == "" { + s.dynamicSamplingContext = DynamicSamplingContext{ + Frozen: true, + } + } + } +} + +// ContinueFromTrace returns a span option that updates the span to continue +// an existing TraceID. +func ContinueFromTrace(trace string) SpanOption { + return func(s *Span) { + if trace == "" { + return + } + s.updateFromSentryTrace([]byte(trace)) + } +} + +// spanContextKey is used to store span values in contexts. +type spanContextKey struct{} + +// TransactionFromContext returns the root span of the current transaction. It +// returns nil if no transaction is tracked in the context. +func TransactionFromContext(ctx context.Context) *Span { + if span, ok := ctx.Value(spanContextKey{}).(*Span); ok { + return span.recorder.root() + } + return nil +} + +// spanFromContext returns the last span stored in the context or a dummy +// non-nil span. +// +// TODO(tracing): consider exporting this. Without this, users cannot retrieve a +// span from a context since spanContextKey is not exported. +// +// This can be added retroactively, and in the meantime think better whether it +// should return nil (like GetHubFromContext), always non-nil (like +// HubFromContext), or both: two exported functions. +// +// Note the equivalence: +// +// SpanFromContext(ctx).StartChild(...) === StartSpan(ctx, ...) +// +// So we don't aim spanFromContext at creating spans, but mutating existing +// spans that you'd have no access otherwise (because it was created in code you +// do not control, for example SDK auto-instrumentation). +// +// For now we provide TransactionFromContext, which solves the more common case +// of setting tags, etc, on the current transaction. +func spanFromContext(ctx context.Context) *Span { + if span, ok := ctx.Value(spanContextKey{}).(*Span); ok { + return span + } + return nil +} + +// StartTransaction will create a transaction (root span) if there's no existing +// transaction in the context otherwise, it will return the existing transaction. +func StartTransaction(ctx context.Context, name string, options ...SpanOption) *Span { + currentTransaction, exists := ctx.Value(spanContextKey{}).(*Span) + if exists { + return currentTransaction + } + + options = append(options, TransactionName(name)) + return StartSpan( + ctx, + "", + options..., + ) +} diff --git a/vendor/github.com/getsentry/sentry-go/transport.go b/vendor/github.com/getsentry/sentry-go/transport.go new file mode 100644 index 00000000..3722217e --- /dev/null +++ b/vendor/github.com/getsentry/sentry-go/transport.go @@ -0,0 +1,592 @@ +package sentry + +import ( + "bytes" + "crypto/tls" + "encoding/json" + "errors" + "fmt" + "io" + "net/http" + "net/url" + "sync" + "time" + + "github.com/getsentry/sentry-go/internal/ratelimit" +) + +const defaultBufferSize = 30 +const defaultTimeout = time.Second * 30 + +// maxDrainResponseBytes is the maximum number of bytes that transport +// implementations will read from response bodies when draining them. +// +// Sentry's ingestion API responses are typically short and the SDK doesn't need +// the contents of the response body. However, the net/http HTTP client requires +// response bodies to be fully drained (and closed) for TCP keep-alive to work. +// +// maxDrainResponseBytes strikes a balance between reading too much data (if the +// server is misbehaving) and reusing TCP connections. +const maxDrainResponseBytes = 16 << 10 + +// Transport is used by the Client to deliver events to remote server. +type Transport interface { + Flush(timeout time.Duration) bool + Configure(options ClientOptions) + SendEvent(event *Event) +} + +func getProxyConfig(options ClientOptions) func(*http.Request) (*url.URL, error) { + if options.HTTPSProxy != "" { + return func(*http.Request) (*url.URL, error) { + return url.Parse(options.HTTPSProxy) + } + } + + if options.HTTPProxy != "" { + return func(*http.Request) (*url.URL, error) { + return url.Parse(options.HTTPProxy) + } + } + + return http.ProxyFromEnvironment +} + +func getTLSConfig(options ClientOptions) *tls.Config { + if options.CaCerts != nil { + // #nosec G402 -- We should be using `MinVersion: tls.VersionTLS12`, + // but we don't want to break peoples code without the major bump. + return &tls.Config{ + RootCAs: options.CaCerts, + } + } + + return nil +} + +func getRequestBodyFromEvent(event *Event) []byte { + body, err := json.Marshal(event) + if err == nil { + return body + } + + msg := fmt.Sprintf("Could not encode original event as JSON. "+ + "Succeeded by removing Breadcrumbs, Contexts and Extra. "+ + "Please verify the data you attach to the scope. "+ + "Error: %s", err) + // Try to serialize the event, with all the contextual data that allows for interface{} stripped. + event.Breadcrumbs = nil + event.Contexts = nil + event.Extra = map[string]interface{}{ + "info": msg, + } + body, err = json.Marshal(event) + if err == nil { + Logger.Println(msg) + return body + } + + // This should _only_ happen when Event.Exception[0].Stacktrace.Frames[0].Vars is unserializable + // Which won't ever happen, as we don't use it now (although it's the part of public interface accepted by Sentry) + // Juuust in case something, somehow goes utterly wrong. + Logger.Println("Event couldn't be marshaled, even with stripped contextual data. Skipping delivery. " + + "Please notify the SDK owners with possibly broken payload.") + return nil +} + +func transactionEnvelopeFromBody(event *Event, dsn *Dsn, sentAt time.Time, body json.RawMessage) (*bytes.Buffer, error) { + var b bytes.Buffer + enc := json.NewEncoder(&b) + + // Construct the trace envelope header + var trace = map[string]string{} + if dsc := event.sdkMetaData.dsc; dsc.HasEntries() { + for k, v := range dsc.Entries { + trace[k] = v + } + } + + // Envelope header + err := enc.Encode(struct { + EventID EventID `json:"event_id"` + SentAt time.Time `json:"sent_at"` + Dsn string `json:"dsn"` + Sdk map[string]string `json:"sdk"` + Trace map[string]string `json:"trace,omitempty"` + }{ + EventID: event.EventID, + SentAt: sentAt, + Trace: trace, + Dsn: dsn.String(), + Sdk: map[string]string{ + "name": event.Sdk.Name, + "version": event.Sdk.Version, + }, + }) + if err != nil { + return nil, err + } + + // Item header + err = enc.Encode(struct { + Type string `json:"type"` + Length int `json:"length"` + }{ + Type: transactionType, + Length: len(body), + }) + if err != nil { + return nil, err + } + // payload + err = enc.Encode(body) + if err != nil { + return nil, err + } + + return &b, nil +} + +func getRequestFromEvent(event *Event, dsn *Dsn) (r *http.Request, err error) { + defer func() { + if r != nil { + r.Header.Set("User-Agent", userAgent) + } + }() + body := getRequestBodyFromEvent(event) + if body == nil { + return nil, errors.New("event could not be marshaled") + } + if event.Type == transactionType { + b, err := transactionEnvelopeFromBody(event, dsn, time.Now(), body) + if err != nil { + return nil, err + } + return http.NewRequest( + http.MethodPost, + dsn.EnvelopeAPIURL().String(), + b, + ) + } + return http.NewRequest( + http.MethodPost, + dsn.StoreAPIURL().String(), + bytes.NewReader(body), + ) +} + +func categoryFor(eventType string) ratelimit.Category { + switch eventType { + case "": + return ratelimit.CategoryError + case transactionType: + return ratelimit.CategoryTransaction + default: + return ratelimit.Category(eventType) + } +} + +// ================================ +// HTTPTransport +// ================================ + +// A batch groups items that are processed sequentially. +type batch struct { + items chan batchItem + started chan struct{} // closed to signal items started to be worked on + done chan struct{} // closed to signal completion of all items +} + +type batchItem struct { + request *http.Request + category ratelimit.Category +} + +// HTTPTransport is the default, non-blocking, implementation of Transport. +// +// Clients using this transport will enqueue requests in a buffer and return to +// the caller before any network communication has happened. Requests are sent +// to Sentry sequentially from a background goroutine. +type HTTPTransport struct { + dsn *Dsn + client *http.Client + transport http.RoundTripper + + // buffer is a channel of batches. Calling Flush terminates work on the + // current in-flight items and starts a new batch for subsequent events. + buffer chan batch + + start sync.Once + + // Size of the transport buffer. Defaults to 30. + BufferSize int + // HTTP Client request timeout. Defaults to 30 seconds. + Timeout time.Duration + + mu sync.RWMutex + limits ratelimit.Map +} + +// NewHTTPTransport returns a new pre-configured instance of HTTPTransport. +func NewHTTPTransport() *HTTPTransport { + transport := HTTPTransport{ + BufferSize: defaultBufferSize, + Timeout: defaultTimeout, + limits: make(ratelimit.Map), + } + return &transport +} + +// Configure is called by the Client itself, providing it it's own ClientOptions. +func (t *HTTPTransport) Configure(options ClientOptions) { + dsn, err := NewDsn(options.Dsn) + if err != nil { + Logger.Printf("%v\n", err) + return + } + t.dsn = dsn + + // A buffered channel with capacity 1 works like a mutex, ensuring only one + // goroutine can access the current batch at a given time. Access is + // synchronized by reading from and writing to the channel. + t.buffer = make(chan batch, 1) + t.buffer <- batch{ + items: make(chan batchItem, t.BufferSize), + started: make(chan struct{}), + done: make(chan struct{}), + } + + if options.HTTPTransport != nil { + t.transport = options.HTTPTransport + } else { + t.transport = &http.Transport{ + Proxy: getProxyConfig(options), + TLSClientConfig: getTLSConfig(options), + } + } + + if options.HTTPClient != nil { + t.client = options.HTTPClient + } else { + t.client = &http.Client{ + Transport: t.transport, + Timeout: t.Timeout, + } + } + + t.start.Do(func() { + go t.worker() + }) +} + +// SendEvent assembles a new packet out of Event and sends it to remote server. +func (t *HTTPTransport) SendEvent(event *Event) { + if t.dsn == nil { + return + } + + category := categoryFor(event.Type) + + if t.disabled(category) { + return + } + + request, err := getRequestFromEvent(event, t.dsn) + if err != nil { + return + } + + for headerKey, headerValue := range t.dsn.RequestHeaders() { + request.Header.Set(headerKey, headerValue) + } + + // <-t.buffer is equivalent to acquiring a lock to access the current batch. + // A few lines below, t.buffer <- b releases the lock. + // + // The lock must be held during the select block below to guarantee that + // b.items is not closed while trying to send to it. Remember that sending + // on a closed channel panics. + // + // Note that the select block takes a bounded amount of CPU time because of + // the default case that is executed if sending on b.items would block. That + // is, the event is dropped if it cannot be sent immediately to the b.items + // channel (used as a queue). + b := <-t.buffer + + select { + case b.items <- batchItem{ + request: request, + category: category, + }: + var eventType string + if event.Type == transactionType { + eventType = "transaction" + } else { + eventType = fmt.Sprintf("%s event", event.Level) + } + Logger.Printf( + "Sending %s [%s] to %s project: %s", + eventType, + event.EventID, + t.dsn.host, + t.dsn.projectID, + ) + default: + Logger.Println("Event dropped due to transport buffer being full.") + } + + t.buffer <- b +} + +// Flush waits until any buffered events are sent to the Sentry server, blocking +// for at most the given timeout. It returns false if the timeout was reached. +// In that case, some events may not have been sent. +// +// Flush should be called before terminating the program to avoid +// unintentionally dropping events. +// +// Do not call Flush indiscriminately after every call to SendEvent. Instead, to +// have the SDK send events over the network synchronously, configure it to use +// the HTTPSyncTransport in the call to Init. +func (t *HTTPTransport) Flush(timeout time.Duration) bool { + toolate := time.After(timeout) + + // Wait until processing the current batch has started or the timeout. + // + // We must wait until the worker has seen the current batch, because it is + // the only way b.done will be closed. If we do not wait, there is a + // possible execution flow in which b.done is never closed, and the only way + // out of Flush would be waiting for the timeout, which is undesired. + var b batch + for { + select { + case b = <-t.buffer: + select { + case <-b.started: + goto started + default: + t.buffer <- b + } + case <-toolate: + goto fail + } + } + +started: + // Signal that there won't be any more items in this batch, so that the + // worker inner loop can end. + close(b.items) + // Start a new batch for subsequent events. + t.buffer <- batch{ + items: make(chan batchItem, t.BufferSize), + started: make(chan struct{}), + done: make(chan struct{}), + } + + // Wait until the current batch is done or the timeout. + select { + case <-b.done: + Logger.Println("Buffer flushed successfully.") + return true + case <-toolate: + goto fail + } + +fail: + Logger.Println("Buffer flushing reached the timeout.") + return false +} + +func (t *HTTPTransport) worker() { + for b := range t.buffer { + // Signal that processing of the current batch has started. + close(b.started) + + // Return the batch to the buffer so that other goroutines can use it. + // Equivalent to releasing a lock. + t.buffer <- b + + // Process all batch items. + for item := range b.items { + if t.disabled(item.category) { + continue + } + + response, err := t.client.Do(item.request) + if err != nil { + Logger.Printf("There was an issue with sending an event: %v", err) + continue + } + t.mu.Lock() + t.limits.Merge(ratelimit.FromResponse(response)) + t.mu.Unlock() + // Drain body up to a limit and close it, allowing the + // transport to reuse TCP connections. + _, _ = io.CopyN(io.Discard, response.Body, maxDrainResponseBytes) + response.Body.Close() + } + + // Signal that processing of the batch is done. + close(b.done) + } +} + +func (t *HTTPTransport) disabled(c ratelimit.Category) bool { + t.mu.RLock() + defer t.mu.RUnlock() + disabled := t.limits.IsRateLimited(c) + if disabled { + Logger.Printf("Too many requests for %q, backing off till: %v", c, t.limits.Deadline(c)) + } + return disabled +} + +// ================================ +// HTTPSyncTransport +// ================================ + +// HTTPSyncTransport is a blocking implementation of Transport. +// +// Clients using this transport will send requests to Sentry sequentially and +// block until a response is returned. +// +// The blocking behavior is useful in a limited set of use cases. For example, +// use it when deploying code to a Function as a Service ("Serverless") +// platform, where any work happening in a background goroutine is not +// guaranteed to execute. +// +// For most cases, prefer HTTPTransport. +type HTTPSyncTransport struct { + dsn *Dsn + client *http.Client + transport http.RoundTripper + + mu sync.Mutex + limits ratelimit.Map + + // HTTP Client request timeout. Defaults to 30 seconds. + Timeout time.Duration +} + +// NewHTTPSyncTransport returns a new pre-configured instance of HTTPSyncTransport. +func NewHTTPSyncTransport() *HTTPSyncTransport { + transport := HTTPSyncTransport{ + Timeout: defaultTimeout, + limits: make(ratelimit.Map), + } + + return &transport +} + +// Configure is called by the Client itself, providing it it's own ClientOptions. +func (t *HTTPSyncTransport) Configure(options ClientOptions) { + dsn, err := NewDsn(options.Dsn) + if err != nil { + Logger.Printf("%v\n", err) + return + } + t.dsn = dsn + + if options.HTTPTransport != nil { + t.transport = options.HTTPTransport + } else { + t.transport = &http.Transport{ + Proxy: getProxyConfig(options), + TLSClientConfig: getTLSConfig(options), + } + } + + if options.HTTPClient != nil { + t.client = options.HTTPClient + } else { + t.client = &http.Client{ + Transport: t.transport, + Timeout: t.Timeout, + } + } +} + +// SendEvent assembles a new packet out of Event and sends it to remote server. +func (t *HTTPSyncTransport) SendEvent(event *Event) { + if t.dsn == nil { + return + } + + if t.disabled(categoryFor(event.Type)) { + return + } + + request, err := getRequestFromEvent(event, t.dsn) + if err != nil { + return + } + + for headerKey, headerValue := range t.dsn.RequestHeaders() { + request.Header.Set(headerKey, headerValue) + } + + var eventType string + if event.Type == transactionType { + eventType = "transaction" + } else { + eventType = fmt.Sprintf("%s event", event.Level) + } + Logger.Printf( + "Sending %s [%s] to %s project: %s", + eventType, + event.EventID, + t.dsn.host, + t.dsn.projectID, + ) + + response, err := t.client.Do(request) + if err != nil { + Logger.Printf("There was an issue with sending an event: %v", err) + return + } + t.mu.Lock() + t.limits.Merge(ratelimit.FromResponse(response)) + t.mu.Unlock() + + // Drain body up to a limit and close it, allowing the + // transport to reuse TCP connections. + _, _ = io.CopyN(io.Discard, response.Body, maxDrainResponseBytes) + response.Body.Close() +} + +// Flush is a no-op for HTTPSyncTransport. It always returns true immediately. +func (t *HTTPSyncTransport) Flush(_ time.Duration) bool { + return true +} + +func (t *HTTPSyncTransport) disabled(c ratelimit.Category) bool { + t.mu.Lock() + defer t.mu.Unlock() + disabled := t.limits.IsRateLimited(c) + if disabled { + Logger.Printf("Too many requests for %q, backing off till: %v", c, t.limits.Deadline(c)) + } + return disabled +} + +// ================================ +// noopTransport +// ================================ + +// noopTransport is an implementation of Transport interface which drops all the events. +// Only used internally when an empty DSN is provided, which effectively disables the SDK. +type noopTransport struct{} + +var _ Transport = noopTransport{} + +func (noopTransport) Configure(ClientOptions) { + Logger.Println("Sentry client initialized with an empty DSN. Using noopTransport. No events will be delivered.") +} + +func (noopTransport) SendEvent(*Event) { + Logger.Println("Event dropped due to noopTransport usage.") +} + +func (noopTransport) Flush(time.Duration) bool { + return true +} diff --git a/vendor/github.com/getsentry/sentry-go/util.go b/vendor/github.com/getsentry/sentry-go/util.go new file mode 100644 index 00000000..e5717c63 --- /dev/null +++ b/vendor/github.com/getsentry/sentry-go/util.go @@ -0,0 +1,91 @@ +package sentry + +import ( + "crypto/rand" + "encoding/hex" + "encoding/json" + "fmt" + "os" + "strings" + "time" + + exec "golang.org/x/sys/execabs" +) + +func uuid() string { + id := make([]byte, 16) + // Prefer rand.Read over rand.Reader, see https://go-review.googlesource.com/c/go/+/272326/. + _, _ = rand.Read(id) + id[6] &= 0x0F // clear version + id[6] |= 0x40 // set version to 4 (random uuid) + id[8] &= 0x3F // clear variant + id[8] |= 0x80 // set to IETF variant + return hex.EncodeToString(id) +} + +func fileExists(fileName string) bool { + _, err := os.Stat(fileName) + return err == nil +} + +// monotonicTimeSince replaces uses of time.Now() to take into account the +// monotonic clock reading stored in start, such that duration = end - start is +// unaffected by changes in the system wall clock. +func monotonicTimeSince(start time.Time) (end time.Time) { + return start.Add(time.Since(start)) +} + +// nolint: deadcode, unused +func prettyPrint(data interface{}) { + dbg, _ := json.MarshalIndent(data, "", " ") + fmt.Println(string(dbg)) +} + +// defaultRelease attempts to guess a default release for the currently running +// program. +func defaultRelease() (release string) { + // Return first non-empty environment variable known to hold release info, if any. + envs := []string{ + "SENTRY_RELEASE", + "HEROKU_SLUG_COMMIT", + "SOURCE_VERSION", + "CODEBUILD_RESOLVED_SOURCE_VERSION", + "CIRCLE_SHA1", + "GAE_DEPLOYMENT_ID", + "GITHUB_SHA", // GitHub Actions - https://help.github.com/en/actions + "COMMIT_REF", // Netlify - https://docs.netlify.com/ + "VERCEL_GIT_COMMIT_SHA", // Vercel - https://vercel.com/ + "ZEIT_GITHUB_COMMIT_SHA", // Zeit (now known as Vercel) + "ZEIT_GITLAB_COMMIT_SHA", + "ZEIT_BITBUCKET_COMMIT_SHA", + } + for _, e := range envs { + if release = os.Getenv(e); release != "" { + Logger.Printf("Using release from environment variable %s: %s", e, release) + return release + } + } + + // Derive a version string from Git. Example outputs: + // v1.0.1-0-g9de4 + // v2.0-8-g77df-dirty + // 4f72d7 + cmd := exec.Command("git", "describe", "--long", "--always", "--dirty") + b, err := cmd.Output() + if err != nil { + // Either Git is not available or the current directory is not a + // Git repository. + var s strings.Builder + fmt.Fprintf(&s, "Release detection failed: %v", err) + if err, ok := err.(*exec.ExitError); ok && len(err.Stderr) > 0 { + fmt.Fprintf(&s, ": %s", err.Stderr) + } + Logger.Print(s.String()) + Logger.Print("Some Sentry features will not be available. See https://docs.sentry.io/product/releases/.") + Logger.Print("To stop seeing this message, pass a Release to sentry.Init or set the SENTRY_RELEASE environment variable.") + return "" + } + release = strings.TrimSpace(string(b)) + Logger.Printf("Using release from Git: %s", release) + return release +} diff --git a/vendor/github.com/mattn/go-colorable/.travis.yml b/vendor/github.com/mattn/go-colorable/.travis.yml deleted file mode 100644 index 7942c565..00000000 --- a/vendor/github.com/mattn/go-colorable/.travis.yml +++ /dev/null @@ -1,15 +0,0 @@ -language: go -sudo: false -go: - - 1.13.x - - tip - -before_install: - - go get -t -v ./... - -script: - - ./go.test.sh - -after_success: - - bash <(curl -s https://codecov.io/bash) - diff --git a/vendor/github.com/mattn/go-colorable/README.md b/vendor/github.com/mattn/go-colorable/README.md index e055952b..ca048371 100644 --- a/vendor/github.com/mattn/go-colorable/README.md +++ b/vendor/github.com/mattn/go-colorable/README.md @@ -1,6 +1,6 @@ # go-colorable -[![Build Status](https://travis-ci.org/mattn/go-colorable.svg?branch=master)](https://travis-ci.org/mattn/go-colorable) +[![Build Status](https://github.com/mattn/go-colorable/workflows/test/badge.svg)](https://github.com/mattn/go-colorable/actions?query=workflow%3Atest) [![Codecov](https://codecov.io/gh/mattn/go-colorable/branch/master/graph/badge.svg)](https://codecov.io/gh/mattn/go-colorable) [![GoDoc](https://godoc.org/github.com/mattn/go-colorable?status.svg)](http://godoc.org/github.com/mattn/go-colorable) [![Go Report Card](https://goreportcard.com/badge/mattn/go-colorable)](https://goreportcard.com/report/mattn/go-colorable) diff --git a/vendor/github.com/mattn/go-colorable/colorable_appengine.go b/vendor/github.com/mattn/go-colorable/colorable_appengine.go index 1f7806fe..416d1bbb 100644 --- a/vendor/github.com/mattn/go-colorable/colorable_appengine.go +++ b/vendor/github.com/mattn/go-colorable/colorable_appengine.go @@ -1,3 +1,4 @@ +//go:build appengine // +build appengine package colorable diff --git a/vendor/github.com/mattn/go-colorable/colorable_others.go b/vendor/github.com/mattn/go-colorable/colorable_others.go index 08cbd1e0..766d9460 100644 --- a/vendor/github.com/mattn/go-colorable/colorable_others.go +++ b/vendor/github.com/mattn/go-colorable/colorable_others.go @@ -1,5 +1,5 @@ -// +build !windows -// +build !appengine +//go:build !windows && !appengine +// +build !windows,!appengine package colorable diff --git a/vendor/github.com/mattn/go-colorable/colorable_windows.go b/vendor/github.com/mattn/go-colorable/colorable_windows.go index 41215d7f..1846ad5a 100644 --- a/vendor/github.com/mattn/go-colorable/colorable_windows.go +++ b/vendor/github.com/mattn/go-colorable/colorable_windows.go @@ -1,5 +1,5 @@ -// +build windows -// +build !appengine +//go:build windows && !appengine +// +build windows,!appengine package colorable @@ -452,18 +452,22 @@ func (w *Writer) Write(data []byte) (n int, err error) { } else { er = bytes.NewReader(data) } - var bw [1]byte + var plaintext bytes.Buffer loop: for { c1, err := er.ReadByte() if err != nil { + plaintext.WriteTo(w.out) break loop } if c1 != 0x1b { - bw[0] = c1 - w.out.Write(bw[:]) + plaintext.WriteByte(c1) continue } + _, err = plaintext.WriteTo(w.out) + if err != nil { + break loop + } c2, err := er.ReadByte() if err != nil { break loop diff --git a/vendor/github.com/mattn/go-colorable/noncolorable.go b/vendor/github.com/mattn/go-colorable/noncolorable.go index 95f2c6be..05d6f74b 100644 --- a/vendor/github.com/mattn/go-colorable/noncolorable.go +++ b/vendor/github.com/mattn/go-colorable/noncolorable.go @@ -18,18 +18,22 @@ func NewNonColorable(w io.Writer) io.Writer { // Write writes data on console func (w *NonColorable) Write(data []byte) (n int, err error) { er := bytes.NewReader(data) - var bw [1]byte + var plaintext bytes.Buffer loop: for { c1, err := er.ReadByte() if err != nil { + plaintext.WriteTo(w.out) break loop } if c1 != 0x1b { - bw[0] = c1 - w.out.Write(bw[:]) + plaintext.WriteByte(c1) continue } + _, err = plaintext.WriteTo(w.out) + if err != nil { + break loop + } c2, err := er.ReadByte() if err != nil { break loop @@ -38,7 +42,6 @@ loop: continue } - var buf bytes.Buffer for { c, err := er.ReadByte() if err != nil { @@ -47,7 +50,6 @@ loop: if ('a' <= c && c <= 'z') || ('A' <= c && c <= 'Z') || c == '@' { break } - buf.Write([]byte(string(c))) } } diff --git a/vendor/github.com/mattn/go-isatty/.travis.yml b/vendor/github.com/mattn/go-isatty/.travis.yml deleted file mode 100644 index 604314dd..00000000 --- a/vendor/github.com/mattn/go-isatty/.travis.yml +++ /dev/null @@ -1,14 +0,0 @@ -language: go -sudo: false -go: - - 1.13.x - - tip - -before_install: - - go get -t -v ./... - -script: - - ./go.test.sh - -after_success: - - bash <(curl -s https://codecov.io/bash) diff --git a/vendor/github.com/mattn/go-isatty/isatty_bsd.go b/vendor/github.com/mattn/go-isatty/isatty_bsd.go index 711f2880..39bbcf00 100644 --- a/vendor/github.com/mattn/go-isatty/isatty_bsd.go +++ b/vendor/github.com/mattn/go-isatty/isatty_bsd.go @@ -1,3 +1,4 @@ +//go:build (darwin || freebsd || openbsd || netbsd || dragonfly) && !appengine // +build darwin freebsd openbsd netbsd dragonfly // +build !appengine diff --git a/vendor/github.com/mattn/go-isatty/isatty_others.go b/vendor/github.com/mattn/go-isatty/isatty_others.go index ff714a37..31503226 100644 --- a/vendor/github.com/mattn/go-isatty/isatty_others.go +++ b/vendor/github.com/mattn/go-isatty/isatty_others.go @@ -1,4 +1,5 @@ -// +build appengine js nacl +//go:build appengine || js || nacl || wasm +// +build appengine js nacl wasm package isatty diff --git a/vendor/github.com/mattn/go-isatty/isatty_plan9.go b/vendor/github.com/mattn/go-isatty/isatty_plan9.go index c5b6e0c0..bae7f9bb 100644 --- a/vendor/github.com/mattn/go-isatty/isatty_plan9.go +++ b/vendor/github.com/mattn/go-isatty/isatty_plan9.go @@ -1,3 +1,4 @@ +//go:build plan9 // +build plan9 package isatty diff --git a/vendor/github.com/mattn/go-isatty/isatty_solaris.go b/vendor/github.com/mattn/go-isatty/isatty_solaris.go index bdd5c79a..0c3acf2d 100644 --- a/vendor/github.com/mattn/go-isatty/isatty_solaris.go +++ b/vendor/github.com/mattn/go-isatty/isatty_solaris.go @@ -1,5 +1,5 @@ -// +build solaris -// +build !appengine +//go:build solaris && !appengine +// +build solaris,!appengine package isatty @@ -8,10 +8,9 @@ import ( ) // IsTerminal returns true if the given file descriptor is a terminal. -// see: http://src.illumos.org/source/xref/illumos-gate/usr/src/lib/libbc/libc/gen/common/isatty.c +// see: https://src.illumos.org/source/xref/illumos-gate/usr/src/lib/libc/port/gen/isatty.c func IsTerminal(fd uintptr) bool { - var termio unix.Termio - err := unix.IoctlSetTermio(int(fd), unix.TCGETA, &termio) + _, err := unix.IoctlGetTermio(int(fd), unix.TCGETA) return err == nil } diff --git a/vendor/github.com/mattn/go-isatty/isatty_tcgets.go b/vendor/github.com/mattn/go-isatty/isatty_tcgets.go index 31a1ca97..67787657 100644 --- a/vendor/github.com/mattn/go-isatty/isatty_tcgets.go +++ b/vendor/github.com/mattn/go-isatty/isatty_tcgets.go @@ -1,4 +1,5 @@ -// +build linux aix +//go:build (linux || aix || zos) && !appengine +// +build linux aix zos // +build !appengine package isatty diff --git a/vendor/github.com/mattn/go-isatty/isatty_windows.go b/vendor/github.com/mattn/go-isatty/isatty_windows.go index 1fa86915..8e3c9917 100644 --- a/vendor/github.com/mattn/go-isatty/isatty_windows.go +++ b/vendor/github.com/mattn/go-isatty/isatty_windows.go @@ -1,5 +1,5 @@ -// +build windows -// +build !appengine +//go:build windows && !appengine +// +build windows,!appengine package isatty @@ -76,7 +76,7 @@ func isCygwinPipeName(name string) bool { } // getFileNameByHandle use the undocomented ntdll NtQueryObject to get file full name from file handler -// since GetFileInformationByHandleEx is not avilable under windows Vista and still some old fashion +// since GetFileInformationByHandleEx is not available under windows Vista and still some old fashion // guys are using Windows XP, this is a workaround for those guys, it will also work on system from // Windows vista to 10 // see https://stackoverflow.com/a/18792477 for details diff --git a/vendor/github.com/mattn/go-isatty/renovate.json b/vendor/github.com/mattn/go-isatty/renovate.json deleted file mode 100644 index 5ae9d96b..00000000 --- a/vendor/github.com/mattn/go-isatty/renovate.json +++ /dev/null @@ -1,8 +0,0 @@ -{ - "extends": [ - "config:base" - ], - "postUpdateOptions": [ - "gomodTidy" - ] -} diff --git a/vendor/golang.org/x/text/cases/cases.go b/vendor/golang.org/x/text/cases/cases.go new file mode 100644 index 00000000..752cdf03 --- /dev/null +++ b/vendor/golang.org/x/text/cases/cases.go @@ -0,0 +1,162 @@ +// Copyright 2014 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:generate go run gen.go gen_trieval.go + +// Package cases provides general and language-specific case mappers. +package cases // import "golang.org/x/text/cases" + +import ( + "golang.org/x/text/language" + "golang.org/x/text/transform" +) + +// References: +// - Unicode Reference Manual Chapter 3.13, 4.2, and 5.18. +// - https://www.unicode.org/reports/tr29/ +// - https://www.unicode.org/Public/6.3.0/ucd/CaseFolding.txt +// - https://www.unicode.org/Public/6.3.0/ucd/SpecialCasing.txt +// - https://www.unicode.org/Public/6.3.0/ucd/DerivedCoreProperties.txt +// - https://www.unicode.org/Public/6.3.0/ucd/auxiliary/WordBreakProperty.txt +// - https://www.unicode.org/Public/6.3.0/ucd/auxiliary/WordBreakTest.txt +// - http://userguide.icu-project.org/transforms/casemappings + +// TODO: +// - Case folding +// - Wide and Narrow? +// - Segmenter option for title casing. +// - ASCII fast paths +// - Encode Soft-Dotted property within trie somehow. + +// A Caser transforms given input to a certain case. It implements +// transform.Transformer. +// +// A Caser may be stateful and should therefore not be shared between +// goroutines. +type Caser struct { + t transform.SpanningTransformer +} + +// Bytes returns a new byte slice with the result of converting b to the case +// form implemented by c. +func (c Caser) Bytes(b []byte) []byte { + b, _, _ = transform.Bytes(c.t, b) + return b +} + +// String returns a string with the result of transforming s to the case form +// implemented by c. +func (c Caser) String(s string) string { + s, _, _ = transform.String(c.t, s) + return s +} + +// Reset resets the Caser to be reused for new input after a previous call to +// Transform. +func (c Caser) Reset() { c.t.Reset() } + +// Transform implements the transform.Transformer interface and transforms the +// given input to the case form implemented by c. +func (c Caser) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { + return c.t.Transform(dst, src, atEOF) +} + +// Span implements the transform.SpanningTransformer interface. +func (c Caser) Span(src []byte, atEOF bool) (n int, err error) { + return c.t.Span(src, atEOF) +} + +// Upper returns a Caser for language-specific uppercasing. +func Upper(t language.Tag, opts ...Option) Caser { + return Caser{makeUpper(t, getOpts(opts...))} +} + +// Lower returns a Caser for language-specific lowercasing. +func Lower(t language.Tag, opts ...Option) Caser { + return Caser{makeLower(t, getOpts(opts...))} +} + +// Title returns a Caser for language-specific title casing. It uses an +// approximation of the default Unicode Word Break algorithm. +func Title(t language.Tag, opts ...Option) Caser { + return Caser{makeTitle(t, getOpts(opts...))} +} + +// Fold returns a Caser that implements Unicode case folding. The returned Caser +// is stateless and safe to use concurrently by multiple goroutines. +// +// Case folding does not normalize the input and may not preserve a normal form. +// Use the collate or search package for more convenient and linguistically +// sound comparisons. Use golang.org/x/text/secure/precis for string comparisons +// where security aspects are a concern. +func Fold(opts ...Option) Caser { + return Caser{makeFold(getOpts(opts...))} +} + +// An Option is used to modify the behavior of a Caser. +type Option func(o options) options + +// TODO: consider these options to take a boolean as well, like FinalSigma. +// The advantage of using this approach is that other providers of a lower-case +// algorithm could set different defaults by prefixing a user-provided slice +// of options with their own. This is handy, for instance, for the precis +// package which would override the default to not handle the Greek final sigma. + +var ( + // NoLower disables the lowercasing of non-leading letters for a title + // caser. + NoLower Option = noLower + + // Compact omits mappings in case folding for characters that would grow the + // input. (Unimplemented.) + Compact Option = compact +) + +// TODO: option to preserve a normal form, if applicable? + +type options struct { + noLower bool + simple bool + + // TODO: segmenter, max ignorable, alternative versions, etc. + + ignoreFinalSigma bool +} + +func getOpts(o ...Option) (res options) { + for _, f := range o { + res = f(res) + } + return +} + +func noLower(o options) options { + o.noLower = true + return o +} + +func compact(o options) options { + o.simple = true + return o +} + +// HandleFinalSigma specifies whether the special handling of Greek final sigma +// should be enabled. Unicode prescribes handling the Greek final sigma for all +// locales, but standards like IDNA and PRECIS override this default. +func HandleFinalSigma(enable bool) Option { + if enable { + return handleFinalSigma + } + return ignoreFinalSigma +} + +func ignoreFinalSigma(o options) options { + o.ignoreFinalSigma = true + return o +} + +func handleFinalSigma(o options) options { + o.ignoreFinalSigma = false + return o +} diff --git a/vendor/golang.org/x/text/cases/context.go b/vendor/golang.org/x/text/cases/context.go new file mode 100644 index 00000000..e9aa9e19 --- /dev/null +++ b/vendor/golang.org/x/text/cases/context.go @@ -0,0 +1,376 @@ +// Copyright 2014 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package cases + +import "golang.org/x/text/transform" + +// A context is used for iterating over source bytes, fetching case info and +// writing to a destination buffer. +// +// Casing operations may need more than one rune of context to decide how a rune +// should be cased. Casing implementations should call checkpoint on context +// whenever it is known to be safe to return the runes processed so far. +// +// It is recommended for implementations to not allow for more than 30 case +// ignorables as lookahead (analogous to the limit in norm) and to use state if +// unbounded lookahead is needed for cased runes. +type context struct { + dst, src []byte + atEOF bool + + pDst int // pDst points past the last written rune in dst. + pSrc int // pSrc points to the start of the currently scanned rune. + + // checkpoints safe to return in Transform, where nDst <= pDst and nSrc <= pSrc. + nDst, nSrc int + err error + + sz int // size of current rune + info info // case information of currently scanned rune + + // State preserved across calls to Transform. + isMidWord bool // false if next cased letter needs to be title-cased. +} + +func (c *context) Reset() { + c.isMidWord = false +} + +// ret returns the return values for the Transform method. It checks whether +// there were insufficient bytes in src to complete and introduces an error +// accordingly, if necessary. +func (c *context) ret() (nDst, nSrc int, err error) { + if c.err != nil || c.nSrc == len(c.src) { + return c.nDst, c.nSrc, c.err + } + // This point is only reached by mappers if there was no short destination + // buffer. This means that the source buffer was exhausted and that c.sz was + // set to 0 by next. + if c.atEOF && c.pSrc == len(c.src) { + return c.pDst, c.pSrc, nil + } + return c.nDst, c.nSrc, transform.ErrShortSrc +} + +// retSpan returns the return values for the Span method. It checks whether +// there were insufficient bytes in src to complete and introduces an error +// accordingly, if necessary. +func (c *context) retSpan() (n int, err error) { + _, nSrc, err := c.ret() + return nSrc, err +} + +// checkpoint sets the return value buffer points for Transform to the current +// positions. +func (c *context) checkpoint() { + if c.err == nil { + c.nDst, c.nSrc = c.pDst, c.pSrc+c.sz + } +} + +// unreadRune causes the last rune read by next to be reread on the next +// invocation of next. Only one unreadRune may be called after a call to next. +func (c *context) unreadRune() { + c.sz = 0 +} + +func (c *context) next() bool { + c.pSrc += c.sz + if c.pSrc == len(c.src) || c.err != nil { + c.info, c.sz = 0, 0 + return false + } + v, sz := trie.lookup(c.src[c.pSrc:]) + c.info, c.sz = info(v), sz + if c.sz == 0 { + if c.atEOF { + // A zero size means we have an incomplete rune. If we are atEOF, + // this means it is an illegal rune, which we will consume one + // byte at a time. + c.sz = 1 + } else { + c.err = transform.ErrShortSrc + return false + } + } + return true +} + +// writeBytes adds bytes to dst. +func (c *context) writeBytes(b []byte) bool { + if len(c.dst)-c.pDst < len(b) { + c.err = transform.ErrShortDst + return false + } + // This loop is faster than using copy. + for _, ch := range b { + c.dst[c.pDst] = ch + c.pDst++ + } + return true +} + +// writeString writes the given string to dst. +func (c *context) writeString(s string) bool { + if len(c.dst)-c.pDst < len(s) { + c.err = transform.ErrShortDst + return false + } + // This loop is faster than using copy. + for i := 0; i < len(s); i++ { + c.dst[c.pDst] = s[i] + c.pDst++ + } + return true +} + +// copy writes the current rune to dst. +func (c *context) copy() bool { + return c.writeBytes(c.src[c.pSrc : c.pSrc+c.sz]) +} + +// copyXOR copies the current rune to dst and modifies it by applying the XOR +// pattern of the case info. It is the responsibility of the caller to ensure +// that this is a rune with a XOR pattern defined. +func (c *context) copyXOR() bool { + if !c.copy() { + return false + } + if c.info&xorIndexBit == 0 { + // Fast path for 6-bit XOR pattern, which covers most cases. + c.dst[c.pDst-1] ^= byte(c.info >> xorShift) + } else { + // Interpret XOR bits as an index. + // TODO: test performance for unrolling this loop. Verify that we have + // at least two bytes and at most three. + idx := c.info >> xorShift + for p := c.pDst - 1; ; p-- { + c.dst[p] ^= xorData[idx] + idx-- + if xorData[idx] == 0 { + break + } + } + } + return true +} + +// hasPrefix returns true if src[pSrc:] starts with the given string. +func (c *context) hasPrefix(s string) bool { + b := c.src[c.pSrc:] + if len(b) < len(s) { + return false + } + for i, c := range b[:len(s)] { + if c != s[i] { + return false + } + } + return true +} + +// caseType returns an info with only the case bits, normalized to either +// cLower, cUpper, cTitle or cUncased. +func (c *context) caseType() info { + cm := c.info & 0x7 + if cm < 4 { + return cm + } + if cm >= cXORCase { + // xor the last bit of the rune with the case type bits. + b := c.src[c.pSrc+c.sz-1] + return info(b&1) ^ cm&0x3 + } + if cm == cIgnorableCased { + return cLower + } + return cUncased +} + +// lower writes the lowercase version of the current rune to dst. +func lower(c *context) bool { + ct := c.caseType() + if c.info&hasMappingMask == 0 || ct == cLower { + return c.copy() + } + if c.info&exceptionBit == 0 { + return c.copyXOR() + } + e := exceptions[c.info>>exceptionShift:] + offset := 2 + e[0]&lengthMask // size of header + fold string + if nLower := (e[1] >> lengthBits) & lengthMask; nLower != noChange { + return c.writeString(e[offset : offset+nLower]) + } + return c.copy() +} + +func isLower(c *context) bool { + ct := c.caseType() + if c.info&hasMappingMask == 0 || ct == cLower { + return true + } + if c.info&exceptionBit == 0 { + c.err = transform.ErrEndOfSpan + return false + } + e := exceptions[c.info>>exceptionShift:] + if nLower := (e[1] >> lengthBits) & lengthMask; nLower != noChange { + c.err = transform.ErrEndOfSpan + return false + } + return true +} + +// upper writes the uppercase version of the current rune to dst. +func upper(c *context) bool { + ct := c.caseType() + if c.info&hasMappingMask == 0 || ct == cUpper { + return c.copy() + } + if c.info&exceptionBit == 0 { + return c.copyXOR() + } + e := exceptions[c.info>>exceptionShift:] + offset := 2 + e[0]&lengthMask // size of header + fold string + // Get length of first special case mapping. + n := (e[1] >> lengthBits) & lengthMask + if ct == cTitle { + // The first special case mapping is for lower. Set n to the second. + if n == noChange { + n = 0 + } + n, e = e[1]&lengthMask, e[n:] + } + if n != noChange { + return c.writeString(e[offset : offset+n]) + } + return c.copy() +} + +// isUpper writes the isUppercase version of the current rune to dst. +func isUpper(c *context) bool { + ct := c.caseType() + if c.info&hasMappingMask == 0 || ct == cUpper { + return true + } + if c.info&exceptionBit == 0 { + c.err = transform.ErrEndOfSpan + return false + } + e := exceptions[c.info>>exceptionShift:] + // Get length of first special case mapping. + n := (e[1] >> lengthBits) & lengthMask + if ct == cTitle { + n = e[1] & lengthMask + } + if n != noChange { + c.err = transform.ErrEndOfSpan + return false + } + return true +} + +// title writes the title case version of the current rune to dst. +func title(c *context) bool { + ct := c.caseType() + if c.info&hasMappingMask == 0 || ct == cTitle { + return c.copy() + } + if c.info&exceptionBit == 0 { + if ct == cLower { + return c.copyXOR() + } + return c.copy() + } + // Get the exception data. + e := exceptions[c.info>>exceptionShift:] + offset := 2 + e[0]&lengthMask // size of header + fold string + + nFirst := (e[1] >> lengthBits) & lengthMask + if nTitle := e[1] & lengthMask; nTitle != noChange { + if nFirst != noChange { + e = e[nFirst:] + } + return c.writeString(e[offset : offset+nTitle]) + } + if ct == cLower && nFirst != noChange { + // Use the uppercase version instead. + return c.writeString(e[offset : offset+nFirst]) + } + // Already in correct case. + return c.copy() +} + +// isTitle reports whether the current rune is in title case. +func isTitle(c *context) bool { + ct := c.caseType() + if c.info&hasMappingMask == 0 || ct == cTitle { + return true + } + if c.info&exceptionBit == 0 { + if ct == cLower { + c.err = transform.ErrEndOfSpan + return false + } + return true + } + // Get the exception data. + e := exceptions[c.info>>exceptionShift:] + if nTitle := e[1] & lengthMask; nTitle != noChange { + c.err = transform.ErrEndOfSpan + return false + } + nFirst := (e[1] >> lengthBits) & lengthMask + if ct == cLower && nFirst != noChange { + c.err = transform.ErrEndOfSpan + return false + } + return true +} + +// foldFull writes the foldFull version of the current rune to dst. +func foldFull(c *context) bool { + if c.info&hasMappingMask == 0 { + return c.copy() + } + ct := c.caseType() + if c.info&exceptionBit == 0 { + if ct != cLower || c.info&inverseFoldBit != 0 { + return c.copyXOR() + } + return c.copy() + } + e := exceptions[c.info>>exceptionShift:] + n := e[0] & lengthMask + if n == 0 { + if ct == cLower { + return c.copy() + } + n = (e[1] >> lengthBits) & lengthMask + } + return c.writeString(e[2 : 2+n]) +} + +// isFoldFull reports whether the current run is mapped to foldFull +func isFoldFull(c *context) bool { + if c.info&hasMappingMask == 0 { + return true + } + ct := c.caseType() + if c.info&exceptionBit == 0 { + if ct != cLower || c.info&inverseFoldBit != 0 { + c.err = transform.ErrEndOfSpan + return false + } + return true + } + e := exceptions[c.info>>exceptionShift:] + n := e[0] & lengthMask + if n == 0 && ct == cLower { + return true + } + c.err = transform.ErrEndOfSpan + return false +} diff --git a/vendor/golang.org/x/text/cases/fold.go b/vendor/golang.org/x/text/cases/fold.go new file mode 100644 index 00000000..85cc434f --- /dev/null +++ b/vendor/golang.org/x/text/cases/fold.go @@ -0,0 +1,34 @@ +// Copyright 2016 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package cases + +import "golang.org/x/text/transform" + +type caseFolder struct{ transform.NopResetter } + +// caseFolder implements the Transformer interface for doing case folding. +func (t *caseFolder) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { + c := context{dst: dst, src: src, atEOF: atEOF} + for c.next() { + foldFull(&c) + c.checkpoint() + } + return c.ret() +} + +func (t *caseFolder) Span(src []byte, atEOF bool) (n int, err error) { + c := context{src: src, atEOF: atEOF} + for c.next() && isFoldFull(&c) { + c.checkpoint() + } + return c.retSpan() +} + +func makeFold(o options) transform.SpanningTransformer { + // TODO: Special case folding, through option Language, Special/Turkic, or + // both. + // TODO: Implement Compact options. + return &caseFolder{} +} diff --git a/vendor/golang.org/x/text/cases/icu.go b/vendor/golang.org/x/text/cases/icu.go new file mode 100644 index 00000000..2dc84b39 --- /dev/null +++ b/vendor/golang.org/x/text/cases/icu.go @@ -0,0 +1,62 @@ +// Copyright 2016 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:build icu +// +build icu + +package cases + +// Ideally these functions would be defined in a test file, but go test doesn't +// allow CGO in tests. The build tag should ensure either way that these +// functions will not end up in the package. + +// TODO: Ensure that the correct ICU version is set. + +/* +#cgo LDFLAGS: -licui18n.57 -licuuc.57 +#include +#include +#include +#include +#include +*/ +import "C" + +import "unsafe" + +func doICU(tag, caser, input string) string { + err := C.UErrorCode(0) + loc := C.CString(tag) + cm := C.ucasemap_open(loc, C.uint32_t(0), &err) + + buf := make([]byte, len(input)*4) + dst := (*C.char)(unsafe.Pointer(&buf[0])) + src := C.CString(input) + + cn := C.int32_t(0) + + switch caser { + case "fold": + cn = C.ucasemap_utf8FoldCase(cm, + dst, C.int32_t(len(buf)), + src, C.int32_t(len(input)), + &err) + case "lower": + cn = C.ucasemap_utf8ToLower(cm, + dst, C.int32_t(len(buf)), + src, C.int32_t(len(input)), + &err) + case "upper": + cn = C.ucasemap_utf8ToUpper(cm, + dst, C.int32_t(len(buf)), + src, C.int32_t(len(input)), + &err) + case "title": + cn = C.ucasemap_utf8ToTitle(cm, + dst, C.int32_t(len(buf)), + src, C.int32_t(len(input)), + &err) + } + return string(buf[:cn]) +} diff --git a/vendor/golang.org/x/text/cases/info.go b/vendor/golang.org/x/text/cases/info.go new file mode 100644 index 00000000..87a7c3e9 --- /dev/null +++ b/vendor/golang.org/x/text/cases/info.go @@ -0,0 +1,82 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package cases + +func (c info) cccVal() info { + if c&exceptionBit != 0 { + return info(exceptions[c>>exceptionShift]) & cccMask + } + return c & cccMask +} + +func (c info) cccType() info { + ccc := c.cccVal() + if ccc <= cccZero { + return cccZero + } + return ccc +} + +// TODO: Implement full Unicode breaking algorithm: +// 1) Implement breaking in separate package. +// 2) Use the breaker here. +// 3) Compare table size and performance of using the more generic breaker. +// +// Note that we can extend the current algorithm to be much more accurate. This +// only makes sense, though, if the performance and/or space penalty of using +// the generic breaker is big. Extra data will only be needed for non-cased +// runes, which means there are sufficient bits left in the caseType. +// ICU prohibits breaking in such cases as well. + +// For the purpose of title casing we use an approximation of the Unicode Word +// Breaking algorithm defined in Annex #29: +// https://www.unicode.org/reports/tr29/#Default_Grapheme_Cluster_Table. +// +// For our approximation, we group the Word Break types into the following +// categories, with associated rules: +// +// 1) Letter: +// ALetter, Hebrew_Letter, Numeric, ExtendNumLet, Extend, Format_FE, ZWJ. +// Rule: Never break between consecutive runes of this category. +// +// 2) Mid: +// MidLetter, MidNumLet, Single_Quote. +// (Cf. case-ignorable: MidLetter, MidNumLet, Single_Quote or cat is Mn, +// Me, Cf, Lm or Sk). +// Rule: Don't break between Letter and Mid, but break between two Mids. +// +// 3) Break: +// Any other category: NewLine, MidNum, CR, LF, Double_Quote, Katakana, and +// Other. +// These categories should always result in a break between two cased letters. +// Rule: Always break. +// +// Note 1: the Katakana and MidNum categories can, in esoteric cases, result in +// preventing a break between two cased letters. For now we will ignore this +// (e.g. [ALetter] [ExtendNumLet] [Katakana] [ExtendNumLet] [ALetter] and +// [ALetter] [Numeric] [MidNum] [Numeric] [ALetter].) +// +// Note 2: the rule for Mid is very approximate, but works in most cases. To +// improve, we could store the categories in the trie value and use a FA to +// manage breaks. See TODO comment above. +// +// Note 3: according to the spec, it is possible for the Extend category to +// introduce breaks between other categories grouped in Letter. However, this +// is undesirable for our purposes. ICU prevents breaks in such cases as well. + +// isBreak returns whether this rune should introduce a break. +func (c info) isBreak() bool { + return c.cccVal() == cccBreak +} + +// isLetter returns whether the rune is of break type ALetter, Hebrew_Letter, +// Numeric, ExtendNumLet, or Extend. +func (c info) isLetter() bool { + ccc := c.cccVal() + if ccc == cccZero { + return !c.isCaseIgnorable() + } + return ccc != cccBreak +} diff --git a/vendor/golang.org/x/text/cases/map.go b/vendor/golang.org/x/text/cases/map.go new file mode 100644 index 00000000..0f7c6a14 --- /dev/null +++ b/vendor/golang.org/x/text/cases/map.go @@ -0,0 +1,816 @@ +// Copyright 2014 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package cases + +// This file contains the definitions of case mappings for all supported +// languages. The rules for the language-specific tailorings were taken and +// modified from the CLDR transform definitions in common/transforms. + +import ( + "strings" + "unicode" + "unicode/utf8" + + "golang.org/x/text/internal" + "golang.org/x/text/language" + "golang.org/x/text/transform" + "golang.org/x/text/unicode/norm" +) + +// A mapFunc takes a context set to the current rune and writes the mapped +// version to the same context. It may advance the context to the next rune. It +// returns whether a checkpoint is possible: whether the pDst bytes written to +// dst so far won't need changing as we see more source bytes. +type mapFunc func(*context) bool + +// A spanFunc takes a context set to the current rune and returns whether this +// rune would be altered when written to the output. It may advance the context +// to the next rune. It returns whether a checkpoint is possible. +type spanFunc func(*context) bool + +// maxIgnorable defines the maximum number of ignorables to consider for +// lookahead operations. +const maxIgnorable = 30 + +// supported lists the language tags for which we have tailorings. +const supported = "und af az el lt nl tr" + +func init() { + tags := []language.Tag{} + for _, s := range strings.Split(supported, " ") { + tags = append(tags, language.MustParse(s)) + } + matcher = internal.NewInheritanceMatcher(tags) + Supported = language.NewCoverage(tags) +} + +var ( + matcher *internal.InheritanceMatcher + + Supported language.Coverage + + // We keep the following lists separate, instead of having a single per- + // language struct, to give the compiler a chance to remove unused code. + + // Some uppercase mappers are stateless, so we can precompute the + // Transformers and save a bit on runtime allocations. + upperFunc = []struct { + upper mapFunc + span spanFunc + }{ + {nil, nil}, // und + {nil, nil}, // af + {aztrUpper(upper), isUpper}, // az + {elUpper, noSpan}, // el + {ltUpper(upper), noSpan}, // lt + {nil, nil}, // nl + {aztrUpper(upper), isUpper}, // tr + } + + undUpper transform.SpanningTransformer = &undUpperCaser{} + undLower transform.SpanningTransformer = &undLowerCaser{} + undLowerIgnoreSigma transform.SpanningTransformer = &undLowerIgnoreSigmaCaser{} + + lowerFunc = []mapFunc{ + nil, // und + nil, // af + aztrLower, // az + nil, // el + ltLower, // lt + nil, // nl + aztrLower, // tr + } + + titleInfos = []struct { + title mapFunc + lower mapFunc + titleSpan spanFunc + rewrite func(*context) + }{ + {title, lower, isTitle, nil}, // und + {title, lower, isTitle, afnlRewrite}, // af + {aztrUpper(title), aztrLower, isTitle, nil}, // az + {title, lower, isTitle, nil}, // el + {ltUpper(title), ltLower, noSpan, nil}, // lt + {nlTitle, lower, nlTitleSpan, afnlRewrite}, // nl + {aztrUpper(title), aztrLower, isTitle, nil}, // tr + } +) + +func makeUpper(t language.Tag, o options) transform.SpanningTransformer { + _, i, _ := matcher.Match(t) + f := upperFunc[i].upper + if f == nil { + return undUpper + } + return &simpleCaser{f: f, span: upperFunc[i].span} +} + +func makeLower(t language.Tag, o options) transform.SpanningTransformer { + _, i, _ := matcher.Match(t) + f := lowerFunc[i] + if f == nil { + if o.ignoreFinalSigma { + return undLowerIgnoreSigma + } + return undLower + } + if o.ignoreFinalSigma { + return &simpleCaser{f: f, span: isLower} + } + return &lowerCaser{ + first: f, + midWord: finalSigma(f), + } +} + +func makeTitle(t language.Tag, o options) transform.SpanningTransformer { + _, i, _ := matcher.Match(t) + x := &titleInfos[i] + lower := x.lower + if o.noLower { + lower = (*context).copy + } else if !o.ignoreFinalSigma { + lower = finalSigma(lower) + } + return &titleCaser{ + title: x.title, + lower: lower, + titleSpan: x.titleSpan, + rewrite: x.rewrite, + } +} + +func noSpan(c *context) bool { + c.err = transform.ErrEndOfSpan + return false +} + +// TODO: consider a similar special case for the fast majority lower case. This +// is a bit more involved so will require some more precise benchmarking to +// justify it. + +type undUpperCaser struct{ transform.NopResetter } + +// undUpperCaser implements the Transformer interface for doing an upper case +// mapping for the root locale (und). It eliminates the need for an allocation +// as it prevents escaping by not using function pointers. +func (t undUpperCaser) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { + c := context{dst: dst, src: src, atEOF: atEOF} + for c.next() { + upper(&c) + c.checkpoint() + } + return c.ret() +} + +func (t undUpperCaser) Span(src []byte, atEOF bool) (n int, err error) { + c := context{src: src, atEOF: atEOF} + for c.next() && isUpper(&c) { + c.checkpoint() + } + return c.retSpan() +} + +// undLowerIgnoreSigmaCaser implements the Transformer interface for doing +// a lower case mapping for the root locale (und) ignoring final sigma +// handling. This casing algorithm is used in some performance-critical packages +// like secure/precis and x/net/http/idna, which warrants its special-casing. +type undLowerIgnoreSigmaCaser struct{ transform.NopResetter } + +func (t undLowerIgnoreSigmaCaser) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { + c := context{dst: dst, src: src, atEOF: atEOF} + for c.next() && lower(&c) { + c.checkpoint() + } + return c.ret() + +} + +// Span implements a generic lower-casing. This is possible as isLower works +// for all lowercasing variants. All lowercase variants only vary in how they +// transform a non-lowercase letter. They will never change an already lowercase +// letter. In addition, there is no state. +func (t undLowerIgnoreSigmaCaser) Span(src []byte, atEOF bool) (n int, err error) { + c := context{src: src, atEOF: atEOF} + for c.next() && isLower(&c) { + c.checkpoint() + } + return c.retSpan() +} + +type simpleCaser struct { + context + f mapFunc + span spanFunc +} + +// simpleCaser implements the Transformer interface for doing a case operation +// on a rune-by-rune basis. +func (t *simpleCaser) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { + c := context{dst: dst, src: src, atEOF: atEOF} + for c.next() && t.f(&c) { + c.checkpoint() + } + return c.ret() +} + +func (t *simpleCaser) Span(src []byte, atEOF bool) (n int, err error) { + c := context{src: src, atEOF: atEOF} + for c.next() && t.span(&c) { + c.checkpoint() + } + return c.retSpan() +} + +// undLowerCaser implements the Transformer interface for doing a lower case +// mapping for the root locale (und) ignoring final sigma handling. This casing +// algorithm is used in some performance-critical packages like secure/precis +// and x/net/http/idna, which warrants its special-casing. +type undLowerCaser struct{ transform.NopResetter } + +func (t undLowerCaser) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { + c := context{dst: dst, src: src, atEOF: atEOF} + + for isInterWord := true; c.next(); { + if isInterWord { + if c.info.isCased() { + if !lower(&c) { + break + } + isInterWord = false + } else if !c.copy() { + break + } + } else { + if c.info.isNotCasedAndNotCaseIgnorable() { + if !c.copy() { + break + } + isInterWord = true + } else if !c.hasPrefix("Σ") { + if !lower(&c) { + break + } + } else if !finalSigmaBody(&c) { + break + } + } + c.checkpoint() + } + return c.ret() +} + +func (t undLowerCaser) Span(src []byte, atEOF bool) (n int, err error) { + c := context{src: src, atEOF: atEOF} + for c.next() && isLower(&c) { + c.checkpoint() + } + return c.retSpan() +} + +// lowerCaser implements the Transformer interface. The default Unicode lower +// casing requires different treatment for the first and subsequent characters +// of a word, most notably to handle the Greek final Sigma. +type lowerCaser struct { + undLowerIgnoreSigmaCaser + + context + + first, midWord mapFunc +} + +func (t *lowerCaser) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { + t.context = context{dst: dst, src: src, atEOF: atEOF} + c := &t.context + + for isInterWord := true; c.next(); { + if isInterWord { + if c.info.isCased() { + if !t.first(c) { + break + } + isInterWord = false + } else if !c.copy() { + break + } + } else { + if c.info.isNotCasedAndNotCaseIgnorable() { + if !c.copy() { + break + } + isInterWord = true + } else if !t.midWord(c) { + break + } + } + c.checkpoint() + } + return c.ret() +} + +// titleCaser implements the Transformer interface. Title casing algorithms +// distinguish between the first letter of a word and subsequent letters of the +// same word. It uses state to avoid requiring a potentially infinite lookahead. +type titleCaser struct { + context + + // rune mappings used by the actual casing algorithms. + title mapFunc + lower mapFunc + titleSpan spanFunc + + rewrite func(*context) +} + +// Transform implements the standard Unicode title case algorithm as defined in +// Chapter 3 of The Unicode Standard: +// toTitlecase(X): Find the word boundaries in X according to Unicode Standard +// Annex #29, "Unicode Text Segmentation." For each word boundary, find the +// first cased character F following the word boundary. If F exists, map F to +// Titlecase_Mapping(F); then map all characters C between F and the following +// word boundary to Lowercase_Mapping(C). +func (t *titleCaser) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { + t.context = context{dst: dst, src: src, atEOF: atEOF, isMidWord: t.isMidWord} + c := &t.context + + if !c.next() { + return c.ret() + } + + for { + p := c.info + if t.rewrite != nil { + t.rewrite(c) + } + + wasMid := p.isMid() + // Break out of this loop on failure to ensure we do not modify the + // state incorrectly. + if p.isCased() { + if !c.isMidWord { + if !t.title(c) { + break + } + c.isMidWord = true + } else if !t.lower(c) { + break + } + } else if !c.copy() { + break + } else if p.isBreak() { + c.isMidWord = false + } + + // As we save the state of the transformer, it is safe to call + // checkpoint after any successful write. + if !(c.isMidWord && wasMid) { + c.checkpoint() + } + + if !c.next() { + break + } + if wasMid && c.info.isMid() { + c.isMidWord = false + } + } + return c.ret() +} + +func (t *titleCaser) Span(src []byte, atEOF bool) (n int, err error) { + t.context = context{src: src, atEOF: atEOF, isMidWord: t.isMidWord} + c := &t.context + + if !c.next() { + return c.retSpan() + } + + for { + p := c.info + if t.rewrite != nil { + t.rewrite(c) + } + + wasMid := p.isMid() + // Break out of this loop on failure to ensure we do not modify the + // state incorrectly. + if p.isCased() { + if !c.isMidWord { + if !t.titleSpan(c) { + break + } + c.isMidWord = true + } else if !isLower(c) { + break + } + } else if p.isBreak() { + c.isMidWord = false + } + // As we save the state of the transformer, it is safe to call + // checkpoint after any successful write. + if !(c.isMidWord && wasMid) { + c.checkpoint() + } + + if !c.next() { + break + } + if wasMid && c.info.isMid() { + c.isMidWord = false + } + } + return c.retSpan() +} + +// finalSigma adds Greek final Sigma handing to another casing function. It +// determines whether a lowercased sigma should be σ or ς, by looking ahead for +// case-ignorables and a cased letters. +func finalSigma(f mapFunc) mapFunc { + return func(c *context) bool { + if !c.hasPrefix("Σ") { + return f(c) + } + return finalSigmaBody(c) + } +} + +func finalSigmaBody(c *context) bool { + // Current rune must be ∑. + + // ::NFD(); + // # 03A3; 03C2; 03A3; 03A3; Final_Sigma; # GREEK CAPITAL LETTER SIGMA + // Σ } [:case-ignorable:]* [:cased:] → σ; + // [:cased:] [:case-ignorable:]* { Σ → ς; + // ::Any-Lower; + // ::NFC(); + + p := c.pDst + c.writeString("ς") + + // TODO: we should do this here, but right now this will never have an + // effect as this is called when the prefix is Sigma, whereas Dutch and + // Afrikaans only test for an apostrophe. + // + // if t.rewrite != nil { + // t.rewrite(c) + // } + + // We need to do one more iteration after maxIgnorable, as a cased + // letter is not an ignorable and may modify the result. + wasMid := false + for i := 0; i < maxIgnorable+1; i++ { + if !c.next() { + return false + } + if !c.info.isCaseIgnorable() { + // All Midword runes are also case ignorable, so we are + // guaranteed to have a letter or word break here. As we are + // unreading the run, there is no need to unset c.isMidWord; + // the title caser will handle this. + if c.info.isCased() { + // p+1 is guaranteed to be in bounds: if writing ς was + // successful, p+1 will contain the second byte of ς. If not, + // this function will have returned after c.next returned false. + c.dst[p+1]++ // ς → σ + } + c.unreadRune() + return true + } + // A case ignorable may also introduce a word break, so we may need + // to continue searching even after detecting a break. + isMid := c.info.isMid() + if (wasMid && isMid) || c.info.isBreak() { + c.isMidWord = false + } + wasMid = isMid + c.copy() + } + return true +} + +// finalSigmaSpan would be the same as isLower. + +// elUpper implements Greek upper casing, which entails removing a predefined +// set of non-blocked modifiers. Note that these accents should not be removed +// for title casing! +// Example: "Οδός" -> "ΟΔΟΣ". +func elUpper(c *context) bool { + // From CLDR: + // [:Greek:] [^[:ccc=Not_Reordered:][:ccc=Above:]]*? { [\u0313\u0314\u0301\u0300\u0306\u0342\u0308\u0304] → ; + // [:Greek:] [^[:ccc=Not_Reordered:][:ccc=Iota_Subscript:]]*? { \u0345 → ; + + r, _ := utf8.DecodeRune(c.src[c.pSrc:]) + oldPDst := c.pDst + if !upper(c) { + return false + } + if !unicode.Is(unicode.Greek, r) { + return true + } + i := 0 + // Take the properties of the uppercased rune that is already written to the + // destination. This saves us the trouble of having to uppercase the + // decomposed rune again. + if b := norm.NFD.Properties(c.dst[oldPDst:]).Decomposition(); b != nil { + // Restore the destination position and process the decomposed rune. + r, sz := utf8.DecodeRune(b) + if r <= 0xFF { // See A.6.1 + return true + } + c.pDst = oldPDst + // Insert the first rune and ignore the modifiers. See A.6.2. + c.writeBytes(b[:sz]) + i = len(b[sz:]) / 2 // Greek modifiers are always of length 2. + } + + for ; i < maxIgnorable && c.next(); i++ { + switch r, _ := utf8.DecodeRune(c.src[c.pSrc:]); r { + // Above and Iota Subscript + case 0x0300, // U+0300 COMBINING GRAVE ACCENT + 0x0301, // U+0301 COMBINING ACUTE ACCENT + 0x0304, // U+0304 COMBINING MACRON + 0x0306, // U+0306 COMBINING BREVE + 0x0308, // U+0308 COMBINING DIAERESIS + 0x0313, // U+0313 COMBINING COMMA ABOVE + 0x0314, // U+0314 COMBINING REVERSED COMMA ABOVE + 0x0342, // U+0342 COMBINING GREEK PERISPOMENI + 0x0345: // U+0345 COMBINING GREEK YPOGEGRAMMENI + // No-op. Gobble the modifier. + + default: + switch v, _ := trie.lookup(c.src[c.pSrc:]); info(v).cccType() { + case cccZero: + c.unreadRune() + return true + + // We don't need to test for IotaSubscript as the only rune that + // qualifies (U+0345) was already excluded in the switch statement + // above. See A.4. + + case cccAbove: + return c.copy() + default: + // Some other modifier. We're still allowed to gobble Greek + // modifiers after this. + c.copy() + } + } + } + return i == maxIgnorable +} + +// TODO: implement elUpperSpan (low-priority: complex and infrequent). + +func ltLower(c *context) bool { + // From CLDR: + // # Introduce an explicit dot above when lowercasing capital I's and J's + // # whenever there are more accents above. + // # (of the accents used in Lithuanian: grave, acute, tilde above, and ogonek) + // # 0049; 0069 0307; 0049; 0049; lt More_Above; # LATIN CAPITAL LETTER I + // # 004A; 006A 0307; 004A; 004A; lt More_Above; # LATIN CAPITAL LETTER J + // # 012E; 012F 0307; 012E; 012E; lt More_Above; # LATIN CAPITAL LETTER I WITH OGONEK + // # 00CC; 0069 0307 0300; 00CC; 00CC; lt; # LATIN CAPITAL LETTER I WITH GRAVE + // # 00CD; 0069 0307 0301; 00CD; 00CD; lt; # LATIN CAPITAL LETTER I WITH ACUTE + // # 0128; 0069 0307 0303; 0128; 0128; lt; # LATIN CAPITAL LETTER I WITH TILDE + // ::NFD(); + // I } [^[:ccc=Not_Reordered:][:ccc=Above:]]* [:ccc=Above:] → i \u0307; + // J } [^[:ccc=Not_Reordered:][:ccc=Above:]]* [:ccc=Above:] → j \u0307; + // I \u0328 (Į) } [^[:ccc=Not_Reordered:][:ccc=Above:]]* [:ccc=Above:] → i \u0328 \u0307; + // I \u0300 (Ì) → i \u0307 \u0300; + // I \u0301 (Í) → i \u0307 \u0301; + // I \u0303 (Ĩ) → i \u0307 \u0303; + // ::Any-Lower(); + // ::NFC(); + + i := 0 + if r := c.src[c.pSrc]; r < utf8.RuneSelf { + lower(c) + if r != 'I' && r != 'J' { + return true + } + } else { + p := norm.NFD.Properties(c.src[c.pSrc:]) + if d := p.Decomposition(); len(d) >= 3 && (d[0] == 'I' || d[0] == 'J') { + // UTF-8 optimization: the decomposition will only have an above + // modifier if the last rune of the decomposition is in [U+300-U+311]. + // In all other cases, a decomposition starting with I is always + // an I followed by modifiers that are not cased themselves. See A.2. + if d[1] == 0xCC && d[2] <= 0x91 { // A.2.4. + if !c.writeBytes(d[:1]) { + return false + } + c.dst[c.pDst-1] += 'a' - 'A' // lower + + // Assumption: modifier never changes on lowercase. See A.1. + // Assumption: all modifiers added have CCC = Above. See A.2.3. + return c.writeString("\u0307") && c.writeBytes(d[1:]) + } + // In all other cases the additional modifiers will have a CCC + // that is less than 230 (Above). We will insert the U+0307, if + // needed, after these modifiers so that a string in FCD form + // will remain so. See A.2.2. + lower(c) + i = 1 + } else { + return lower(c) + } + } + + for ; i < maxIgnorable && c.next(); i++ { + switch c.info.cccType() { + case cccZero: + c.unreadRune() + return true + case cccAbove: + return c.writeString("\u0307") && c.copy() // See A.1. + default: + c.copy() // See A.1. + } + } + return i == maxIgnorable +} + +// ltLowerSpan would be the same as isLower. + +func ltUpper(f mapFunc) mapFunc { + return func(c *context) bool { + // Unicode: + // 0307; 0307; ; ; lt After_Soft_Dotted; # COMBINING DOT ABOVE + // + // From CLDR: + // # Remove \u0307 following soft-dotteds (i, j, and the like), with possible + // # intervening non-230 marks. + // ::NFD(); + // [:Soft_Dotted:] [^[:ccc=Not_Reordered:][:ccc=Above:]]* { \u0307 → ; + // ::Any-Upper(); + // ::NFC(); + + // TODO: See A.5. A soft-dotted rune never has an exception. This would + // allow us to overload the exception bit and encode this property in + // info. Need to measure performance impact of this. + r, _ := utf8.DecodeRune(c.src[c.pSrc:]) + oldPDst := c.pDst + if !f(c) { + return false + } + if !unicode.Is(unicode.Soft_Dotted, r) { + return true + } + + // We don't need to do an NFD normalization, as a soft-dotted rune never + // contains U+0307. See A.3. + + i := 0 + for ; i < maxIgnorable && c.next(); i++ { + switch c.info.cccType() { + case cccZero: + c.unreadRune() + return true + case cccAbove: + if c.hasPrefix("\u0307") { + // We don't do a full NFC, but rather combine runes for + // some of the common cases. (Returning NFC or + // preserving normal form is neither a requirement nor + // a possibility anyway). + if !c.next() { + return false + } + if c.dst[oldPDst] == 'I' && c.pDst == oldPDst+1 && c.src[c.pSrc] == 0xcc { + s := "" + switch c.src[c.pSrc+1] { + case 0x80: // U+0300 COMBINING GRAVE ACCENT + s = "\u00cc" // U+00CC LATIN CAPITAL LETTER I WITH GRAVE + case 0x81: // U+0301 COMBINING ACUTE ACCENT + s = "\u00cd" // U+00CD LATIN CAPITAL LETTER I WITH ACUTE + case 0x83: // U+0303 COMBINING TILDE + s = "\u0128" // U+0128 LATIN CAPITAL LETTER I WITH TILDE + case 0x88: // U+0308 COMBINING DIAERESIS + s = "\u00cf" // U+00CF LATIN CAPITAL LETTER I WITH DIAERESIS + default: + } + if s != "" { + c.pDst = oldPDst + return c.writeString(s) + } + } + } + return c.copy() + default: + c.copy() + } + } + return i == maxIgnorable + } +} + +// TODO: implement ltUpperSpan (low priority: complex and infrequent). + +func aztrUpper(f mapFunc) mapFunc { + return func(c *context) bool { + // i→İ; + if c.src[c.pSrc] == 'i' { + return c.writeString("İ") + } + return f(c) + } +} + +func aztrLower(c *context) (done bool) { + // From CLDR: + // # I and i-dotless; I-dot and i are case pairs in Turkish and Azeri + // # 0130; 0069; 0130; 0130; tr; # LATIN CAPITAL LETTER I WITH DOT ABOVE + // İ→i; + // # When lowercasing, remove dot_above in the sequence I + dot_above, which will turn into i. + // # This matches the behavior of the canonically equivalent I-dot_above + // # 0307; ; 0307; 0307; tr After_I; # COMBINING DOT ABOVE + // # When lowercasing, unless an I is before a dot_above, it turns into a dotless i. + // # 0049; 0131; 0049; 0049; tr Not_Before_Dot; # LATIN CAPITAL LETTER I + // I([^[:ccc=Not_Reordered:][:ccc=Above:]]*)\u0307 → i$1 ; + // I→ı ; + // ::Any-Lower(); + if c.hasPrefix("\u0130") { // İ + return c.writeString("i") + } + if c.src[c.pSrc] != 'I' { + return lower(c) + } + + // We ignore the lower-case I for now, but insert it later when we know + // which form we need. + start := c.pSrc + c.sz + + i := 0 +Loop: + // We check for up to n ignorables before \u0307. As \u0307 is an + // ignorable as well, n is maxIgnorable-1. + for ; i < maxIgnorable && c.next(); i++ { + switch c.info.cccType() { + case cccAbove: + if c.hasPrefix("\u0307") { + return c.writeString("i") && c.writeBytes(c.src[start:c.pSrc]) // ignore U+0307 + } + done = true + break Loop + case cccZero: + c.unreadRune() + done = true + break Loop + default: + // We'll write this rune after we know which starter to use. + } + } + if i == maxIgnorable { + done = true + } + return c.writeString("ı") && c.writeBytes(c.src[start:c.pSrc+c.sz]) && done +} + +// aztrLowerSpan would be the same as isLower. + +func nlTitle(c *context) bool { + // From CLDR: + // # Special titlecasing for Dutch initial "ij". + // ::Any-Title(); + // # Fix up Ij at the beginning of a "word" (per Any-Title, notUAX #29) + // [:^WB=ALetter:] [:WB=Extend:]* [[:WB=MidLetter:][:WB=MidNumLet:]]? { Ij } → IJ ; + if c.src[c.pSrc] != 'I' && c.src[c.pSrc] != 'i' { + return title(c) + } + + if !c.writeString("I") || !c.next() { + return false + } + if c.src[c.pSrc] == 'j' || c.src[c.pSrc] == 'J' { + return c.writeString("J") + } + c.unreadRune() + return true +} + +func nlTitleSpan(c *context) bool { + // From CLDR: + // # Special titlecasing for Dutch initial "ij". + // ::Any-Title(); + // # Fix up Ij at the beginning of a "word" (per Any-Title, notUAX #29) + // [:^WB=ALetter:] [:WB=Extend:]* [[:WB=MidLetter:][:WB=MidNumLet:]]? { Ij } → IJ ; + if c.src[c.pSrc] != 'I' { + return isTitle(c) + } + if !c.next() || c.src[c.pSrc] == 'j' { + return false + } + if c.src[c.pSrc] != 'J' { + c.unreadRune() + } + return true +} + +// Not part of CLDR, but see https://unicode.org/cldr/trac/ticket/7078. +func afnlRewrite(c *context) { + if c.hasPrefix("'") || c.hasPrefix("’") { + c.isMidWord = true + } +} diff --git a/vendor/golang.org/x/text/cases/tables10.0.0.go b/vendor/golang.org/x/text/cases/tables10.0.0.go new file mode 100644 index 00000000..ca992310 --- /dev/null +++ b/vendor/golang.org/x/text/cases/tables10.0.0.go @@ -0,0 +1,2256 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +//go:build go1.10 && !go1.13 +// +build go1.10,!go1.13 + +package cases + +// UnicodeVersion is the Unicode version from which the tables in this package are derived. +const UnicodeVersion = "10.0.0" + +var xorData string = "" + // Size: 185 bytes + "\x00\x06\x07\x00\x01?\x00\x0f\x03\x00\x0f\x12\x00\x0f\x1f\x00\x0f\x1d" + + "\x00\x01\x13\x00\x0f\x16\x00\x0f\x0b\x00\x0f3\x00\x0f7\x00\x01#\x00\x0f?" + + "\x00\x0e'\x00\x0f/\x00\x0e>\x00\x0f*\x00\x0c&\x00\x0c*\x00\x0c;\x00\x0c9" + + "\x00\x0c%\x00\x01\x08\x00\x03\x0d\x00\x03\x09\x00\x02\x06\x00\x02\x02" + + "\x00\x02\x0c\x00\x01\x00\x00\x01\x03\x00\x01\x01\x00\x01 \x00\x01\x0c" + + "\x00\x01\x10\x00\x03\x10\x00\x036 \x00\x037 \x00\x0b#\x10\x00\x0b 0\x00" + + "\x0b!\x10\x00\x0b!0\x00\x0b(\x04\x00\x03\x04\x1e\x00\x03\x0a\x00\x02:" + + "\x00\x02>\x00\x02,\x00\x02\x00\x00\x02\x10\x00\x01<\x00\x01&\x00\x01*" + + "\x00\x01.\x00\x010\x003 \x00\x01\x18\x00\x01(\x00\x01\x1e\x00\x01\x22" + +var exceptions string = "" + // Size: 2068 bytes + "\x00\x12\x12μΜΜ\x12\x12ssSSSs\x13\x18i̇i̇\x10\x09II\x13\x1bʼnʼNʼN\x11" + + "\x09sSS\x12\x12dždžDž\x12\x12dždžDŽ\x10\x12DŽDž\x12\x12ljljLj\x12\x12ljljLJ\x10\x12LJLj" + + "\x12\x12njnjNj\x12\x12njnjNJ\x10\x12NJNj\x13\x1bǰJ̌J̌\x12\x12dzdzDz\x12\x12dzdzDZ\x10" + + "\x12DZDz\x13\x18ⱥⱥ\x13\x18ⱦⱦ\x10\x1bⱾⱾ\x10\x1bⱿⱿ\x10\x1bⱯⱯ\x10\x1bⱭⱭ\x10" + + "\x1bⱰⱰ\x10\x1bꞫꞫ\x10\x1bꞬꞬ\x10\x1bꞍꞍ\x10\x1bꞪꞪ\x10\x1bꞮꞮ\x10\x1bⱢⱢ\x10" + + "\x1bꞭꞭ\x10\x1bⱮⱮ\x10\x1bⱤⱤ\x10\x1bꞱꞱ\x10\x1bꞲꞲ\x10\x1bꞰꞰ2\x12ιΙΙ\x166ΐ" + + "Ϊ́Ϊ́\x166ΰΫ́Ϋ́\x12\x12σΣΣ\x12\x12βΒΒ\x12\x12θΘΘ\x12\x12φΦΦ\x12" + + "\x12πΠΠ\x12\x12κΚΚ\x12\x12ρΡΡ\x12\x12εΕΕ\x14$եւԵՒԵւ\x12\x12вВВ\x12\x12дД" + + "Д\x12\x12оОО\x12\x12сСС\x12\x12тТТ\x12\x12тТТ\x12\x12ъЪЪ\x12\x12ѣѢѢ\x13" + + "\x1bꙋꙊꙊ\x13\x1bẖH̱H̱\x13\x1bẗT̈T̈\x13\x1bẘW̊W̊\x13\x1bẙY̊Y̊\x13\x1ba" + + "ʾAʾAʾ\x13\x1bṡṠṠ\x12\x10ssß\x14$ὐΥ̓Υ̓\x166ὒΥ̓̀Υ̓̀\x166ὔΥ̓́Υ̓́\x166" + + "ὖΥ̓͂Υ̓͂\x15+ἀιἈΙᾈ\x15+ἁιἉΙᾉ\x15+ἂιἊΙᾊ\x15+ἃιἋΙᾋ\x15+ἄιἌΙᾌ\x15+ἅιἍΙᾍ" + + "\x15+ἆιἎΙᾎ\x15+ἇιἏΙᾏ\x15\x1dἀιᾀἈΙ\x15\x1dἁιᾁἉΙ\x15\x1dἂιᾂἊΙ\x15\x1dἃιᾃἋΙ" + + "\x15\x1dἄιᾄἌΙ\x15\x1dἅιᾅἍΙ\x15\x1dἆιᾆἎΙ\x15\x1dἇιᾇἏΙ\x15+ἠιἨΙᾘ\x15+ἡιἩΙᾙ" + + "\x15+ἢιἪΙᾚ\x15+ἣιἫΙᾛ\x15+ἤιἬΙᾜ\x15+ἥιἭΙᾝ\x15+ἦιἮΙᾞ\x15+ἧιἯΙᾟ\x15\x1dἠιᾐἨ" + + "Ι\x15\x1dἡιᾑἩΙ\x15\x1dἢιᾒἪΙ\x15\x1dἣιᾓἫΙ\x15\x1dἤιᾔἬΙ\x15\x1dἥιᾕἭΙ\x15" + + "\x1dἦιᾖἮΙ\x15\x1dἧιᾗἯΙ\x15+ὠιὨΙᾨ\x15+ὡιὩΙᾩ\x15+ὢιὪΙᾪ\x15+ὣιὫΙᾫ\x15+ὤιὬΙᾬ" + + "\x15+ὥιὭΙᾭ\x15+ὦιὮΙᾮ\x15+ὧιὯΙᾯ\x15\x1dὠιᾠὨΙ\x15\x1dὡιᾡὩΙ\x15\x1dὢιᾢὪΙ" + + "\x15\x1dὣιᾣὫΙ\x15\x1dὤιᾤὬΙ\x15\x1dὥιᾥὭΙ\x15\x1dὦιᾦὮΙ\x15\x1dὧιᾧὯΙ\x15-ὰι" + + "ᾺΙᾺͅ\x14#αιΑΙᾼ\x14$άιΆΙΆͅ\x14$ᾶΑ͂Α͂\x166ᾶιΑ͂Ιᾼ͂\x14\x1cαιᾳΑΙ\x12" + + "\x12ιΙΙ\x15-ὴιῊΙῊͅ\x14#ηιΗΙῌ\x14$ήιΉΙΉͅ\x14$ῆΗ͂Η͂\x166ῆιΗ͂Ιῌ͂\x14\x1c" + + "ηιῃΗΙ\x166ῒΪ̀Ϊ̀\x166ΐΪ́Ϊ́\x14$ῖΙ͂Ι͂\x166ῗΪ͂Ϊ͂\x166ῢΫ̀Ϋ" + + "̀\x166ΰΫ́Ϋ́\x14$ῤΡ̓Ρ̓\x14$ῦΥ͂Υ͂\x166ῧΫ͂Ϋ͂\x15-ὼιῺΙῺͅ\x14#ωιΩΙ" + + "ῼ\x14$ώιΏΙΏͅ\x14$ῶΩ͂Ω͂\x166ῶιΩ͂Ιῼ͂\x14\x1cωιῳΩΙ\x12\x10ωω\x11\x08kk" + + "\x12\x10åå\x12\x10ɫɫ\x12\x10ɽɽ\x10\x12ȺȺ\x10\x12ȾȾ\x12\x10ɑɑ\x12\x10ɱɱ" + + "\x12\x10ɐɐ\x12\x10ɒɒ\x12\x10ȿȿ\x12\x10ɀɀ\x12\x10ɥɥ\x12\x10ɦɦ\x12\x10ɜɜ" + + "\x12\x10ɡɡ\x12\x10ɬɬ\x12\x10ɪɪ\x12\x10ʞʞ\x12\x10ʇʇ\x12\x10ʝʝ\x12\x12ffFF" + + "Ff\x12\x12fiFIFi\x12\x12flFLFl\x13\x1bffiFFIFfi\x13\x1bfflFFLFfl\x12\x12" + + "stSTSt\x12\x12stSTSt\x14$մնՄՆՄն\x14$մեՄԵՄե\x14$միՄԻՄի\x14$վնՎՆՎն\x14$մխՄ" + + "ԽՄխ" + +// lookup returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *caseTrie) lookup(s []byte) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return caseValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = caseIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *caseTrie) lookupUnsafe(s []byte) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return caseValues[c0] + } + i := caseIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = caseIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = caseIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// lookupString returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *caseTrie) lookupString(s string) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return caseValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = caseIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *caseTrie) lookupStringUnsafe(s string) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return caseValues[c0] + } + i := caseIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = caseIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = caseIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// caseTrie. Total size: 11892 bytes (11.61 KiB). Checksum: c6f15484b7653775. +type caseTrie struct{} + +func newCaseTrie(i int) *caseTrie { + return &caseTrie{} +} + +// lookupValue determines the type of block n and looks up the value for b. +func (t *caseTrie) lookupValue(n uint32, b byte) uint16 { + switch { + case n < 18: + return uint16(caseValues[n<<6+uint32(b)]) + default: + n -= 18 + return uint16(sparse.lookup(n, b)) + } +} + +// caseValues: 20 blocks, 1280 entries, 2560 bytes +// The third block is the zero block. +var caseValues = [1280]uint16{ + // Block 0x0, offset 0x0 + 0x27: 0x0054, + 0x2e: 0x0054, + 0x30: 0x0010, 0x31: 0x0010, 0x32: 0x0010, 0x33: 0x0010, 0x34: 0x0010, 0x35: 0x0010, + 0x36: 0x0010, 0x37: 0x0010, 0x38: 0x0010, 0x39: 0x0010, 0x3a: 0x0054, + // Block 0x1, offset 0x40 + 0x41: 0x2013, 0x42: 0x2013, 0x43: 0x2013, 0x44: 0x2013, 0x45: 0x2013, + 0x46: 0x2013, 0x47: 0x2013, 0x48: 0x2013, 0x49: 0x2013, 0x4a: 0x2013, 0x4b: 0x2013, + 0x4c: 0x2013, 0x4d: 0x2013, 0x4e: 0x2013, 0x4f: 0x2013, 0x50: 0x2013, 0x51: 0x2013, + 0x52: 0x2013, 0x53: 0x2013, 0x54: 0x2013, 0x55: 0x2013, 0x56: 0x2013, 0x57: 0x2013, + 0x58: 0x2013, 0x59: 0x2013, 0x5a: 0x2013, + 0x5e: 0x0004, 0x5f: 0x0010, 0x60: 0x0004, 0x61: 0x2012, 0x62: 0x2012, 0x63: 0x2012, + 0x64: 0x2012, 0x65: 0x2012, 0x66: 0x2012, 0x67: 0x2012, 0x68: 0x2012, 0x69: 0x2012, + 0x6a: 0x2012, 0x6b: 0x2012, 0x6c: 0x2012, 0x6d: 0x2012, 0x6e: 0x2012, 0x6f: 0x2012, + 0x70: 0x2012, 0x71: 0x2012, 0x72: 0x2012, 0x73: 0x2012, 0x74: 0x2012, 0x75: 0x2012, + 0x76: 0x2012, 0x77: 0x2012, 0x78: 0x2012, 0x79: 0x2012, 0x7a: 0x2012, + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc0: 0x0852, 0xc1: 0x0b53, 0xc2: 0x0113, 0xc3: 0x0112, 0xc4: 0x0113, 0xc5: 0x0112, + 0xc6: 0x0b53, 0xc7: 0x0f13, 0xc8: 0x0f12, 0xc9: 0x0e53, 0xca: 0x1153, 0xcb: 0x0713, + 0xcc: 0x0712, 0xcd: 0x0012, 0xce: 0x1453, 0xcf: 0x1753, 0xd0: 0x1a53, 0xd1: 0x0313, + 0xd2: 0x0312, 0xd3: 0x1d53, 0xd4: 0x2053, 0xd5: 0x2352, 0xd6: 0x2653, 0xd7: 0x2653, + 0xd8: 0x0113, 0xd9: 0x0112, 0xda: 0x2952, 0xdb: 0x0012, 0xdc: 0x1d53, 0xdd: 0x2c53, + 0xde: 0x2f52, 0xdf: 0x3253, 0xe0: 0x0113, 0xe1: 0x0112, 0xe2: 0x0113, 0xe3: 0x0112, + 0xe4: 0x0113, 0xe5: 0x0112, 0xe6: 0x3553, 0xe7: 0x0f13, 0xe8: 0x0f12, 0xe9: 0x3853, + 0xea: 0x0012, 0xeb: 0x0012, 0xec: 0x0113, 0xed: 0x0112, 0xee: 0x3553, 0xef: 0x1f13, + 0xf0: 0x1f12, 0xf1: 0x3b53, 0xf2: 0x3e53, 0xf3: 0x0713, 0xf4: 0x0712, 0xf5: 0x0313, + 0xf6: 0x0312, 0xf7: 0x4153, 0xf8: 0x0113, 0xf9: 0x0112, 0xfa: 0x0012, 0xfb: 0x0010, + 0xfc: 0x0113, 0xfd: 0x0112, 0xfe: 0x0012, 0xff: 0x4452, + // Block 0x4, offset 0x100 + 0x100: 0x0010, 0x101: 0x0010, 0x102: 0x0010, 0x103: 0x0010, 0x104: 0x02db, 0x105: 0x0359, + 0x106: 0x03da, 0x107: 0x043b, 0x108: 0x04b9, 0x109: 0x053a, 0x10a: 0x059b, 0x10b: 0x0619, + 0x10c: 0x069a, 0x10d: 0x0313, 0x10e: 0x0312, 0x10f: 0x1f13, 0x110: 0x1f12, 0x111: 0x0313, + 0x112: 0x0312, 0x113: 0x0713, 0x114: 0x0712, 0x115: 0x0313, 0x116: 0x0312, 0x117: 0x0f13, + 0x118: 0x0f12, 0x119: 0x0313, 0x11a: 0x0312, 0x11b: 0x0713, 0x11c: 0x0712, 0x11d: 0x1452, + 0x11e: 0x0113, 0x11f: 0x0112, 0x120: 0x0113, 0x121: 0x0112, 0x122: 0x0113, 0x123: 0x0112, + 0x124: 0x0113, 0x125: 0x0112, 0x126: 0x0113, 0x127: 0x0112, 0x128: 0x0113, 0x129: 0x0112, + 0x12a: 0x0113, 0x12b: 0x0112, 0x12c: 0x0113, 0x12d: 0x0112, 0x12e: 0x0113, 0x12f: 0x0112, + 0x130: 0x06fa, 0x131: 0x07ab, 0x132: 0x0829, 0x133: 0x08aa, 0x134: 0x0113, 0x135: 0x0112, + 0x136: 0x2353, 0x137: 0x4453, 0x138: 0x0113, 0x139: 0x0112, 0x13a: 0x0113, 0x13b: 0x0112, + 0x13c: 0x0113, 0x13d: 0x0112, 0x13e: 0x0113, 0x13f: 0x0112, + // Block 0x5, offset 0x140 + 0x140: 0x0a8a, 0x141: 0x0313, 0x142: 0x0312, 0x143: 0x0853, 0x144: 0x4753, 0x145: 0x4a53, + 0x146: 0x0113, 0x147: 0x0112, 0x148: 0x0113, 0x149: 0x0112, 0x14a: 0x0113, 0x14b: 0x0112, + 0x14c: 0x0113, 0x14d: 0x0112, 0x14e: 0x0113, 0x14f: 0x0112, 0x150: 0x0b0a, 0x151: 0x0b8a, + 0x152: 0x0c0a, 0x153: 0x0b52, 0x154: 0x0b52, 0x155: 0x0012, 0x156: 0x0e52, 0x157: 0x1152, + 0x158: 0x0012, 0x159: 0x1752, 0x15a: 0x0012, 0x15b: 0x1a52, 0x15c: 0x0c8a, 0x15d: 0x0012, + 0x15e: 0x0012, 0x15f: 0x0012, 0x160: 0x1d52, 0x161: 0x0d0a, 0x162: 0x0012, 0x163: 0x2052, + 0x164: 0x0012, 0x165: 0x0d8a, 0x166: 0x0e0a, 0x167: 0x0012, 0x168: 0x2652, 0x169: 0x2652, + 0x16a: 0x0e8a, 0x16b: 0x0f0a, 0x16c: 0x0f8a, 0x16d: 0x0012, 0x16e: 0x0012, 0x16f: 0x1d52, + 0x170: 0x0012, 0x171: 0x100a, 0x172: 0x2c52, 0x173: 0x0012, 0x174: 0x0012, 0x175: 0x3252, + 0x176: 0x0012, 0x177: 0x0012, 0x178: 0x0012, 0x179: 0x0012, 0x17a: 0x0012, 0x17b: 0x0012, + 0x17c: 0x0012, 0x17d: 0x108a, 0x17e: 0x0012, 0x17f: 0x0012, + // Block 0x6, offset 0x180 + 0x180: 0x3552, 0x181: 0x0012, 0x182: 0x0012, 0x183: 0x3852, 0x184: 0x0012, 0x185: 0x0012, + 0x186: 0x0012, 0x187: 0x110a, 0x188: 0x3552, 0x189: 0x4752, 0x18a: 0x3b52, 0x18b: 0x3e52, + 0x18c: 0x4a52, 0x18d: 0x0012, 0x18e: 0x0012, 0x18f: 0x0012, 0x190: 0x0012, 0x191: 0x0012, + 0x192: 0x4152, 0x193: 0x0012, 0x194: 0x0010, 0x195: 0x0012, 0x196: 0x0012, 0x197: 0x0012, + 0x198: 0x0012, 0x199: 0x0012, 0x19a: 0x0012, 0x19b: 0x0012, 0x19c: 0x0012, 0x19d: 0x118a, + 0x19e: 0x120a, 0x19f: 0x0012, 0x1a0: 0x0012, 0x1a1: 0x0012, 0x1a2: 0x0012, 0x1a3: 0x0012, + 0x1a4: 0x0012, 0x1a5: 0x0012, 0x1a6: 0x0012, 0x1a7: 0x0012, 0x1a8: 0x0012, 0x1a9: 0x0012, + 0x1aa: 0x0012, 0x1ab: 0x0012, 0x1ac: 0x0012, 0x1ad: 0x0012, 0x1ae: 0x0012, 0x1af: 0x0012, + 0x1b0: 0x0015, 0x1b1: 0x0015, 0x1b2: 0x0015, 0x1b3: 0x0015, 0x1b4: 0x0015, 0x1b5: 0x0015, + 0x1b6: 0x0015, 0x1b7: 0x0015, 0x1b8: 0x0015, 0x1b9: 0x0014, 0x1ba: 0x0014, 0x1bb: 0x0014, + 0x1bc: 0x0014, 0x1bd: 0x0014, 0x1be: 0x0014, 0x1bf: 0x0014, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x0024, 0x1c1: 0x0024, 0x1c2: 0x0024, 0x1c3: 0x0024, 0x1c4: 0x0024, 0x1c5: 0x128d, + 0x1c6: 0x0024, 0x1c7: 0x0034, 0x1c8: 0x0034, 0x1c9: 0x0034, 0x1ca: 0x0024, 0x1cb: 0x0024, + 0x1cc: 0x0024, 0x1cd: 0x0034, 0x1ce: 0x0034, 0x1cf: 0x0014, 0x1d0: 0x0024, 0x1d1: 0x0024, + 0x1d2: 0x0024, 0x1d3: 0x0034, 0x1d4: 0x0034, 0x1d5: 0x0034, 0x1d6: 0x0034, 0x1d7: 0x0024, + 0x1d8: 0x0034, 0x1d9: 0x0034, 0x1da: 0x0034, 0x1db: 0x0024, 0x1dc: 0x0034, 0x1dd: 0x0034, + 0x1de: 0x0034, 0x1df: 0x0034, 0x1e0: 0x0034, 0x1e1: 0x0034, 0x1e2: 0x0034, 0x1e3: 0x0024, + 0x1e4: 0x0024, 0x1e5: 0x0024, 0x1e6: 0x0024, 0x1e7: 0x0024, 0x1e8: 0x0024, 0x1e9: 0x0024, + 0x1ea: 0x0024, 0x1eb: 0x0024, 0x1ec: 0x0024, 0x1ed: 0x0024, 0x1ee: 0x0024, 0x1ef: 0x0024, + 0x1f0: 0x0113, 0x1f1: 0x0112, 0x1f2: 0x0113, 0x1f3: 0x0112, 0x1f4: 0x0014, 0x1f5: 0x0004, + 0x1f6: 0x0113, 0x1f7: 0x0112, 0x1fa: 0x0015, 0x1fb: 0x4d52, + 0x1fc: 0x5052, 0x1fd: 0x5052, 0x1ff: 0x5353, + // Block 0x8, offset 0x200 + 0x204: 0x0004, 0x205: 0x0004, + 0x206: 0x2a13, 0x207: 0x0054, 0x208: 0x2513, 0x209: 0x2713, 0x20a: 0x2513, + 0x20c: 0x5653, 0x20e: 0x5953, 0x20f: 0x5c53, 0x210: 0x130a, 0x211: 0x2013, + 0x212: 0x2013, 0x213: 0x2013, 0x214: 0x2013, 0x215: 0x2013, 0x216: 0x2013, 0x217: 0x2013, + 0x218: 0x2013, 0x219: 0x2013, 0x21a: 0x2013, 0x21b: 0x2013, 0x21c: 0x2013, 0x21d: 0x2013, + 0x21e: 0x2013, 0x21f: 0x2013, 0x220: 0x5f53, 0x221: 0x5f53, 0x223: 0x5f53, + 0x224: 0x5f53, 0x225: 0x5f53, 0x226: 0x5f53, 0x227: 0x5f53, 0x228: 0x5f53, 0x229: 0x5f53, + 0x22a: 0x5f53, 0x22b: 0x5f53, 0x22c: 0x2a12, 0x22d: 0x2512, 0x22e: 0x2712, 0x22f: 0x2512, + 0x230: 0x144a, 0x231: 0x2012, 0x232: 0x2012, 0x233: 0x2012, 0x234: 0x2012, 0x235: 0x2012, + 0x236: 0x2012, 0x237: 0x2012, 0x238: 0x2012, 0x239: 0x2012, 0x23a: 0x2012, 0x23b: 0x2012, + 0x23c: 0x2012, 0x23d: 0x2012, 0x23e: 0x2012, 0x23f: 0x2012, + // Block 0x9, offset 0x240 + 0x240: 0x5f52, 0x241: 0x5f52, 0x242: 0x158a, 0x243: 0x5f52, 0x244: 0x5f52, 0x245: 0x5f52, + 0x246: 0x5f52, 0x247: 0x5f52, 0x248: 0x5f52, 0x249: 0x5f52, 0x24a: 0x5f52, 0x24b: 0x5f52, + 0x24c: 0x5652, 0x24d: 0x5952, 0x24e: 0x5c52, 0x24f: 0x1813, 0x250: 0x160a, 0x251: 0x168a, + 0x252: 0x0013, 0x253: 0x0013, 0x254: 0x0013, 0x255: 0x170a, 0x256: 0x178a, 0x257: 0x1812, + 0x258: 0x0113, 0x259: 0x0112, 0x25a: 0x0113, 0x25b: 0x0112, 0x25c: 0x0113, 0x25d: 0x0112, + 0x25e: 0x0113, 0x25f: 0x0112, 0x260: 0x0113, 0x261: 0x0112, 0x262: 0x0113, 0x263: 0x0112, + 0x264: 0x0113, 0x265: 0x0112, 0x266: 0x0113, 0x267: 0x0112, 0x268: 0x0113, 0x269: 0x0112, + 0x26a: 0x0113, 0x26b: 0x0112, 0x26c: 0x0113, 0x26d: 0x0112, 0x26e: 0x0113, 0x26f: 0x0112, + 0x270: 0x180a, 0x271: 0x188a, 0x272: 0x0b12, 0x273: 0x5352, 0x274: 0x6253, 0x275: 0x190a, + 0x277: 0x0f13, 0x278: 0x0f12, 0x279: 0x0b13, 0x27a: 0x0113, 0x27b: 0x0112, + 0x27c: 0x0012, 0x27d: 0x4d53, 0x27e: 0x5053, 0x27f: 0x5053, + // Block 0xa, offset 0x280 + 0x280: 0x0812, 0x281: 0x0812, 0x282: 0x0812, 0x283: 0x0812, 0x284: 0x0812, 0x285: 0x0812, + 0x288: 0x0813, 0x289: 0x0813, 0x28a: 0x0813, 0x28b: 0x0813, + 0x28c: 0x0813, 0x28d: 0x0813, 0x290: 0x239a, 0x291: 0x0812, + 0x292: 0x247a, 0x293: 0x0812, 0x294: 0x25ba, 0x295: 0x0812, 0x296: 0x26fa, 0x297: 0x0812, + 0x299: 0x0813, 0x29b: 0x0813, 0x29d: 0x0813, + 0x29f: 0x0813, 0x2a0: 0x0812, 0x2a1: 0x0812, 0x2a2: 0x0812, 0x2a3: 0x0812, + 0x2a4: 0x0812, 0x2a5: 0x0812, 0x2a6: 0x0812, 0x2a7: 0x0812, 0x2a8: 0x0813, 0x2a9: 0x0813, + 0x2aa: 0x0813, 0x2ab: 0x0813, 0x2ac: 0x0813, 0x2ad: 0x0813, 0x2ae: 0x0813, 0x2af: 0x0813, + 0x2b0: 0x8b52, 0x2b1: 0x8b52, 0x2b2: 0x8e52, 0x2b3: 0x8e52, 0x2b4: 0x9152, 0x2b5: 0x9152, + 0x2b6: 0x9452, 0x2b7: 0x9452, 0x2b8: 0x9752, 0x2b9: 0x9752, 0x2ba: 0x9a52, 0x2bb: 0x9a52, + 0x2bc: 0x4d52, 0x2bd: 0x4d52, + // Block 0xb, offset 0x2c0 + 0x2c0: 0x283a, 0x2c1: 0x292a, 0x2c2: 0x2a1a, 0x2c3: 0x2b0a, 0x2c4: 0x2bfa, 0x2c5: 0x2cea, + 0x2c6: 0x2dda, 0x2c7: 0x2eca, 0x2c8: 0x2fb9, 0x2c9: 0x30a9, 0x2ca: 0x3199, 0x2cb: 0x3289, + 0x2cc: 0x3379, 0x2cd: 0x3469, 0x2ce: 0x3559, 0x2cf: 0x3649, 0x2d0: 0x373a, 0x2d1: 0x382a, + 0x2d2: 0x391a, 0x2d3: 0x3a0a, 0x2d4: 0x3afa, 0x2d5: 0x3bea, 0x2d6: 0x3cda, 0x2d7: 0x3dca, + 0x2d8: 0x3eb9, 0x2d9: 0x3fa9, 0x2da: 0x4099, 0x2db: 0x4189, 0x2dc: 0x4279, 0x2dd: 0x4369, + 0x2de: 0x4459, 0x2df: 0x4549, 0x2e0: 0x463a, 0x2e1: 0x472a, 0x2e2: 0x481a, 0x2e3: 0x490a, + 0x2e4: 0x49fa, 0x2e5: 0x4aea, 0x2e6: 0x4bda, 0x2e7: 0x4cca, 0x2e8: 0x4db9, 0x2e9: 0x4ea9, + 0x2ea: 0x4f99, 0x2eb: 0x5089, 0x2ec: 0x5179, 0x2ed: 0x5269, 0x2ee: 0x5359, 0x2ef: 0x5449, + 0x2f0: 0x0812, 0x2f1: 0x0812, 0x2f2: 0x553a, 0x2f3: 0x564a, 0x2f4: 0x571a, + 0x2f6: 0x57fa, 0x2f7: 0x58da, 0x2f8: 0x0813, 0x2f9: 0x0813, 0x2fa: 0x8b53, 0x2fb: 0x8b53, + 0x2fc: 0x5a19, 0x2fd: 0x0004, 0x2fe: 0x5aea, 0x2ff: 0x0004, + // Block 0xc, offset 0x300 + 0x300: 0x0004, 0x301: 0x0004, 0x302: 0x5b6a, 0x303: 0x5c7a, 0x304: 0x5d4a, + 0x306: 0x5e2a, 0x307: 0x5f0a, 0x308: 0x8e53, 0x309: 0x8e53, 0x30a: 0x9153, 0x30b: 0x9153, + 0x30c: 0x6049, 0x30d: 0x0004, 0x30e: 0x0004, 0x30f: 0x0004, 0x310: 0x0812, 0x311: 0x0812, + 0x312: 0x611a, 0x313: 0x625a, 0x316: 0x639a, 0x317: 0x647a, + 0x318: 0x0813, 0x319: 0x0813, 0x31a: 0x9453, 0x31b: 0x9453, 0x31d: 0x0004, + 0x31e: 0x0004, 0x31f: 0x0004, 0x320: 0x0812, 0x321: 0x0812, 0x322: 0x65ba, 0x323: 0x66fa, + 0x324: 0x683a, 0x325: 0x0912, 0x326: 0x691a, 0x327: 0x69fa, 0x328: 0x0813, 0x329: 0x0813, + 0x32a: 0x9a53, 0x32b: 0x9a53, 0x32c: 0x0913, 0x32d: 0x0004, 0x32e: 0x0004, 0x32f: 0x0004, + 0x332: 0x6b3a, 0x333: 0x6c4a, 0x334: 0x6d1a, + 0x336: 0x6dfa, 0x337: 0x6eda, 0x338: 0x9753, 0x339: 0x9753, 0x33a: 0x4d53, 0x33b: 0x4d53, + 0x33c: 0x7019, 0x33d: 0x0004, 0x33e: 0x0004, + // Block 0xd, offset 0x340 + 0x342: 0x0013, + 0x347: 0x0013, 0x34a: 0x0012, 0x34b: 0x0013, + 0x34c: 0x0013, 0x34d: 0x0013, 0x34e: 0x0012, 0x34f: 0x0012, 0x350: 0x0013, 0x351: 0x0013, + 0x352: 0x0013, 0x353: 0x0012, 0x355: 0x0013, + 0x359: 0x0013, 0x35a: 0x0013, 0x35b: 0x0013, 0x35c: 0x0013, 0x35d: 0x0013, + 0x364: 0x0013, 0x366: 0x70eb, 0x368: 0x0013, + 0x36a: 0x714b, 0x36b: 0x718b, 0x36c: 0x0013, 0x36d: 0x0013, 0x36f: 0x0012, + 0x370: 0x0013, 0x371: 0x0013, 0x372: 0x9d53, 0x373: 0x0013, 0x374: 0x0012, 0x375: 0x0010, + 0x376: 0x0010, 0x377: 0x0010, 0x378: 0x0010, 0x379: 0x0012, + 0x37c: 0x0012, 0x37d: 0x0012, 0x37e: 0x0013, 0x37f: 0x0013, + // Block 0xe, offset 0x380 + 0x380: 0x1a13, 0x381: 0x1a13, 0x382: 0x1e13, 0x383: 0x1e13, 0x384: 0x1a13, 0x385: 0x1a13, + 0x386: 0x2613, 0x387: 0x2613, 0x388: 0x2a13, 0x389: 0x2a13, 0x38a: 0x2e13, 0x38b: 0x2e13, + 0x38c: 0x2a13, 0x38d: 0x2a13, 0x38e: 0x2613, 0x38f: 0x2613, 0x390: 0xa052, 0x391: 0xa052, + 0x392: 0xa352, 0x393: 0xa352, 0x394: 0xa652, 0x395: 0xa652, 0x396: 0xa352, 0x397: 0xa352, + 0x398: 0xa052, 0x399: 0xa052, 0x39a: 0x1a12, 0x39b: 0x1a12, 0x39c: 0x1e12, 0x39d: 0x1e12, + 0x39e: 0x1a12, 0x39f: 0x1a12, 0x3a0: 0x2612, 0x3a1: 0x2612, 0x3a2: 0x2a12, 0x3a3: 0x2a12, + 0x3a4: 0x2e12, 0x3a5: 0x2e12, 0x3a6: 0x2a12, 0x3a7: 0x2a12, 0x3a8: 0x2612, 0x3a9: 0x2612, + // Block 0xf, offset 0x3c0 + 0x3c0: 0x6552, 0x3c1: 0x6552, 0x3c2: 0x6552, 0x3c3: 0x6552, 0x3c4: 0x6552, 0x3c5: 0x6552, + 0x3c6: 0x6552, 0x3c7: 0x6552, 0x3c8: 0x6552, 0x3c9: 0x6552, 0x3ca: 0x6552, 0x3cb: 0x6552, + 0x3cc: 0x6552, 0x3cd: 0x6552, 0x3ce: 0x6552, 0x3cf: 0x6552, 0x3d0: 0xa952, 0x3d1: 0xa952, + 0x3d2: 0xa952, 0x3d3: 0xa952, 0x3d4: 0xa952, 0x3d5: 0xa952, 0x3d6: 0xa952, 0x3d7: 0xa952, + 0x3d8: 0xa952, 0x3d9: 0xa952, 0x3da: 0xa952, 0x3db: 0xa952, 0x3dc: 0xa952, 0x3dd: 0xa952, + 0x3de: 0xa952, 0x3e0: 0x0113, 0x3e1: 0x0112, 0x3e2: 0x71eb, 0x3e3: 0x8853, + 0x3e4: 0x724b, 0x3e5: 0x72aa, 0x3e6: 0x730a, 0x3e7: 0x0f13, 0x3e8: 0x0f12, 0x3e9: 0x0313, + 0x3ea: 0x0312, 0x3eb: 0x0713, 0x3ec: 0x0712, 0x3ed: 0x736b, 0x3ee: 0x73cb, 0x3ef: 0x742b, + 0x3f0: 0x748b, 0x3f1: 0x0012, 0x3f2: 0x0113, 0x3f3: 0x0112, 0x3f4: 0x0012, 0x3f5: 0x0313, + 0x3f6: 0x0312, 0x3f7: 0x0012, 0x3f8: 0x0012, 0x3f9: 0x0012, 0x3fa: 0x0012, 0x3fb: 0x0012, + 0x3fc: 0x0015, 0x3fd: 0x0015, 0x3fe: 0x74eb, 0x3ff: 0x754b, + // Block 0x10, offset 0x400 + 0x400: 0x0113, 0x401: 0x0112, 0x402: 0x0113, 0x403: 0x0112, 0x404: 0x0113, 0x405: 0x0112, + 0x406: 0x0113, 0x407: 0x0112, 0x408: 0x0014, 0x409: 0x0014, 0x40a: 0x0014, 0x40b: 0x0713, + 0x40c: 0x0712, 0x40d: 0x75ab, 0x40e: 0x0012, 0x40f: 0x0010, 0x410: 0x0113, 0x411: 0x0112, + 0x412: 0x0113, 0x413: 0x0112, 0x414: 0x0012, 0x415: 0x0012, 0x416: 0x0113, 0x417: 0x0112, + 0x418: 0x0113, 0x419: 0x0112, 0x41a: 0x0113, 0x41b: 0x0112, 0x41c: 0x0113, 0x41d: 0x0112, + 0x41e: 0x0113, 0x41f: 0x0112, 0x420: 0x0113, 0x421: 0x0112, 0x422: 0x0113, 0x423: 0x0112, + 0x424: 0x0113, 0x425: 0x0112, 0x426: 0x0113, 0x427: 0x0112, 0x428: 0x0113, 0x429: 0x0112, + 0x42a: 0x760b, 0x42b: 0x766b, 0x42c: 0x76cb, 0x42d: 0x772b, 0x42e: 0x778b, + 0x430: 0x77eb, 0x431: 0x784b, 0x432: 0x78ab, 0x433: 0xac53, 0x434: 0x0113, 0x435: 0x0112, + 0x436: 0x0113, 0x437: 0x0112, + // Block 0x11, offset 0x440 + 0x440: 0x790a, 0x441: 0x798a, 0x442: 0x7a0a, 0x443: 0x7a8a, 0x444: 0x7b3a, 0x445: 0x7bea, + 0x446: 0x7c6a, + 0x453: 0x7cea, 0x454: 0x7dca, 0x455: 0x7eaa, 0x456: 0x7f8a, 0x457: 0x806a, + 0x45d: 0x0010, + 0x45e: 0x0034, 0x45f: 0x0010, 0x460: 0x0010, 0x461: 0x0010, 0x462: 0x0010, 0x463: 0x0010, + 0x464: 0x0010, 0x465: 0x0010, 0x466: 0x0010, 0x467: 0x0010, 0x468: 0x0010, + 0x46a: 0x0010, 0x46b: 0x0010, 0x46c: 0x0010, 0x46d: 0x0010, 0x46e: 0x0010, 0x46f: 0x0010, + 0x470: 0x0010, 0x471: 0x0010, 0x472: 0x0010, 0x473: 0x0010, 0x474: 0x0010, 0x475: 0x0010, + 0x476: 0x0010, 0x478: 0x0010, 0x479: 0x0010, 0x47a: 0x0010, 0x47b: 0x0010, + 0x47c: 0x0010, 0x47e: 0x0010, + // Block 0x12, offset 0x480 + 0x480: 0x2213, 0x481: 0x2213, 0x482: 0x2613, 0x483: 0x2613, 0x484: 0x2213, 0x485: 0x2213, + 0x486: 0x2e13, 0x487: 0x2e13, 0x488: 0x2213, 0x489: 0x2213, 0x48a: 0x2613, 0x48b: 0x2613, + 0x48c: 0x2213, 0x48d: 0x2213, 0x48e: 0x3e13, 0x48f: 0x3e13, 0x490: 0x2213, 0x491: 0x2213, + 0x492: 0x2613, 0x493: 0x2613, 0x494: 0x2213, 0x495: 0x2213, 0x496: 0x2e13, 0x497: 0x2e13, + 0x498: 0x2213, 0x499: 0x2213, 0x49a: 0x2613, 0x49b: 0x2613, 0x49c: 0x2213, 0x49d: 0x2213, + 0x49e: 0xb553, 0x49f: 0xb553, 0x4a0: 0xb853, 0x4a1: 0xb853, 0x4a2: 0x2212, 0x4a3: 0x2212, + 0x4a4: 0x2612, 0x4a5: 0x2612, 0x4a6: 0x2212, 0x4a7: 0x2212, 0x4a8: 0x2e12, 0x4a9: 0x2e12, + 0x4aa: 0x2212, 0x4ab: 0x2212, 0x4ac: 0x2612, 0x4ad: 0x2612, 0x4ae: 0x2212, 0x4af: 0x2212, + 0x4b0: 0x3e12, 0x4b1: 0x3e12, 0x4b2: 0x2212, 0x4b3: 0x2212, 0x4b4: 0x2612, 0x4b5: 0x2612, + 0x4b6: 0x2212, 0x4b7: 0x2212, 0x4b8: 0x2e12, 0x4b9: 0x2e12, 0x4ba: 0x2212, 0x4bb: 0x2212, + 0x4bc: 0x2612, 0x4bd: 0x2612, 0x4be: 0x2212, 0x4bf: 0x2212, + // Block 0x13, offset 0x4c0 + 0x4c2: 0x0010, + 0x4c7: 0x0010, 0x4c9: 0x0010, 0x4cb: 0x0010, + 0x4cd: 0x0010, 0x4ce: 0x0010, 0x4cf: 0x0010, 0x4d1: 0x0010, + 0x4d2: 0x0010, 0x4d4: 0x0010, 0x4d7: 0x0010, + 0x4d9: 0x0010, 0x4db: 0x0010, 0x4dd: 0x0010, + 0x4df: 0x0010, 0x4e1: 0x0010, 0x4e2: 0x0010, + 0x4e4: 0x0010, 0x4e7: 0x0010, 0x4e8: 0x0010, 0x4e9: 0x0010, + 0x4ea: 0x0010, 0x4ec: 0x0010, 0x4ed: 0x0010, 0x4ee: 0x0010, 0x4ef: 0x0010, + 0x4f0: 0x0010, 0x4f1: 0x0010, 0x4f2: 0x0010, 0x4f4: 0x0010, 0x4f5: 0x0010, + 0x4f6: 0x0010, 0x4f7: 0x0010, 0x4f9: 0x0010, 0x4fa: 0x0010, 0x4fb: 0x0010, + 0x4fc: 0x0010, 0x4fe: 0x0010, +} + +// caseIndex: 25 blocks, 1600 entries, 3200 bytes +// Block 0 is the zero block. +var caseIndex = [1600]uint16{ + // Block 0x0, offset 0x0 + // Block 0x1, offset 0x40 + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc2: 0x12, 0xc3: 0x13, 0xc4: 0x14, 0xc5: 0x15, 0xc6: 0x01, 0xc7: 0x02, + 0xc8: 0x16, 0xc9: 0x03, 0xca: 0x04, 0xcb: 0x17, 0xcc: 0x18, 0xcd: 0x05, 0xce: 0x06, 0xcf: 0x07, + 0xd0: 0x19, 0xd1: 0x1a, 0xd2: 0x1b, 0xd3: 0x1c, 0xd4: 0x1d, 0xd5: 0x1e, 0xd6: 0x1f, 0xd7: 0x20, + 0xd8: 0x21, 0xd9: 0x22, 0xda: 0x23, 0xdb: 0x24, 0xdc: 0x25, 0xdd: 0x26, 0xde: 0x27, 0xdf: 0x28, + 0xe0: 0x02, 0xe1: 0x03, 0xe2: 0x04, 0xe3: 0x05, + 0xea: 0x06, 0xeb: 0x07, 0xec: 0x07, 0xed: 0x08, 0xef: 0x09, + 0xf0: 0x14, 0xf3: 0x16, + // Block 0x4, offset 0x100 + 0x120: 0x29, 0x121: 0x2a, 0x122: 0x2b, 0x123: 0x2c, 0x124: 0x2d, 0x125: 0x2e, 0x126: 0x2f, 0x127: 0x30, + 0x128: 0x31, 0x129: 0x32, 0x12a: 0x33, 0x12b: 0x34, 0x12c: 0x35, 0x12d: 0x36, 0x12e: 0x37, 0x12f: 0x38, + 0x130: 0x39, 0x131: 0x3a, 0x132: 0x3b, 0x133: 0x3c, 0x134: 0x3d, 0x135: 0x3e, 0x136: 0x3f, 0x137: 0x40, + 0x138: 0x41, 0x139: 0x42, 0x13a: 0x43, 0x13b: 0x44, 0x13c: 0x45, 0x13d: 0x46, 0x13e: 0x47, 0x13f: 0x48, + // Block 0x5, offset 0x140 + 0x140: 0x49, 0x141: 0x4a, 0x142: 0x4b, 0x143: 0x4c, 0x144: 0x23, 0x145: 0x23, 0x146: 0x23, 0x147: 0x23, + 0x148: 0x23, 0x149: 0x4d, 0x14a: 0x4e, 0x14b: 0x4f, 0x14c: 0x50, 0x14d: 0x51, 0x14e: 0x52, 0x14f: 0x53, + 0x150: 0x54, 0x151: 0x23, 0x152: 0x23, 0x153: 0x23, 0x154: 0x23, 0x155: 0x23, 0x156: 0x23, 0x157: 0x23, + 0x158: 0x23, 0x159: 0x55, 0x15a: 0x56, 0x15b: 0x57, 0x15c: 0x58, 0x15d: 0x59, 0x15e: 0x5a, 0x15f: 0x5b, + 0x160: 0x5c, 0x161: 0x5d, 0x162: 0x5e, 0x163: 0x5f, 0x164: 0x60, 0x165: 0x61, 0x167: 0x62, + 0x168: 0x63, 0x169: 0x64, 0x16a: 0x65, 0x16c: 0x66, 0x16d: 0x67, 0x16e: 0x68, 0x16f: 0x69, + 0x170: 0x6a, 0x171: 0x6b, 0x172: 0x6c, 0x173: 0x6d, 0x174: 0x6e, 0x175: 0x6f, 0x176: 0x70, 0x177: 0x71, + 0x178: 0x72, 0x179: 0x72, 0x17a: 0x73, 0x17b: 0x72, 0x17c: 0x74, 0x17d: 0x08, 0x17e: 0x09, 0x17f: 0x0a, + // Block 0x6, offset 0x180 + 0x180: 0x75, 0x181: 0x76, 0x182: 0x77, 0x183: 0x78, 0x184: 0x0b, 0x185: 0x79, 0x186: 0x7a, + 0x192: 0x7b, 0x193: 0x0c, + 0x1b0: 0x7c, 0x1b1: 0x0d, 0x1b2: 0x72, 0x1b3: 0x7d, 0x1b4: 0x7e, 0x1b5: 0x7f, 0x1b6: 0x80, 0x1b7: 0x81, + 0x1b8: 0x82, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x83, 0x1c2: 0x84, 0x1c3: 0x85, 0x1c4: 0x86, 0x1c5: 0x23, 0x1c6: 0x87, + // Block 0x8, offset 0x200 + 0x200: 0x88, 0x201: 0x23, 0x202: 0x23, 0x203: 0x23, 0x204: 0x23, 0x205: 0x23, 0x206: 0x23, 0x207: 0x23, + 0x208: 0x23, 0x209: 0x23, 0x20a: 0x23, 0x20b: 0x23, 0x20c: 0x23, 0x20d: 0x23, 0x20e: 0x23, 0x20f: 0x23, + 0x210: 0x23, 0x211: 0x23, 0x212: 0x89, 0x213: 0x8a, 0x214: 0x23, 0x215: 0x23, 0x216: 0x23, 0x217: 0x23, + 0x218: 0x8b, 0x219: 0x8c, 0x21a: 0x8d, 0x21b: 0x8e, 0x21c: 0x8f, 0x21d: 0x90, 0x21e: 0x0e, 0x21f: 0x91, + 0x220: 0x92, 0x221: 0x93, 0x222: 0x23, 0x223: 0x94, 0x224: 0x95, 0x225: 0x96, 0x226: 0x97, 0x227: 0x98, + 0x228: 0x99, 0x229: 0x9a, 0x22a: 0x9b, 0x22b: 0x9c, 0x22c: 0x9d, 0x22d: 0x9e, 0x22e: 0x9f, 0x22f: 0xa0, + 0x230: 0x23, 0x231: 0x23, 0x232: 0x23, 0x233: 0x23, 0x234: 0x23, 0x235: 0x23, 0x236: 0x23, 0x237: 0x23, + 0x238: 0x23, 0x239: 0x23, 0x23a: 0x23, 0x23b: 0x23, 0x23c: 0x23, 0x23d: 0x23, 0x23e: 0x23, 0x23f: 0x23, + // Block 0x9, offset 0x240 + 0x240: 0x23, 0x241: 0x23, 0x242: 0x23, 0x243: 0x23, 0x244: 0x23, 0x245: 0x23, 0x246: 0x23, 0x247: 0x23, + 0x248: 0x23, 0x249: 0x23, 0x24a: 0x23, 0x24b: 0x23, 0x24c: 0x23, 0x24d: 0x23, 0x24e: 0x23, 0x24f: 0x23, + 0x250: 0x23, 0x251: 0x23, 0x252: 0x23, 0x253: 0x23, 0x254: 0x23, 0x255: 0x23, 0x256: 0x23, 0x257: 0x23, + 0x258: 0x23, 0x259: 0x23, 0x25a: 0x23, 0x25b: 0x23, 0x25c: 0x23, 0x25d: 0x23, 0x25e: 0x23, 0x25f: 0x23, + 0x260: 0x23, 0x261: 0x23, 0x262: 0x23, 0x263: 0x23, 0x264: 0x23, 0x265: 0x23, 0x266: 0x23, 0x267: 0x23, + 0x268: 0x23, 0x269: 0x23, 0x26a: 0x23, 0x26b: 0x23, 0x26c: 0x23, 0x26d: 0x23, 0x26e: 0x23, 0x26f: 0x23, + 0x270: 0x23, 0x271: 0x23, 0x272: 0x23, 0x273: 0x23, 0x274: 0x23, 0x275: 0x23, 0x276: 0x23, 0x277: 0x23, + 0x278: 0x23, 0x279: 0x23, 0x27a: 0x23, 0x27b: 0x23, 0x27c: 0x23, 0x27d: 0x23, 0x27e: 0x23, 0x27f: 0x23, + // Block 0xa, offset 0x280 + 0x280: 0x23, 0x281: 0x23, 0x282: 0x23, 0x283: 0x23, 0x284: 0x23, 0x285: 0x23, 0x286: 0x23, 0x287: 0x23, + 0x288: 0x23, 0x289: 0x23, 0x28a: 0x23, 0x28b: 0x23, 0x28c: 0x23, 0x28d: 0x23, 0x28e: 0x23, 0x28f: 0x23, + 0x290: 0x23, 0x291: 0x23, 0x292: 0x23, 0x293: 0x23, 0x294: 0x23, 0x295: 0x23, 0x296: 0x23, 0x297: 0x23, + 0x298: 0x23, 0x299: 0x23, 0x29a: 0x23, 0x29b: 0x23, 0x29c: 0x23, 0x29d: 0x23, 0x29e: 0xa1, 0x29f: 0xa2, + // Block 0xb, offset 0x2c0 + 0x2ec: 0x0f, 0x2ed: 0xa3, 0x2ee: 0xa4, 0x2ef: 0xa5, + 0x2f0: 0x23, 0x2f1: 0x23, 0x2f2: 0x23, 0x2f3: 0x23, 0x2f4: 0xa6, 0x2f5: 0xa7, 0x2f6: 0xa8, 0x2f7: 0xa9, + 0x2f8: 0xaa, 0x2f9: 0xab, 0x2fa: 0x23, 0x2fb: 0xac, 0x2fc: 0xad, 0x2fd: 0xae, 0x2fe: 0xaf, 0x2ff: 0xb0, + // Block 0xc, offset 0x300 + 0x300: 0xb1, 0x301: 0xb2, 0x302: 0x23, 0x303: 0xb3, 0x305: 0xb4, 0x307: 0xb5, + 0x30a: 0xb6, 0x30b: 0xb7, 0x30c: 0xb8, 0x30d: 0xb9, 0x30e: 0xba, 0x30f: 0xbb, + 0x310: 0xbc, 0x311: 0xbd, 0x312: 0xbe, 0x313: 0xbf, 0x314: 0xc0, 0x315: 0xc1, + 0x318: 0x23, 0x319: 0x23, 0x31a: 0x23, 0x31b: 0x23, 0x31c: 0xc2, 0x31d: 0xc3, + 0x320: 0xc4, 0x321: 0xc5, 0x322: 0xc6, 0x323: 0xc7, 0x324: 0xc8, 0x326: 0xc9, + 0x328: 0xca, 0x329: 0xcb, 0x32a: 0xcc, 0x32b: 0xcd, 0x32c: 0x5f, 0x32d: 0xce, 0x32e: 0xcf, + 0x330: 0x23, 0x331: 0xd0, 0x332: 0xd1, 0x333: 0xd2, + // Block 0xd, offset 0x340 + 0x340: 0xd3, 0x341: 0xd4, 0x342: 0xd5, 0x343: 0xd6, 0x344: 0xd7, 0x345: 0xd8, 0x346: 0xd9, 0x347: 0xda, + 0x348: 0xdb, 0x34a: 0xdc, 0x34b: 0xdd, 0x34c: 0xde, 0x34d: 0xdf, + 0x350: 0xe0, 0x351: 0xe1, 0x352: 0xe2, 0x353: 0xe3, 0x356: 0xe4, 0x357: 0xe5, + 0x358: 0xe6, 0x359: 0xe7, 0x35a: 0xe8, 0x35b: 0xe9, 0x35c: 0xea, + 0x362: 0xeb, 0x363: 0xec, + 0x368: 0xed, 0x369: 0xee, 0x36a: 0xef, 0x36b: 0xf0, + 0x370: 0xf1, 0x371: 0xf2, 0x372: 0xf3, 0x374: 0xf4, 0x375: 0xf5, + // Block 0xe, offset 0x380 + 0x380: 0x23, 0x381: 0x23, 0x382: 0x23, 0x383: 0x23, 0x384: 0x23, 0x385: 0x23, 0x386: 0x23, 0x387: 0x23, + 0x388: 0x23, 0x389: 0x23, 0x38a: 0x23, 0x38b: 0x23, 0x38c: 0x23, 0x38d: 0x23, 0x38e: 0xf6, + 0x390: 0x23, 0x391: 0xf7, 0x392: 0x23, 0x393: 0x23, 0x394: 0x23, 0x395: 0xf8, + // Block 0xf, offset 0x3c0 + 0x3c0: 0x23, 0x3c1: 0x23, 0x3c2: 0x23, 0x3c3: 0x23, 0x3c4: 0x23, 0x3c5: 0x23, 0x3c6: 0x23, 0x3c7: 0x23, + 0x3c8: 0x23, 0x3c9: 0x23, 0x3ca: 0x23, 0x3cb: 0x23, 0x3cc: 0x23, 0x3cd: 0x23, 0x3ce: 0x23, 0x3cf: 0x23, + 0x3d0: 0xf7, + // Block 0x10, offset 0x400 + 0x410: 0x23, 0x411: 0x23, 0x412: 0x23, 0x413: 0x23, 0x414: 0x23, 0x415: 0x23, 0x416: 0x23, 0x417: 0x23, + 0x418: 0x23, 0x419: 0xf9, + // Block 0x11, offset 0x440 + 0x460: 0x23, 0x461: 0x23, 0x462: 0x23, 0x463: 0x23, 0x464: 0x23, 0x465: 0x23, 0x466: 0x23, 0x467: 0x23, + 0x468: 0xf0, 0x469: 0xfa, 0x46b: 0xfb, 0x46c: 0xfc, 0x46d: 0xfd, 0x46e: 0xfe, + 0x47c: 0x23, 0x47d: 0xff, 0x47e: 0x100, 0x47f: 0x101, + // Block 0x12, offset 0x480 + 0x4b0: 0x23, 0x4b1: 0x102, 0x4b2: 0x103, + // Block 0x13, offset 0x4c0 + 0x4c5: 0x104, 0x4c6: 0x105, + 0x4c9: 0x106, + 0x4d0: 0x107, 0x4d1: 0x108, 0x4d2: 0x109, 0x4d3: 0x10a, 0x4d4: 0x10b, 0x4d5: 0x10c, 0x4d6: 0x10d, 0x4d7: 0x10e, + 0x4d8: 0x10f, 0x4d9: 0x110, 0x4da: 0x111, 0x4db: 0x112, 0x4dc: 0x113, 0x4dd: 0x114, 0x4de: 0x115, 0x4df: 0x116, + 0x4e8: 0x117, 0x4e9: 0x118, 0x4ea: 0x119, + // Block 0x14, offset 0x500 + 0x500: 0x11a, + 0x520: 0x23, 0x521: 0x23, 0x522: 0x23, 0x523: 0x11b, 0x524: 0x10, 0x525: 0x11c, + 0x538: 0x11d, 0x539: 0x11, 0x53a: 0x11e, + // Block 0x15, offset 0x540 + 0x544: 0x11f, 0x545: 0x120, 0x546: 0x121, + 0x54f: 0x122, + // Block 0x16, offset 0x580 + 0x590: 0x0a, 0x591: 0x0b, 0x592: 0x0c, 0x593: 0x0d, 0x594: 0x0e, 0x596: 0x0f, + 0x59b: 0x10, 0x59d: 0x11, 0x59e: 0x12, 0x59f: 0x13, + // Block 0x17, offset 0x5c0 + 0x5c0: 0x123, 0x5c1: 0x124, 0x5c4: 0x124, 0x5c5: 0x124, 0x5c6: 0x124, 0x5c7: 0x125, + // Block 0x18, offset 0x600 + 0x620: 0x15, +} + +// sparseOffsets: 277 entries, 554 bytes +var sparseOffsets = []uint16{0x0, 0x9, 0xf, 0x18, 0x24, 0x2e, 0x35, 0x38, 0x3c, 0x3f, 0x43, 0x4d, 0x4f, 0x54, 0x64, 0x6b, 0x70, 0x7e, 0x7f, 0x8d, 0x9c, 0xa6, 0xa9, 0xaf, 0xb7, 0xba, 0xbc, 0xca, 0xd0, 0xde, 0xe9, 0xf5, 0x100, 0x10c, 0x116, 0x122, 0x12d, 0x139, 0x145, 0x14d, 0x155, 0x15f, 0x16a, 0x176, 0x17d, 0x188, 0x18d, 0x195, 0x198, 0x19d, 0x1a1, 0x1a5, 0x1ac, 0x1b5, 0x1bd, 0x1be, 0x1c7, 0x1ce, 0x1d6, 0x1dc, 0x1e2, 0x1e7, 0x1eb, 0x1ee, 0x1f0, 0x1f3, 0x1f8, 0x1f9, 0x1fb, 0x1fd, 0x1ff, 0x206, 0x20b, 0x20f, 0x218, 0x21b, 0x21e, 0x224, 0x225, 0x230, 0x231, 0x232, 0x237, 0x244, 0x24c, 0x254, 0x25d, 0x266, 0x26f, 0x274, 0x277, 0x280, 0x28d, 0x28f, 0x296, 0x298, 0x2a4, 0x2a5, 0x2b0, 0x2b8, 0x2c0, 0x2c6, 0x2c7, 0x2d5, 0x2da, 0x2dd, 0x2e2, 0x2e6, 0x2ec, 0x2f1, 0x2f4, 0x2f9, 0x2fe, 0x2ff, 0x305, 0x307, 0x308, 0x30a, 0x30c, 0x30f, 0x310, 0x312, 0x315, 0x31b, 0x31f, 0x321, 0x326, 0x32d, 0x331, 0x33a, 0x33b, 0x343, 0x347, 0x34c, 0x354, 0x35a, 0x360, 0x36a, 0x36f, 0x378, 0x37e, 0x385, 0x389, 0x391, 0x393, 0x395, 0x398, 0x39a, 0x39c, 0x39d, 0x39e, 0x3a0, 0x3a2, 0x3a8, 0x3ad, 0x3af, 0x3b5, 0x3b8, 0x3ba, 0x3c0, 0x3c5, 0x3c7, 0x3c8, 0x3c9, 0x3ca, 0x3cc, 0x3ce, 0x3d0, 0x3d3, 0x3d5, 0x3d8, 0x3e0, 0x3e3, 0x3e7, 0x3ef, 0x3f1, 0x3f2, 0x3f3, 0x3f5, 0x3fb, 0x3fd, 0x3fe, 0x400, 0x402, 0x404, 0x411, 0x412, 0x413, 0x417, 0x419, 0x41a, 0x41b, 0x41c, 0x41d, 0x421, 0x425, 0x42b, 0x42d, 0x434, 0x437, 0x43b, 0x441, 0x44a, 0x450, 0x456, 0x460, 0x46a, 0x46c, 0x473, 0x479, 0x47f, 0x485, 0x488, 0x48e, 0x491, 0x499, 0x49a, 0x4a1, 0x4a2, 0x4a5, 0x4af, 0x4b5, 0x4bb, 0x4bc, 0x4c2, 0x4c5, 0x4cd, 0x4d4, 0x4db, 0x4dc, 0x4dd, 0x4de, 0x4df, 0x4e1, 0x4e3, 0x4e5, 0x4e9, 0x4ea, 0x4ec, 0x4ed, 0x4ee, 0x4f0, 0x4f5, 0x4fa, 0x4fe, 0x4ff, 0x502, 0x506, 0x511, 0x515, 0x51d, 0x522, 0x526, 0x529, 0x52d, 0x530, 0x533, 0x538, 0x53c, 0x540, 0x544, 0x548, 0x54a, 0x54c, 0x54f, 0x554, 0x556, 0x55b, 0x564, 0x569, 0x56a, 0x56d, 0x56e, 0x56f, 0x571, 0x572, 0x573} + +// sparseValues: 1395 entries, 5580 bytes +var sparseValues = [1395]valueRange{ + // Block 0x0, offset 0x0 + {value: 0x0004, lo: 0xa8, hi: 0xa8}, + {value: 0x0012, lo: 0xaa, hi: 0xaa}, + {value: 0x0014, lo: 0xad, hi: 0xad}, + {value: 0x0004, lo: 0xaf, hi: 0xaf}, + {value: 0x0004, lo: 0xb4, hi: 0xb4}, + {value: 0x001a, lo: 0xb5, hi: 0xb5}, + {value: 0x0054, lo: 0xb7, hi: 0xb7}, + {value: 0x0004, lo: 0xb8, hi: 0xb8}, + {value: 0x0012, lo: 0xba, hi: 0xba}, + // Block 0x1, offset 0x9 + {value: 0x2013, lo: 0x80, hi: 0x96}, + {value: 0x2013, lo: 0x98, hi: 0x9e}, + {value: 0x009a, lo: 0x9f, hi: 0x9f}, + {value: 0x2012, lo: 0xa0, hi: 0xb6}, + {value: 0x2012, lo: 0xb8, hi: 0xbe}, + {value: 0x0252, lo: 0xbf, hi: 0xbf}, + // Block 0x2, offset 0xf + {value: 0x0117, lo: 0x80, hi: 0xaf}, + {value: 0x011b, lo: 0xb0, hi: 0xb0}, + {value: 0x019a, lo: 0xb1, hi: 0xb1}, + {value: 0x0117, lo: 0xb2, hi: 0xb7}, + {value: 0x0012, lo: 0xb8, hi: 0xb8}, + {value: 0x0316, lo: 0xb9, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x0316, lo: 0xbd, hi: 0xbe}, + {value: 0x0553, lo: 0xbf, hi: 0xbf}, + // Block 0x3, offset 0x18 + {value: 0x0552, lo: 0x80, hi: 0x80}, + {value: 0x0316, lo: 0x81, hi: 0x82}, + {value: 0x0716, lo: 0x83, hi: 0x84}, + {value: 0x0316, lo: 0x85, hi: 0x86}, + {value: 0x0f16, lo: 0x87, hi: 0x88}, + {value: 0x01da, lo: 0x89, hi: 0x89}, + {value: 0x0117, lo: 0x8a, hi: 0xb7}, + {value: 0x0253, lo: 0xb8, hi: 0xb8}, + {value: 0x0316, lo: 0xb9, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x0316, lo: 0xbd, hi: 0xbe}, + {value: 0x028a, lo: 0xbf, hi: 0xbf}, + // Block 0x4, offset 0x24 + {value: 0x0117, lo: 0x80, hi: 0x9f}, + {value: 0x2f53, lo: 0xa0, hi: 0xa0}, + {value: 0x0012, lo: 0xa1, hi: 0xa1}, + {value: 0x0117, lo: 0xa2, hi: 0xb3}, + {value: 0x0012, lo: 0xb4, hi: 0xb9}, + {value: 0x090b, lo: 0xba, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x2953, lo: 0xbd, hi: 0xbd}, + {value: 0x098b, lo: 0xbe, hi: 0xbe}, + {value: 0x0a0a, lo: 0xbf, hi: 0xbf}, + // Block 0x5, offset 0x2e + {value: 0x0015, lo: 0x80, hi: 0x81}, + {value: 0x0014, lo: 0x82, hi: 0x97}, + {value: 0x0004, lo: 0x98, hi: 0x9d}, + {value: 0x0014, lo: 0x9e, hi: 0x9f}, + {value: 0x0015, lo: 0xa0, hi: 0xa4}, + {value: 0x0004, lo: 0xa5, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xbf}, + // Block 0x6, offset 0x35 + {value: 0x0024, lo: 0x80, hi: 0x94}, + {value: 0x0034, lo: 0x95, hi: 0xbc}, + {value: 0x0024, lo: 0xbd, hi: 0xbf}, + // Block 0x7, offset 0x38 + {value: 0x6553, lo: 0x80, hi: 0x8f}, + {value: 0x2013, lo: 0x90, hi: 0x9f}, + {value: 0x5f53, lo: 0xa0, hi: 0xaf}, + {value: 0x2012, lo: 0xb0, hi: 0xbf}, + // Block 0x8, offset 0x3c + {value: 0x5f52, lo: 0x80, hi: 0x8f}, + {value: 0x6552, lo: 0x90, hi: 0x9f}, + {value: 0x0117, lo: 0xa0, hi: 0xbf}, + // Block 0x9, offset 0x3f + {value: 0x0117, lo: 0x80, hi: 0x81}, + {value: 0x0024, lo: 0x83, hi: 0x87}, + {value: 0x0014, lo: 0x88, hi: 0x89}, + {value: 0x0117, lo: 0x8a, hi: 0xbf}, + // Block 0xa, offset 0x43 + {value: 0x0f13, lo: 0x80, hi: 0x80}, + {value: 0x0316, lo: 0x81, hi: 0x82}, + {value: 0x0716, lo: 0x83, hi: 0x84}, + {value: 0x0316, lo: 0x85, hi: 0x86}, + {value: 0x0f16, lo: 0x87, hi: 0x88}, + {value: 0x0316, lo: 0x89, hi: 0x8a}, + {value: 0x0716, lo: 0x8b, hi: 0x8c}, + {value: 0x0316, lo: 0x8d, hi: 0x8e}, + {value: 0x0f12, lo: 0x8f, hi: 0x8f}, + {value: 0x0117, lo: 0x90, hi: 0xbf}, + // Block 0xb, offset 0x4d + {value: 0x0117, lo: 0x80, hi: 0xaf}, + {value: 0x6553, lo: 0xb1, hi: 0xbf}, + // Block 0xc, offset 0x4f + {value: 0x3013, lo: 0x80, hi: 0x8f}, + {value: 0x6853, lo: 0x90, hi: 0x96}, + {value: 0x0014, lo: 0x99, hi: 0x99}, + {value: 0x6552, lo: 0xa1, hi: 0xaf}, + {value: 0x3012, lo: 0xb0, hi: 0xbf}, + // Block 0xd, offset 0x54 + {value: 0x6852, lo: 0x80, hi: 0x86}, + {value: 0x198a, lo: 0x87, hi: 0x87}, + {value: 0x0034, lo: 0x91, hi: 0x91}, + {value: 0x0024, lo: 0x92, hi: 0x95}, + {value: 0x0034, lo: 0x96, hi: 0x96}, + {value: 0x0024, lo: 0x97, hi: 0x99}, + {value: 0x0034, lo: 0x9a, hi: 0x9b}, + {value: 0x0024, lo: 0x9c, hi: 0xa1}, + {value: 0x0034, lo: 0xa2, hi: 0xa7}, + {value: 0x0024, lo: 0xa8, hi: 0xa9}, + {value: 0x0034, lo: 0xaa, hi: 0xaa}, + {value: 0x0024, lo: 0xab, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xae}, + {value: 0x0024, lo: 0xaf, hi: 0xaf}, + {value: 0x0034, lo: 0xb0, hi: 0xbd}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xe, offset 0x64 + {value: 0x0034, lo: 0x81, hi: 0x82}, + {value: 0x0024, lo: 0x84, hi: 0x84}, + {value: 0x0034, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0x87, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0xaa}, + {value: 0x0010, lo: 0xb0, hi: 0xb3}, + {value: 0x0054, lo: 0xb4, hi: 0xb4}, + // Block 0xf, offset 0x6b + {value: 0x0014, lo: 0x80, hi: 0x85}, + {value: 0x0024, lo: 0x90, hi: 0x97}, + {value: 0x0034, lo: 0x98, hi: 0x9a}, + {value: 0x0014, lo: 0x9c, hi: 0x9c}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x10, offset 0x70 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x8a}, + {value: 0x0034, lo: 0x8b, hi: 0x92}, + {value: 0x0024, lo: 0x93, hi: 0x94}, + {value: 0x0034, lo: 0x95, hi: 0x96}, + {value: 0x0024, lo: 0x97, hi: 0x9b}, + {value: 0x0034, lo: 0x9c, hi: 0x9c}, + {value: 0x0024, lo: 0x9d, hi: 0x9e}, + {value: 0x0034, lo: 0x9f, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0x0010, lo: 0xab, hi: 0xab}, + {value: 0x0010, lo: 0xae, hi: 0xaf}, + {value: 0x0034, lo: 0xb0, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xbf}, + // Block 0x11, offset 0x7e + {value: 0x0010, lo: 0x80, hi: 0xbf}, + // Block 0x12, offset 0x7f + {value: 0x0010, lo: 0x80, hi: 0x93}, + {value: 0x0010, lo: 0x95, hi: 0x95}, + {value: 0x0024, lo: 0x96, hi: 0x9c}, + {value: 0x0014, lo: 0x9d, hi: 0x9d}, + {value: 0x0024, lo: 0x9f, hi: 0xa2}, + {value: 0x0034, lo: 0xa3, hi: 0xa3}, + {value: 0x0024, lo: 0xa4, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xa6}, + {value: 0x0024, lo: 0xa7, hi: 0xa8}, + {value: 0x0034, lo: 0xaa, hi: 0xaa}, + {value: 0x0024, lo: 0xab, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xbc}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x13, offset 0x8d + {value: 0x0014, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0034, lo: 0x91, hi: 0x91}, + {value: 0x0010, lo: 0x92, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb0}, + {value: 0x0034, lo: 0xb1, hi: 0xb1}, + {value: 0x0024, lo: 0xb2, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0024, lo: 0xb5, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb9}, + {value: 0x0024, lo: 0xba, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbc}, + {value: 0x0024, lo: 0xbd, hi: 0xbd}, + {value: 0x0034, lo: 0xbe, hi: 0xbe}, + {value: 0x0024, lo: 0xbf, hi: 0xbf}, + // Block 0x14, offset 0x9c + {value: 0x0024, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0024, lo: 0x83, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x84}, + {value: 0x0024, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0024, lo: 0x87, hi: 0x87}, + {value: 0x0034, lo: 0x88, hi: 0x88}, + {value: 0x0024, lo: 0x89, hi: 0x8a}, + {value: 0x0010, lo: 0x8d, hi: 0xbf}, + // Block 0x15, offset 0xa6 + {value: 0x0010, lo: 0x80, hi: 0xa5}, + {value: 0x0014, lo: 0xa6, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + // Block 0x16, offset 0xa9 + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0024, lo: 0xab, hi: 0xb1}, + {value: 0x0034, lo: 0xb2, hi: 0xb2}, + {value: 0x0024, lo: 0xb3, hi: 0xb3}, + {value: 0x0014, lo: 0xb4, hi: 0xb5}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + // Block 0x17, offset 0xaf + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0024, lo: 0x96, hi: 0x99}, + {value: 0x0014, lo: 0x9a, hi: 0x9a}, + {value: 0x0024, lo: 0x9b, hi: 0xa3}, + {value: 0x0014, lo: 0xa4, hi: 0xa4}, + {value: 0x0024, lo: 0xa5, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa8}, + {value: 0x0024, lo: 0xa9, hi: 0xad}, + // Block 0x18, offset 0xb7 + {value: 0x0010, lo: 0x80, hi: 0x98}, + {value: 0x0034, lo: 0x99, hi: 0x9b}, + {value: 0x0010, lo: 0xa0, hi: 0xaa}, + // Block 0x19, offset 0xba + {value: 0x0010, lo: 0xa0, hi: 0xb4}, + {value: 0x0010, lo: 0xb6, hi: 0xbd}, + // Block 0x1a, offset 0xbc + {value: 0x0024, lo: 0x94, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa2}, + {value: 0x0034, lo: 0xa3, hi: 0xa3}, + {value: 0x0024, lo: 0xa4, hi: 0xa5}, + {value: 0x0034, lo: 0xa6, hi: 0xa6}, + {value: 0x0024, lo: 0xa7, hi: 0xa8}, + {value: 0x0034, lo: 0xa9, hi: 0xa9}, + {value: 0x0024, lo: 0xaa, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xb2}, + {value: 0x0024, lo: 0xb3, hi: 0xb5}, + {value: 0x0034, lo: 0xb6, hi: 0xb6}, + {value: 0x0024, lo: 0xb7, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0024, lo: 0xbb, hi: 0xbf}, + // Block 0x1b, offset 0xca + {value: 0x0014, lo: 0x80, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0xb9}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x1c, offset 0xd0 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x88}, + {value: 0x0010, lo: 0x89, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0024, lo: 0x91, hi: 0x91}, + {value: 0x0034, lo: 0x92, hi: 0x92}, + {value: 0x0024, lo: 0x93, hi: 0x94}, + {value: 0x0014, lo: 0x95, hi: 0x97}, + {value: 0x0010, lo: 0x98, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0014, lo: 0xb1, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xbf}, + // Block 0x1d, offset 0xde + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb2}, + {value: 0x0010, lo: 0xb6, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x1e, offset 0xe9 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8e, hi: 0x8e}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0x9c, hi: 0x9d}, + {value: 0x0010, lo: 0x9f, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xb1}, + {value: 0x0010, lo: 0xbc, hi: 0xbc}, + // Block 0x1f, offset 0xf5 + {value: 0x0014, lo: 0x81, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8a}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb6}, + {value: 0x0010, lo: 0xb8, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x20, offset 0x100 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x82}, + {value: 0x0014, lo: 0x87, hi: 0x88}, + {value: 0x0014, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0014, lo: 0x91, hi: 0x91}, + {value: 0x0010, lo: 0x99, hi: 0x9c}, + {value: 0x0010, lo: 0x9e, hi: 0x9e}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb5}, + // Block 0x21, offset 0x10c + {value: 0x0014, lo: 0x81, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8d}, + {value: 0x0010, lo: 0x8f, hi: 0x91}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x22, offset 0x116 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x85}, + {value: 0x0014, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x89, hi: 0x89}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb9, hi: 0xb9}, + {value: 0x0014, lo: 0xba, hi: 0xbf}, + // Block 0x23, offset 0x122 + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbe}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x24, offset 0x12d + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0014, lo: 0x96, hi: 0x96}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0x9c, hi: 0x9d}, + {value: 0x0010, lo: 0x9f, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + // Block 0x25, offset 0x139 + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8a}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0x95}, + {value: 0x0010, lo: 0x99, hi: 0x9a}, + {value: 0x0010, lo: 0x9c, hi: 0x9c}, + {value: 0x0010, lo: 0x9e, hi: 0x9f}, + {value: 0x0010, lo: 0xa3, hi: 0xa4}, + {value: 0x0010, lo: 0xa8, hi: 0xaa}, + {value: 0x0010, lo: 0xae, hi: 0xb9}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x26, offset 0x145 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x82}, + {value: 0x0010, lo: 0x86, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + // Block 0x27, offset 0x14d + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb9}, + {value: 0x0010, lo: 0xbd, hi: 0xbd}, + {value: 0x0014, lo: 0xbe, hi: 0xbf}, + // Block 0x28, offset 0x155 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x84}, + {value: 0x0014, lo: 0x86, hi: 0x88}, + {value: 0x0014, lo: 0x8a, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0034, lo: 0x95, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x9a}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + // Block 0x29, offset 0x15f + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbe}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x2a, offset 0x16a + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0014, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x95, hi: 0x96}, + {value: 0x0010, lo: 0x9e, hi: 0x9e}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb1, hi: 0xb2}, + // Block 0x2b, offset 0x176 + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x2c, offset 0x17d + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x86, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8e, hi: 0x8e}, + {value: 0x0010, lo: 0x94, hi: 0x97}, + {value: 0x0010, lo: 0x9f, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xba, hi: 0xbf}, + // Block 0x2d, offset 0x188 + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x96}, + {value: 0x0010, lo: 0x9a, hi: 0xb1}, + {value: 0x0010, lo: 0xb3, hi: 0xbb}, + {value: 0x0010, lo: 0xbd, hi: 0xbd}, + // Block 0x2e, offset 0x18d + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0010, lo: 0x8f, hi: 0x91}, + {value: 0x0014, lo: 0x92, hi: 0x94}, + {value: 0x0014, lo: 0x96, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x9f}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + // Block 0x2f, offset 0x195 + {value: 0x0014, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb4, hi: 0xb7}, + {value: 0x0034, lo: 0xb8, hi: 0xba}, + // Block 0x30, offset 0x198 + {value: 0x0004, lo: 0x86, hi: 0x86}, + {value: 0x0014, lo: 0x87, hi: 0x87}, + {value: 0x0034, lo: 0x88, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8e}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x31, offset 0x19d + {value: 0x0014, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb4, hi: 0xb7}, + {value: 0x0034, lo: 0xb8, hi: 0xb9}, + {value: 0x0014, lo: 0xbb, hi: 0xbc}, + // Block 0x32, offset 0x1a1 + {value: 0x0004, lo: 0x86, hi: 0x86}, + {value: 0x0034, lo: 0x88, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x33, offset 0x1a5 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0034, lo: 0x98, hi: 0x99}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0x0034, lo: 0xb5, hi: 0xb5}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + {value: 0x0034, lo: 0xb9, hi: 0xb9}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x34, offset 0x1ac + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0010, lo: 0x89, hi: 0xac}, + {value: 0x0034, lo: 0xb1, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xba, hi: 0xbd}, + {value: 0x0014, lo: 0xbe, hi: 0xbe}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x35, offset 0x1b5 + {value: 0x0034, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0024, lo: 0x82, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x84}, + {value: 0x0024, lo: 0x86, hi: 0x87}, + {value: 0x0010, lo: 0x88, hi: 0x8c}, + {value: 0x0014, lo: 0x8d, hi: 0x97}, + {value: 0x0014, lo: 0x99, hi: 0xbc}, + // Block 0x36, offset 0x1bd + {value: 0x0034, lo: 0x86, hi: 0x86}, + // Block 0x37, offset 0x1be + {value: 0x0010, lo: 0xab, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + {value: 0x0010, lo: 0xb8, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbc}, + {value: 0x0014, lo: 0xbd, hi: 0xbe}, + // Block 0x38, offset 0x1c7 + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x96, hi: 0x97}, + {value: 0x0014, lo: 0x98, hi: 0x99}, + {value: 0x0014, lo: 0x9e, hi: 0xa0}, + {value: 0x0010, lo: 0xa2, hi: 0xa4}, + {value: 0x0010, lo: 0xa7, hi: 0xad}, + {value: 0x0014, lo: 0xb1, hi: 0xb4}, + // Block 0x39, offset 0x1ce + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x84}, + {value: 0x0014, lo: 0x85, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8f, hi: 0x9c}, + {value: 0x0014, lo: 0x9d, hi: 0x9d}, + {value: 0x6c53, lo: 0xa0, hi: 0xbf}, + // Block 0x3a, offset 0x1d6 + {value: 0x7053, lo: 0x80, hi: 0x85}, + {value: 0x7053, lo: 0x87, hi: 0x87}, + {value: 0x7053, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0xba}, + {value: 0x0014, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x3b, offset 0x1dc + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x98}, + {value: 0x0010, lo: 0x9a, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x3c, offset 0x1e2 + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb5}, + {value: 0x0010, lo: 0xb8, hi: 0xbe}, + // Block 0x3d, offset 0x1e7 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x82, hi: 0x85}, + {value: 0x0010, lo: 0x88, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0xbf}, + // Block 0x3e, offset 0x1eb + {value: 0x0010, lo: 0x80, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0x95}, + {value: 0x0010, lo: 0x98, hi: 0xbf}, + // Block 0x3f, offset 0x1ee + {value: 0x0010, lo: 0x80, hi: 0x9a}, + {value: 0x0024, lo: 0x9d, hi: 0x9f}, + // Block 0x40, offset 0x1f0 + {value: 0x0010, lo: 0x80, hi: 0x8f}, + {value: 0x7453, lo: 0xa0, hi: 0xaf}, + {value: 0x7853, lo: 0xb0, hi: 0xbf}, + // Block 0x41, offset 0x1f3 + {value: 0x7c53, lo: 0x80, hi: 0x8f}, + {value: 0x8053, lo: 0x90, hi: 0x9f}, + {value: 0x7c53, lo: 0xa0, hi: 0xaf}, + {value: 0x0813, lo: 0xb0, hi: 0xb5}, + {value: 0x0892, lo: 0xb8, hi: 0xbd}, + // Block 0x42, offset 0x1f8 + {value: 0x0010, lo: 0x81, hi: 0xbf}, + // Block 0x43, offset 0x1f9 + {value: 0x0010, lo: 0x80, hi: 0xac}, + {value: 0x0010, lo: 0xaf, hi: 0xbf}, + // Block 0x44, offset 0x1fb + {value: 0x0010, lo: 0x81, hi: 0x9a}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x45, offset 0x1fd + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0010, lo: 0xae, hi: 0xb8}, + // Block 0x46, offset 0x1ff + {value: 0x0010, lo: 0x80, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x91}, + {value: 0x0014, lo: 0x92, hi: 0x93}, + {value: 0x0034, lo: 0x94, hi: 0x94}, + {value: 0x0010, lo: 0xa0, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + // Block 0x47, offset 0x206 + {value: 0x0010, lo: 0x80, hi: 0x91}, + {value: 0x0014, lo: 0x92, hi: 0x93}, + {value: 0x0010, lo: 0xa0, hi: 0xac}, + {value: 0x0010, lo: 0xae, hi: 0xb0}, + {value: 0x0014, lo: 0xb2, hi: 0xb3}, + // Block 0x48, offset 0x20b + {value: 0x0014, lo: 0xb4, hi: 0xb5}, + {value: 0x0010, lo: 0xb6, hi: 0xb6}, + {value: 0x0014, lo: 0xb7, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x49, offset 0x20f + {value: 0x0010, lo: 0x80, hi: 0x85}, + {value: 0x0014, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0014, lo: 0x89, hi: 0x91}, + {value: 0x0034, lo: 0x92, hi: 0x92}, + {value: 0x0014, lo: 0x93, hi: 0x93}, + {value: 0x0004, lo: 0x97, hi: 0x97}, + {value: 0x0024, lo: 0x9d, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + // Block 0x4a, offset 0x218 + {value: 0x0014, lo: 0x8b, hi: 0x8e}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x4b, offset 0x21b + {value: 0x0010, lo: 0x80, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0xb7}, + // Block 0x4c, offset 0x21e + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0014, lo: 0x85, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0xa8}, + {value: 0x0034, lo: 0xa9, hi: 0xa9}, + {value: 0x0010, lo: 0xaa, hi: 0xaa}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x4d, offset 0x224 + {value: 0x0010, lo: 0x80, hi: 0xb5}, + // Block 0x4e, offset 0x225 + {value: 0x0010, lo: 0x80, hi: 0x9e}, + {value: 0x0014, lo: 0xa0, hi: 0xa2}, + {value: 0x0010, lo: 0xa3, hi: 0xa6}, + {value: 0x0014, lo: 0xa7, hi: 0xa8}, + {value: 0x0010, lo: 0xa9, hi: 0xab}, + {value: 0x0010, lo: 0xb0, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb2}, + {value: 0x0010, lo: 0xb3, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xb9}, + {value: 0x0024, lo: 0xba, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbb}, + // Block 0x4f, offset 0x230 + {value: 0x0010, lo: 0x86, hi: 0x8f}, + // Block 0x50, offset 0x231 + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x51, offset 0x232 + {value: 0x0010, lo: 0x80, hi: 0x96}, + {value: 0x0024, lo: 0x97, hi: 0x97}, + {value: 0x0034, lo: 0x98, hi: 0x98}, + {value: 0x0010, lo: 0x99, hi: 0x9a}, + {value: 0x0014, lo: 0x9b, hi: 0x9b}, + // Block 0x52, offset 0x237 + {value: 0x0010, lo: 0x95, hi: 0x95}, + {value: 0x0014, lo: 0x96, hi: 0x96}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0014, lo: 0x98, hi: 0x9e}, + {value: 0x0034, lo: 0xa0, hi: 0xa0}, + {value: 0x0010, lo: 0xa1, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa2}, + {value: 0x0010, lo: 0xa3, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xac}, + {value: 0x0010, lo: 0xad, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb4}, + {value: 0x0024, lo: 0xb5, hi: 0xbc}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0x53, offset 0x244 + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0004, lo: 0xa7, hi: 0xa7}, + {value: 0x0024, lo: 0xb0, hi: 0xb4}, + {value: 0x0034, lo: 0xb5, hi: 0xba}, + {value: 0x0024, lo: 0xbb, hi: 0xbc}, + {value: 0x0034, lo: 0xbd, hi: 0xbd}, + {value: 0x0014, lo: 0xbe, hi: 0xbe}, + // Block 0x54, offset 0x24c + {value: 0x0014, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x55, offset 0x254 + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0030, lo: 0x84, hi: 0x84}, + {value: 0x0010, lo: 0x85, hi: 0x8b}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0024, lo: 0xab, hi: 0xab}, + {value: 0x0034, lo: 0xac, hi: 0xac}, + {value: 0x0024, lo: 0xad, hi: 0xb3}, + // Block 0x56, offset 0x25d + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa5}, + {value: 0x0010, lo: 0xa6, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa9}, + {value: 0x0030, lo: 0xaa, hi: 0xaa}, + {value: 0x0034, lo: 0xab, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xbf}, + // Block 0x57, offset 0x266 + {value: 0x0010, lo: 0x80, hi: 0xa5}, + {value: 0x0034, lo: 0xa6, hi: 0xa6}, + {value: 0x0010, lo: 0xa7, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa9}, + {value: 0x0010, lo: 0xaa, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xae}, + {value: 0x0014, lo: 0xaf, hi: 0xb1}, + {value: 0x0030, lo: 0xb2, hi: 0xb3}, + // Block 0x58, offset 0x26f + {value: 0x0010, lo: 0x80, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xb3}, + {value: 0x0010, lo: 0xb4, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + // Block 0x59, offset 0x274 + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x8d, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbd}, + // Block 0x5a, offset 0x277 + {value: 0x1a6a, lo: 0x80, hi: 0x80}, + {value: 0x1aea, lo: 0x81, hi: 0x81}, + {value: 0x1b6a, lo: 0x82, hi: 0x82}, + {value: 0x1bea, lo: 0x83, hi: 0x83}, + {value: 0x1c6a, lo: 0x84, hi: 0x84}, + {value: 0x1cea, lo: 0x85, hi: 0x85}, + {value: 0x1d6a, lo: 0x86, hi: 0x86}, + {value: 0x1dea, lo: 0x87, hi: 0x87}, + {value: 0x1e6a, lo: 0x88, hi: 0x88}, + // Block 0x5b, offset 0x280 + {value: 0x0024, lo: 0x90, hi: 0x92}, + {value: 0x0034, lo: 0x94, hi: 0x99}, + {value: 0x0024, lo: 0x9a, hi: 0x9b}, + {value: 0x0034, lo: 0x9c, hi: 0x9f}, + {value: 0x0024, lo: 0xa0, hi: 0xa0}, + {value: 0x0010, lo: 0xa1, hi: 0xa1}, + {value: 0x0034, lo: 0xa2, hi: 0xa8}, + {value: 0x0010, lo: 0xa9, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xb3}, + {value: 0x0024, lo: 0xb4, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb7}, + {value: 0x0024, lo: 0xb8, hi: 0xb9}, + // Block 0x5c, offset 0x28d + {value: 0x0012, lo: 0x80, hi: 0xab}, + {value: 0x0015, lo: 0xac, hi: 0xbf}, + // Block 0x5d, offset 0x28f + {value: 0x0015, lo: 0x80, hi: 0xaa}, + {value: 0x0012, lo: 0xab, hi: 0xb7}, + {value: 0x0015, lo: 0xb8, hi: 0xb8}, + {value: 0x8452, lo: 0xb9, hi: 0xb9}, + {value: 0x0012, lo: 0xba, hi: 0xbc}, + {value: 0x8852, lo: 0xbd, hi: 0xbd}, + {value: 0x0012, lo: 0xbe, hi: 0xbf}, + // Block 0x5e, offset 0x296 + {value: 0x0012, lo: 0x80, hi: 0x9a}, + {value: 0x0015, lo: 0x9b, hi: 0xbf}, + // Block 0x5f, offset 0x298 + {value: 0x0024, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0024, lo: 0x83, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0024, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x90}, + {value: 0x0024, lo: 0x91, hi: 0xb5}, + {value: 0x0034, lo: 0xb6, hi: 0xb9}, + {value: 0x0024, lo: 0xbb, hi: 0xbb}, + {value: 0x0034, lo: 0xbc, hi: 0xbd}, + {value: 0x0024, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0x60, offset 0x2a4 + {value: 0x0117, lo: 0x80, hi: 0xbf}, + // Block 0x61, offset 0x2a5 + {value: 0x0117, lo: 0x80, hi: 0x95}, + {value: 0x1f1a, lo: 0x96, hi: 0x96}, + {value: 0x1fca, lo: 0x97, hi: 0x97}, + {value: 0x207a, lo: 0x98, hi: 0x98}, + {value: 0x212a, lo: 0x99, hi: 0x99}, + {value: 0x21da, lo: 0x9a, hi: 0x9a}, + {value: 0x228a, lo: 0x9b, hi: 0x9b}, + {value: 0x0012, lo: 0x9c, hi: 0x9d}, + {value: 0x233b, lo: 0x9e, hi: 0x9e}, + {value: 0x0012, lo: 0x9f, hi: 0x9f}, + {value: 0x0117, lo: 0xa0, hi: 0xbf}, + // Block 0x62, offset 0x2b0 + {value: 0x0812, lo: 0x80, hi: 0x87}, + {value: 0x0813, lo: 0x88, hi: 0x8f}, + {value: 0x0812, lo: 0x90, hi: 0x95}, + {value: 0x0813, lo: 0x98, hi: 0x9d}, + {value: 0x0812, lo: 0xa0, hi: 0xa7}, + {value: 0x0813, lo: 0xa8, hi: 0xaf}, + {value: 0x0812, lo: 0xb0, hi: 0xb7}, + {value: 0x0813, lo: 0xb8, hi: 0xbf}, + // Block 0x63, offset 0x2b8 + {value: 0x0004, lo: 0x8b, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8f}, + {value: 0x0054, lo: 0x98, hi: 0x99}, + {value: 0x0054, lo: 0xa4, hi: 0xa4}, + {value: 0x0054, lo: 0xa7, hi: 0xa7}, + {value: 0x0014, lo: 0xaa, hi: 0xae}, + {value: 0x0010, lo: 0xaf, hi: 0xaf}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x64, offset 0x2c0 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x94, hi: 0x94}, + {value: 0x0014, lo: 0xa0, hi: 0xa4}, + {value: 0x0014, lo: 0xa6, hi: 0xaf}, + {value: 0x0015, lo: 0xb1, hi: 0xb1}, + {value: 0x0015, lo: 0xbf, hi: 0xbf}, + // Block 0x65, offset 0x2c6 + {value: 0x0015, lo: 0x90, hi: 0x9c}, + // Block 0x66, offset 0x2c7 + {value: 0x0024, lo: 0x90, hi: 0x91}, + {value: 0x0034, lo: 0x92, hi: 0x93}, + {value: 0x0024, lo: 0x94, hi: 0x97}, + {value: 0x0034, lo: 0x98, hi: 0x9a}, + {value: 0x0024, lo: 0x9b, hi: 0x9c}, + {value: 0x0014, lo: 0x9d, hi: 0xa0}, + {value: 0x0024, lo: 0xa1, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa4}, + {value: 0x0034, lo: 0xa5, hi: 0xa6}, + {value: 0x0024, lo: 0xa7, hi: 0xa7}, + {value: 0x0034, lo: 0xa8, hi: 0xa8}, + {value: 0x0024, lo: 0xa9, hi: 0xa9}, + {value: 0x0034, lo: 0xaa, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb0}, + // Block 0x67, offset 0x2d5 + {value: 0x0016, lo: 0x85, hi: 0x86}, + {value: 0x0012, lo: 0x87, hi: 0x89}, + {value: 0x9d52, lo: 0x8e, hi: 0x8e}, + {value: 0x1013, lo: 0xa0, hi: 0xaf}, + {value: 0x1012, lo: 0xb0, hi: 0xbf}, + // Block 0x68, offset 0x2da + {value: 0x0010, lo: 0x80, hi: 0x82}, + {value: 0x0716, lo: 0x83, hi: 0x84}, + {value: 0x0010, lo: 0x85, hi: 0x88}, + // Block 0x69, offset 0x2dd + {value: 0xa053, lo: 0xb6, hi: 0xb7}, + {value: 0xa353, lo: 0xb8, hi: 0xb9}, + {value: 0xa653, lo: 0xba, hi: 0xbb}, + {value: 0xa353, lo: 0xbc, hi: 0xbd}, + {value: 0xa053, lo: 0xbe, hi: 0xbf}, + // Block 0x6a, offset 0x2e2 + {value: 0x3013, lo: 0x80, hi: 0x8f}, + {value: 0x6553, lo: 0x90, hi: 0x9f}, + {value: 0xa953, lo: 0xa0, hi: 0xae}, + {value: 0x3012, lo: 0xb0, hi: 0xbf}, + // Block 0x6b, offset 0x2e6 + {value: 0x0117, lo: 0x80, hi: 0xa3}, + {value: 0x0012, lo: 0xa4, hi: 0xa4}, + {value: 0x0716, lo: 0xab, hi: 0xac}, + {value: 0x0316, lo: 0xad, hi: 0xae}, + {value: 0x0024, lo: 0xaf, hi: 0xb1}, + {value: 0x0117, lo: 0xb2, hi: 0xb3}, + // Block 0x6c, offset 0x2ec + {value: 0x6c52, lo: 0x80, hi: 0x9f}, + {value: 0x7052, lo: 0xa0, hi: 0xa5}, + {value: 0x7052, lo: 0xa7, hi: 0xa7}, + {value: 0x7052, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x6d, offset 0x2f1 + {value: 0x0010, lo: 0x80, hi: 0xa7}, + {value: 0x0014, lo: 0xaf, hi: 0xaf}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0x6e, offset 0x2f4 + {value: 0x0010, lo: 0x80, hi: 0x96}, + {value: 0x0010, lo: 0xa0, hi: 0xa6}, + {value: 0x0010, lo: 0xa8, hi: 0xae}, + {value: 0x0010, lo: 0xb0, hi: 0xb6}, + {value: 0x0010, lo: 0xb8, hi: 0xbe}, + // Block 0x6f, offset 0x2f9 + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x88, hi: 0x8e}, + {value: 0x0010, lo: 0x90, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x9e}, + {value: 0x0024, lo: 0xa0, hi: 0xbf}, + // Block 0x70, offset 0x2fe + {value: 0x0014, lo: 0xaf, hi: 0xaf}, + // Block 0x71, offset 0x2ff + {value: 0x0014, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0xaa, hi: 0xad}, + {value: 0x0030, lo: 0xae, hi: 0xaf}, + {value: 0x0004, lo: 0xb1, hi: 0xb5}, + {value: 0x0014, lo: 0xbb, hi: 0xbb}, + {value: 0x0010, lo: 0xbc, hi: 0xbc}, + // Block 0x72, offset 0x305 + {value: 0x0034, lo: 0x99, hi: 0x9a}, + {value: 0x0004, lo: 0x9b, hi: 0x9e}, + // Block 0x73, offset 0x307 + {value: 0x0004, lo: 0xbc, hi: 0xbe}, + // Block 0x74, offset 0x308 + {value: 0x0010, lo: 0x85, hi: 0xae}, + {value: 0x0010, lo: 0xb1, hi: 0xbf}, + // Block 0x75, offset 0x30a + {value: 0x0010, lo: 0x80, hi: 0x8e}, + {value: 0x0010, lo: 0xa0, hi: 0xba}, + // Block 0x76, offset 0x30c + {value: 0x0010, lo: 0x80, hi: 0x94}, + {value: 0x0014, lo: 0x95, hi: 0x95}, + {value: 0x0010, lo: 0x96, hi: 0xbf}, + // Block 0x77, offset 0x30f + {value: 0x0010, lo: 0x80, hi: 0x8c}, + // Block 0x78, offset 0x310 + {value: 0x0010, lo: 0x90, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbd}, + // Block 0x79, offset 0x312 + {value: 0x0010, lo: 0x80, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0010, lo: 0x90, hi: 0xab}, + // Block 0x7a, offset 0x315 + {value: 0x0117, lo: 0x80, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xae}, + {value: 0x0024, lo: 0xaf, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb2}, + {value: 0x0024, lo: 0xb4, hi: 0xbd}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x7b, offset 0x31b + {value: 0x0117, lo: 0x80, hi: 0x9b}, + {value: 0x0015, lo: 0x9c, hi: 0x9d}, + {value: 0x0024, lo: 0x9e, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x7c, offset 0x31f + {value: 0x0010, lo: 0x80, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb1}, + // Block 0x7d, offset 0x321 + {value: 0x0004, lo: 0x80, hi: 0x96}, + {value: 0x0014, lo: 0x97, hi: 0xa1}, + {value: 0x0117, lo: 0xa2, hi: 0xaf}, + {value: 0x0012, lo: 0xb0, hi: 0xb1}, + {value: 0x0117, lo: 0xb2, hi: 0xbf}, + // Block 0x7e, offset 0x326 + {value: 0x0117, lo: 0x80, hi: 0xaf}, + {value: 0x0015, lo: 0xb0, hi: 0xb0}, + {value: 0x0012, lo: 0xb1, hi: 0xb8}, + {value: 0x0316, lo: 0xb9, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x8453, lo: 0xbd, hi: 0xbd}, + {value: 0x0117, lo: 0xbe, hi: 0xbf}, + // Block 0x7f, offset 0x32d + {value: 0x0010, lo: 0xb7, hi: 0xb7}, + {value: 0x0015, lo: 0xb8, hi: 0xb9}, + {value: 0x0012, lo: 0xba, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbf}, + // Block 0x80, offset 0x331 + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x8a}, + {value: 0x0014, lo: 0x8b, hi: 0x8b}, + {value: 0x0010, lo: 0x8c, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xa6}, + {value: 0x0010, lo: 0xa7, hi: 0xa7}, + // Block 0x81, offset 0x33a + {value: 0x0010, lo: 0x80, hi: 0xb3}, + // Block 0x82, offset 0x33b + {value: 0x0010, lo: 0x80, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x84}, + {value: 0x0014, lo: 0x85, hi: 0x85}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0024, lo: 0xa0, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xb7}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0010, lo: 0xbd, hi: 0xbd}, + // Block 0x83, offset 0x343 + {value: 0x0010, lo: 0x80, hi: 0xa5}, + {value: 0x0014, lo: 0xa6, hi: 0xaa}, + {value: 0x0034, lo: 0xab, hi: 0xad}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x84, offset 0x347 + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0014, lo: 0x87, hi: 0x91}, + {value: 0x0010, lo: 0x92, hi: 0x92}, + {value: 0x0030, lo: 0x93, hi: 0x93}, + {value: 0x0010, lo: 0xa0, hi: 0xbc}, + // Block 0x85, offset 0x34c + {value: 0x0014, lo: 0x80, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0xb2}, + {value: 0x0034, lo: 0xb3, hi: 0xb3}, + {value: 0x0010, lo: 0xb4, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xb9}, + {value: 0x0010, lo: 0xba, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x86, offset 0x354 + {value: 0x0030, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0014, lo: 0xa5, hi: 0xa5}, + {value: 0x0004, lo: 0xa6, hi: 0xa6}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0x87, offset 0x35a + {value: 0x0010, lo: 0x80, hi: 0xa8}, + {value: 0x0014, lo: 0xa9, hi: 0xae}, + {value: 0x0010, lo: 0xaf, hi: 0xb0}, + {value: 0x0014, lo: 0xb1, hi: 0xb2}, + {value: 0x0010, lo: 0xb3, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb6}, + // Block 0x88, offset 0x360 + {value: 0x0010, lo: 0x80, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0010, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0004, lo: 0xb0, hi: 0xb0}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbd}, + // Block 0x89, offset 0x36a + {value: 0x0024, lo: 0xb0, hi: 0xb0}, + {value: 0x0024, lo: 0xb2, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0024, lo: 0xb7, hi: 0xb8}, + {value: 0x0024, lo: 0xbe, hi: 0xbf}, + // Block 0x8a, offset 0x36f + {value: 0x0024, lo: 0x81, hi: 0x81}, + {value: 0x0004, lo: 0x9d, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xaf}, + {value: 0x0010, lo: 0xb2, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb5}, + {value: 0x0034, lo: 0xb6, hi: 0xb6}, + // Block 0x8b, offset 0x378 + {value: 0x0010, lo: 0x81, hi: 0x86}, + {value: 0x0010, lo: 0x89, hi: 0x8e}, + {value: 0x0010, lo: 0x91, hi: 0x96}, + {value: 0x0010, lo: 0xa0, hi: 0xa6}, + {value: 0x0010, lo: 0xa8, hi: 0xae}, + {value: 0x0012, lo: 0xb0, hi: 0xbf}, + // Block 0x8c, offset 0x37e + {value: 0x0012, lo: 0x80, hi: 0x92}, + {value: 0xac52, lo: 0x93, hi: 0x93}, + {value: 0x0012, lo: 0x94, hi: 0x9a}, + {value: 0x0014, lo: 0x9b, hi: 0x9b}, + {value: 0x0015, lo: 0x9c, hi: 0x9f}, + {value: 0x0012, lo: 0xa0, hi: 0xa5}, + {value: 0x74d2, lo: 0xb0, hi: 0xbf}, + // Block 0x8d, offset 0x385 + {value: 0x78d2, lo: 0x80, hi: 0x8f}, + {value: 0x7cd2, lo: 0x90, hi: 0x9f}, + {value: 0x80d2, lo: 0xa0, hi: 0xaf}, + {value: 0x7cd2, lo: 0xb0, hi: 0xbf}, + // Block 0x8e, offset 0x389 + {value: 0x0010, lo: 0x80, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xa5}, + {value: 0x0010, lo: 0xa6, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa8}, + {value: 0x0010, lo: 0xa9, hi: 0xaa}, + {value: 0x0010, lo: 0xac, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0x8f, offset 0x391 + {value: 0x0010, lo: 0x80, hi: 0xa3}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x90, offset 0x393 + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x8b, hi: 0xbb}, + // Block 0x91, offset 0x395 + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x83, hi: 0x84}, + {value: 0x0010, lo: 0x86, hi: 0xbf}, + // Block 0x92, offset 0x398 + {value: 0x0010, lo: 0x80, hi: 0xb1}, + {value: 0x0004, lo: 0xb2, hi: 0xbf}, + // Block 0x93, offset 0x39a + {value: 0x0004, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x93, hi: 0xbf}, + // Block 0x94, offset 0x39c + {value: 0x0010, lo: 0x80, hi: 0xbd}, + // Block 0x95, offset 0x39d + {value: 0x0010, lo: 0x90, hi: 0xbf}, + // Block 0x96, offset 0x39e + {value: 0x0010, lo: 0x80, hi: 0x8f}, + {value: 0x0010, lo: 0x92, hi: 0xbf}, + // Block 0x97, offset 0x3a0 + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0010, lo: 0xb0, hi: 0xbb}, + // Block 0x98, offset 0x3a2 + {value: 0x0014, lo: 0x80, hi: 0x8f}, + {value: 0x0054, lo: 0x93, hi: 0x93}, + {value: 0x0024, lo: 0xa0, hi: 0xa6}, + {value: 0x0034, lo: 0xa7, hi: 0xad}, + {value: 0x0024, lo: 0xae, hi: 0xaf}, + {value: 0x0010, lo: 0xb3, hi: 0xb4}, + // Block 0x99, offset 0x3a8 + {value: 0x0010, lo: 0x8d, hi: 0x8f}, + {value: 0x0054, lo: 0x92, hi: 0x92}, + {value: 0x0054, lo: 0x95, hi: 0x95}, + {value: 0x0010, lo: 0xb0, hi: 0xb4}, + {value: 0x0010, lo: 0xb6, hi: 0xbf}, + // Block 0x9a, offset 0x3ad + {value: 0x0010, lo: 0x80, hi: 0xbc}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x9b, offset 0x3af + {value: 0x0054, lo: 0x87, hi: 0x87}, + {value: 0x0054, lo: 0x8e, hi: 0x8e}, + {value: 0x0054, lo: 0x9a, hi: 0x9a}, + {value: 0x5f53, lo: 0xa1, hi: 0xba}, + {value: 0x0004, lo: 0xbe, hi: 0xbe}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x9c, offset 0x3b5 + {value: 0x0004, lo: 0x80, hi: 0x80}, + {value: 0x5f52, lo: 0x81, hi: 0x9a}, + {value: 0x0004, lo: 0xb0, hi: 0xb0}, + // Block 0x9d, offset 0x3b8 + {value: 0x0014, lo: 0x9e, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xbe}, + // Block 0x9e, offset 0x3ba + {value: 0x0010, lo: 0x82, hi: 0x87}, + {value: 0x0010, lo: 0x8a, hi: 0x8f}, + {value: 0x0010, lo: 0x92, hi: 0x97}, + {value: 0x0010, lo: 0x9a, hi: 0x9c}, + {value: 0x0004, lo: 0xa3, hi: 0xa3}, + {value: 0x0014, lo: 0xb9, hi: 0xbb}, + // Block 0x9f, offset 0x3c0 + {value: 0x0010, lo: 0x80, hi: 0x8b}, + {value: 0x0010, lo: 0x8d, hi: 0xa6}, + {value: 0x0010, lo: 0xa8, hi: 0xba}, + {value: 0x0010, lo: 0xbc, hi: 0xbd}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xa0, offset 0x3c5 + {value: 0x0010, lo: 0x80, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x9d}, + // Block 0xa1, offset 0x3c7 + {value: 0x0010, lo: 0x80, hi: 0xba}, + // Block 0xa2, offset 0x3c8 + {value: 0x0010, lo: 0x80, hi: 0xb4}, + // Block 0xa3, offset 0x3c9 + {value: 0x0034, lo: 0xbd, hi: 0xbd}, + // Block 0xa4, offset 0x3ca + {value: 0x0010, lo: 0x80, hi: 0x9c}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0xa5, offset 0x3cc + {value: 0x0010, lo: 0x80, hi: 0x90}, + {value: 0x0034, lo: 0xa0, hi: 0xa0}, + // Block 0xa6, offset 0x3ce + {value: 0x0010, lo: 0x80, hi: 0x9f}, + {value: 0x0010, lo: 0xad, hi: 0xbf}, + // Block 0xa7, offset 0x3d0 + {value: 0x0010, lo: 0x80, hi: 0x8a}, + {value: 0x0010, lo: 0x90, hi: 0xb5}, + {value: 0x0024, lo: 0xb6, hi: 0xba}, + // Block 0xa8, offset 0x3d3 + {value: 0x0010, lo: 0x80, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0xa9, offset 0x3d5 + {value: 0x0010, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x88, hi: 0x8f}, + {value: 0x0010, lo: 0x91, hi: 0x95}, + // Block 0xaa, offset 0x3d8 + {value: 0x2813, lo: 0x80, hi: 0x87}, + {value: 0x3813, lo: 0x88, hi: 0x8f}, + {value: 0x2813, lo: 0x90, hi: 0x97}, + {value: 0xaf53, lo: 0x98, hi: 0x9f}, + {value: 0xb253, lo: 0xa0, hi: 0xa7}, + {value: 0x2812, lo: 0xa8, hi: 0xaf}, + {value: 0x3812, lo: 0xb0, hi: 0xb7}, + {value: 0x2812, lo: 0xb8, hi: 0xbf}, + // Block 0xab, offset 0x3e0 + {value: 0xaf52, lo: 0x80, hi: 0x87}, + {value: 0xb252, lo: 0x88, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0xbf}, + // Block 0xac, offset 0x3e3 + {value: 0x0010, lo: 0x80, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0xb253, lo: 0xb0, hi: 0xb7}, + {value: 0xaf53, lo: 0xb8, hi: 0xbf}, + // Block 0xad, offset 0x3e7 + {value: 0x2813, lo: 0x80, hi: 0x87}, + {value: 0x3813, lo: 0x88, hi: 0x8f}, + {value: 0x2813, lo: 0x90, hi: 0x93}, + {value: 0xb252, lo: 0x98, hi: 0x9f}, + {value: 0xaf52, lo: 0xa0, hi: 0xa7}, + {value: 0x2812, lo: 0xa8, hi: 0xaf}, + {value: 0x3812, lo: 0xb0, hi: 0xb7}, + {value: 0x2812, lo: 0xb8, hi: 0xbb}, + // Block 0xae, offset 0x3ef + {value: 0x0010, lo: 0x80, hi: 0xa7}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0xaf, offset 0x3f1 + {value: 0x0010, lo: 0x80, hi: 0xa3}, + // Block 0xb0, offset 0x3f2 + {value: 0x0010, lo: 0x80, hi: 0xb6}, + // Block 0xb1, offset 0x3f3 + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xa7}, + // Block 0xb2, offset 0x3f5 + {value: 0x0010, lo: 0x80, hi: 0x85}, + {value: 0x0010, lo: 0x88, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0xb5}, + {value: 0x0010, lo: 0xb7, hi: 0xb8}, + {value: 0x0010, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xb3, offset 0x3fb + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xb6}, + // Block 0xb4, offset 0x3fd + {value: 0x0010, lo: 0x80, hi: 0x9e}, + // Block 0xb5, offset 0x3fe + {value: 0x0010, lo: 0xa0, hi: 0xb2}, + {value: 0x0010, lo: 0xb4, hi: 0xb5}, + // Block 0xb6, offset 0x400 + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xb9}, + // Block 0xb7, offset 0x402 + {value: 0x0010, lo: 0x80, hi: 0xb7}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0xb8, offset 0x404 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x83}, + {value: 0x0014, lo: 0x85, hi: 0x86}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0014, lo: 0x8e, hi: 0x8e}, + {value: 0x0024, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0x93}, + {value: 0x0010, lo: 0x95, hi: 0x97}, + {value: 0x0010, lo: 0x99, hi: 0xb3}, + {value: 0x0024, lo: 0xb8, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xb9, offset 0x411 + {value: 0x0010, lo: 0xa0, hi: 0xbc}, + // Block 0xba, offset 0x412 + {value: 0x0010, lo: 0x80, hi: 0x9c}, + // Block 0xbb, offset 0x413 + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0010, lo: 0x89, hi: 0xa4}, + {value: 0x0024, lo: 0xa5, hi: 0xa5}, + {value: 0x0034, lo: 0xa6, hi: 0xa6}, + // Block 0xbc, offset 0x417 + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xb2}, + // Block 0xbd, offset 0x419 + {value: 0x0010, lo: 0x80, hi: 0x91}, + // Block 0xbe, offset 0x41a + {value: 0x0010, lo: 0x80, hi: 0x88}, + // Block 0xbf, offset 0x41b + {value: 0x5653, lo: 0x80, hi: 0xb2}, + // Block 0xc0, offset 0x41c + {value: 0x5652, lo: 0x80, hi: 0xb2}, + // Block 0xc1, offset 0x41d + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbf}, + // Block 0xc2, offset 0x421 + {value: 0x0014, lo: 0x80, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xc3, offset 0x425 + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb6}, + {value: 0x0010, lo: 0xb7, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0014, lo: 0xbd, hi: 0xbd}, + // Block 0xc4, offset 0x42b + {value: 0x0010, lo: 0x90, hi: 0xa8}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0xc5, offset 0x42d + {value: 0x0024, lo: 0x80, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0xa6}, + {value: 0x0014, lo: 0xa7, hi: 0xab}, + {value: 0x0010, lo: 0xac, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xb2}, + {value: 0x0034, lo: 0xb3, hi: 0xb4}, + {value: 0x0010, lo: 0xb6, hi: 0xbf}, + // Block 0xc6, offset 0x434 + {value: 0x0010, lo: 0x90, hi: 0xb2}, + {value: 0x0034, lo: 0xb3, hi: 0xb3}, + {value: 0x0010, lo: 0xb6, hi: 0xb6}, + // Block 0xc7, offset 0x437 + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xbe}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xc8, offset 0x43b + {value: 0x0030, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x84}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0014, lo: 0x8b, hi: 0x8c}, + {value: 0x0010, lo: 0x90, hi: 0x9a}, + {value: 0x0010, lo: 0x9c, hi: 0x9c}, + // Block 0xc9, offset 0x441 + {value: 0x0010, lo: 0x80, hi: 0x91}, + {value: 0x0010, lo: 0x93, hi: 0xae}, + {value: 0x0014, lo: 0xaf, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0014, lo: 0xb4, hi: 0xb4}, + {value: 0x0030, lo: 0xb5, hi: 0xb5}, + {value: 0x0034, lo: 0xb6, hi: 0xb6}, + {value: 0x0014, lo: 0xb7, hi: 0xb7}, + {value: 0x0014, lo: 0xbe, hi: 0xbe}, + // Block 0xca, offset 0x44a + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x88, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8d}, + {value: 0x0010, lo: 0x8f, hi: 0x9d}, + {value: 0x0010, lo: 0x9f, hi: 0xa8}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0xcb, offset 0x450 + {value: 0x0010, lo: 0x80, hi: 0x9e}, + {value: 0x0014, lo: 0x9f, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa2}, + {value: 0x0014, lo: 0xa3, hi: 0xa8}, + {value: 0x0034, lo: 0xa9, hi: 0xaa}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0xcc, offset 0x456 + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0xcd, offset 0x460 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0030, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0x9d, hi: 0xa3}, + {value: 0x0024, lo: 0xa6, hi: 0xac}, + {value: 0x0024, lo: 0xb0, hi: 0xb4}, + // Block 0xce, offset 0x46a + {value: 0x0010, lo: 0x80, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbf}, + // Block 0xcf, offset 0x46c + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x84}, + {value: 0x0010, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x8a}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0xd0, offset 0x473 + {value: 0x0010, lo: 0x80, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb8}, + {value: 0x0010, lo: 0xb9, hi: 0xb9}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbe}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0xd1, offset 0x479 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0x85}, + {value: 0x0010, lo: 0x87, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0xd2, offset 0x47f + {value: 0x0010, lo: 0x80, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb5}, + {value: 0x0010, lo: 0xb8, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xd3, offset 0x485 + {value: 0x0034, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x98, hi: 0x9b}, + {value: 0x0014, lo: 0x9c, hi: 0x9d}, + // Block 0xd4, offset 0x488 + {value: 0x0010, lo: 0x80, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbc}, + {value: 0x0014, lo: 0xbd, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xd5, offset 0x48e + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x84, hi: 0x84}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0xd6, offset 0x491 + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0014, lo: 0xab, hi: 0xab}, + {value: 0x0010, lo: 0xac, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb5}, + {value: 0x0030, lo: 0xb6, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + // Block 0xd7, offset 0x499 + {value: 0x0010, lo: 0x80, hi: 0x89}, + // Block 0xd8, offset 0x49a + {value: 0x0014, lo: 0x9d, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa5}, + {value: 0x0010, lo: 0xa6, hi: 0xa6}, + {value: 0x0014, lo: 0xa7, hi: 0xaa}, + {value: 0x0034, lo: 0xab, hi: 0xab}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0xd9, offset 0x4a1 + {value: 0x5f53, lo: 0xa0, hi: 0xbf}, + // Block 0xda, offset 0x4a2 + {value: 0x5f52, lo: 0x80, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xdb, offset 0x4a5 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0014, lo: 0x89, hi: 0x8a}, + {value: 0x0010, lo: 0x8b, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb8}, + {value: 0x0010, lo: 0xb9, hi: 0xba}, + {value: 0x0014, lo: 0xbb, hi: 0xbe}, + // Block 0xdc, offset 0x4af + {value: 0x0034, lo: 0x87, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0014, lo: 0x91, hi: 0x96}, + {value: 0x0010, lo: 0x97, hi: 0x98}, + {value: 0x0014, lo: 0x99, hi: 0x9b}, + {value: 0x0010, lo: 0x9c, hi: 0xbf}, + // Block 0xdd, offset 0x4b5 + {value: 0x0010, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x86, hi: 0x89}, + {value: 0x0014, lo: 0x8a, hi: 0x96}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0014, lo: 0x98, hi: 0x98}, + {value: 0x0034, lo: 0x99, hi: 0x99}, + // Block 0xde, offset 0x4bb + {value: 0x0010, lo: 0x80, hi: 0xb8}, + // Block 0xdf, offset 0x4bc + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb6}, + {value: 0x0014, lo: 0xb8, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xe0, offset 0x4c2 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0010, lo: 0xb2, hi: 0xbf}, + // Block 0xe1, offset 0x4c5 + {value: 0x0010, lo: 0x80, hi: 0x8f}, + {value: 0x0014, lo: 0x92, hi: 0xa7}, + {value: 0x0010, lo: 0xa9, hi: 0xa9}, + {value: 0x0014, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb4, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb6}, + // Block 0xe2, offset 0x4cd + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x88, hi: 0x89}, + {value: 0x0010, lo: 0x8b, hi: 0xb0}, + {value: 0x0014, lo: 0xb1, hi: 0xb6}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + {value: 0x0014, lo: 0xbc, hi: 0xbd}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0xe3, offset 0x4d4 + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x85}, + {value: 0x0010, lo: 0x86, hi: 0x86}, + {value: 0x0014, lo: 0x87, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0xe4, offset 0x4db + {value: 0x0010, lo: 0x80, hi: 0x99}, + // Block 0xe5, offset 0x4dc + {value: 0x0010, lo: 0x80, hi: 0xae}, + // Block 0xe6, offset 0x4dd + {value: 0x0010, lo: 0x80, hi: 0x83}, + // Block 0xe7, offset 0x4de + {value: 0x0010, lo: 0x80, hi: 0x86}, + // Block 0xe8, offset 0x4df + {value: 0x0010, lo: 0x80, hi: 0x9e}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + // Block 0xe9, offset 0x4e1 + {value: 0x0010, lo: 0x90, hi: 0xad}, + {value: 0x0034, lo: 0xb0, hi: 0xb4}, + // Block 0xea, offset 0x4e3 + {value: 0x0010, lo: 0x80, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb6}, + // Block 0xeb, offset 0x4e5 + {value: 0x0014, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0010, lo: 0xa3, hi: 0xb7}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0xec, offset 0x4e9 + {value: 0x0010, lo: 0x80, hi: 0x8f}, + // Block 0xed, offset 0x4ea + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0010, lo: 0x90, hi: 0xbe}, + // Block 0xee, offset 0x4ec + {value: 0x0014, lo: 0x8f, hi: 0x9f}, + // Block 0xef, offset 0x4ed + {value: 0x0014, lo: 0xa0, hi: 0xa1}, + // Block 0xf0, offset 0x4ee + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0010, lo: 0xb0, hi: 0xbc}, + // Block 0xf1, offset 0x4f0 + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0014, lo: 0x9d, hi: 0x9d}, + {value: 0x0034, lo: 0x9e, hi: 0x9e}, + {value: 0x0014, lo: 0xa0, hi: 0xa3}, + // Block 0xf2, offset 0x4f5 + {value: 0x0030, lo: 0xa5, hi: 0xa6}, + {value: 0x0034, lo: 0xa7, hi: 0xa9}, + {value: 0x0030, lo: 0xad, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbf}, + // Block 0xf3, offset 0x4fa + {value: 0x0034, lo: 0x80, hi: 0x82}, + {value: 0x0024, lo: 0x85, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8b}, + {value: 0x0024, lo: 0xaa, hi: 0xad}, + // Block 0xf4, offset 0x4fe + {value: 0x0024, lo: 0x82, hi: 0x84}, + // Block 0xf5, offset 0x4ff + {value: 0x0013, lo: 0x80, hi: 0x99}, + {value: 0x0012, lo: 0x9a, hi: 0xb3}, + {value: 0x0013, lo: 0xb4, hi: 0xbf}, + // Block 0xf6, offset 0x502 + {value: 0x0013, lo: 0x80, hi: 0x8d}, + {value: 0x0012, lo: 0x8e, hi: 0x94}, + {value: 0x0012, lo: 0x96, hi: 0xa7}, + {value: 0x0013, lo: 0xa8, hi: 0xbf}, + // Block 0xf7, offset 0x506 + {value: 0x0013, lo: 0x80, hi: 0x81}, + {value: 0x0012, lo: 0x82, hi: 0x9b}, + {value: 0x0013, lo: 0x9c, hi: 0x9c}, + {value: 0x0013, lo: 0x9e, hi: 0x9f}, + {value: 0x0013, lo: 0xa2, hi: 0xa2}, + {value: 0x0013, lo: 0xa5, hi: 0xa6}, + {value: 0x0013, lo: 0xa9, hi: 0xac}, + {value: 0x0013, lo: 0xae, hi: 0xb5}, + {value: 0x0012, lo: 0xb6, hi: 0xb9}, + {value: 0x0012, lo: 0xbb, hi: 0xbb}, + {value: 0x0012, lo: 0xbd, hi: 0xbf}, + // Block 0xf8, offset 0x511 + {value: 0x0012, lo: 0x80, hi: 0x83}, + {value: 0x0012, lo: 0x85, hi: 0x8f}, + {value: 0x0013, lo: 0x90, hi: 0xa9}, + {value: 0x0012, lo: 0xaa, hi: 0xbf}, + // Block 0xf9, offset 0x515 + {value: 0x0012, lo: 0x80, hi: 0x83}, + {value: 0x0013, lo: 0x84, hi: 0x85}, + {value: 0x0013, lo: 0x87, hi: 0x8a}, + {value: 0x0013, lo: 0x8d, hi: 0x94}, + {value: 0x0013, lo: 0x96, hi: 0x9c}, + {value: 0x0012, lo: 0x9e, hi: 0xb7}, + {value: 0x0013, lo: 0xb8, hi: 0xb9}, + {value: 0x0013, lo: 0xbb, hi: 0xbe}, + // Block 0xfa, offset 0x51d + {value: 0x0013, lo: 0x80, hi: 0x84}, + {value: 0x0013, lo: 0x86, hi: 0x86}, + {value: 0x0013, lo: 0x8a, hi: 0x90}, + {value: 0x0012, lo: 0x92, hi: 0xab}, + {value: 0x0013, lo: 0xac, hi: 0xbf}, + // Block 0xfb, offset 0x522 + {value: 0x0013, lo: 0x80, hi: 0x85}, + {value: 0x0012, lo: 0x86, hi: 0x9f}, + {value: 0x0013, lo: 0xa0, hi: 0xb9}, + {value: 0x0012, lo: 0xba, hi: 0xbf}, + // Block 0xfc, offset 0x526 + {value: 0x0012, lo: 0x80, hi: 0x93}, + {value: 0x0013, lo: 0x94, hi: 0xad}, + {value: 0x0012, lo: 0xae, hi: 0xbf}, + // Block 0xfd, offset 0x529 + {value: 0x0012, lo: 0x80, hi: 0x87}, + {value: 0x0013, lo: 0x88, hi: 0xa1}, + {value: 0x0012, lo: 0xa2, hi: 0xbb}, + {value: 0x0013, lo: 0xbc, hi: 0xbf}, + // Block 0xfe, offset 0x52d + {value: 0x0013, lo: 0x80, hi: 0x95}, + {value: 0x0012, lo: 0x96, hi: 0xaf}, + {value: 0x0013, lo: 0xb0, hi: 0xbf}, + // Block 0xff, offset 0x530 + {value: 0x0013, lo: 0x80, hi: 0x89}, + {value: 0x0012, lo: 0x8a, hi: 0xa5}, + {value: 0x0013, lo: 0xa8, hi: 0xbf}, + // Block 0x100, offset 0x533 + {value: 0x0013, lo: 0x80, hi: 0x80}, + {value: 0x0012, lo: 0x82, hi: 0x9a}, + {value: 0x0012, lo: 0x9c, hi: 0xa1}, + {value: 0x0013, lo: 0xa2, hi: 0xba}, + {value: 0x0012, lo: 0xbc, hi: 0xbf}, + // Block 0x101, offset 0x538 + {value: 0x0012, lo: 0x80, hi: 0x94}, + {value: 0x0012, lo: 0x96, hi: 0x9b}, + {value: 0x0013, lo: 0x9c, hi: 0xb4}, + {value: 0x0012, lo: 0xb6, hi: 0xbf}, + // Block 0x102, offset 0x53c + {value: 0x0012, lo: 0x80, hi: 0x8e}, + {value: 0x0012, lo: 0x90, hi: 0x95}, + {value: 0x0013, lo: 0x96, hi: 0xae}, + {value: 0x0012, lo: 0xb0, hi: 0xbf}, + // Block 0x103, offset 0x540 + {value: 0x0012, lo: 0x80, hi: 0x88}, + {value: 0x0012, lo: 0x8a, hi: 0x8f}, + {value: 0x0013, lo: 0x90, hi: 0xa8}, + {value: 0x0012, lo: 0xaa, hi: 0xbf}, + // Block 0x104, offset 0x544 + {value: 0x0012, lo: 0x80, hi: 0x82}, + {value: 0x0012, lo: 0x84, hi: 0x89}, + {value: 0x0017, lo: 0x8a, hi: 0x8b}, + {value: 0x0010, lo: 0x8e, hi: 0xbf}, + // Block 0x105, offset 0x548 + {value: 0x0014, lo: 0x80, hi: 0xb6}, + {value: 0x0014, lo: 0xbb, hi: 0xbf}, + // Block 0x106, offset 0x54a + {value: 0x0014, lo: 0x80, hi: 0xac}, + {value: 0x0014, lo: 0xb5, hi: 0xb5}, + // Block 0x107, offset 0x54c + {value: 0x0014, lo: 0x84, hi: 0x84}, + {value: 0x0014, lo: 0x9b, hi: 0x9f}, + {value: 0x0014, lo: 0xa1, hi: 0xaf}, + // Block 0x108, offset 0x54f + {value: 0x0024, lo: 0x80, hi: 0x86}, + {value: 0x0024, lo: 0x88, hi: 0x98}, + {value: 0x0024, lo: 0x9b, hi: 0xa1}, + {value: 0x0024, lo: 0xa3, hi: 0xa4}, + {value: 0x0024, lo: 0xa6, hi: 0xaa}, + // Block 0x109, offset 0x554 + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0034, lo: 0x90, hi: 0x96}, + // Block 0x10a, offset 0x556 + {value: 0xb552, lo: 0x80, hi: 0x81}, + {value: 0xb852, lo: 0x82, hi: 0x83}, + {value: 0x0024, lo: 0x84, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x10b, offset 0x55b + {value: 0x0010, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x9f}, + {value: 0x0010, lo: 0xa1, hi: 0xa2}, + {value: 0x0010, lo: 0xa4, hi: 0xa4}, + {value: 0x0010, lo: 0xa7, hi: 0xa7}, + {value: 0x0010, lo: 0xa9, hi: 0xb2}, + {value: 0x0010, lo: 0xb4, hi: 0xb7}, + {value: 0x0010, lo: 0xb9, hi: 0xb9}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + // Block 0x10c, offset 0x564 + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x8b, hi: 0x9b}, + {value: 0x0010, lo: 0xa1, hi: 0xa3}, + {value: 0x0010, lo: 0xa5, hi: 0xa9}, + {value: 0x0010, lo: 0xab, hi: 0xbb}, + // Block 0x10d, offset 0x569 + {value: 0x0013, lo: 0xb0, hi: 0xbf}, + // Block 0x10e, offset 0x56a + {value: 0x0013, lo: 0x80, hi: 0x89}, + {value: 0x0013, lo: 0x90, hi: 0xa9}, + {value: 0x0013, lo: 0xb0, hi: 0xbf}, + // Block 0x10f, offset 0x56d + {value: 0x0013, lo: 0x80, hi: 0x89}, + // Block 0x110, offset 0x56e + {value: 0x0004, lo: 0xbb, hi: 0xbf}, + // Block 0x111, offset 0x56f + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0014, lo: 0xa0, hi: 0xbf}, + // Block 0x112, offset 0x571 + {value: 0x0014, lo: 0x80, hi: 0xbf}, + // Block 0x113, offset 0x572 + {value: 0x0014, lo: 0x80, hi: 0xaf}, +} + +// Total table size 14177 bytes (13KiB); checksum: F17D40E8 diff --git a/vendor/golang.org/x/text/cases/tables11.0.0.go b/vendor/golang.org/x/text/cases/tables11.0.0.go new file mode 100644 index 00000000..b1106b41 --- /dev/null +++ b/vendor/golang.org/x/text/cases/tables11.0.0.go @@ -0,0 +1,2317 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +//go:build go1.13 && !go1.14 +// +build go1.13,!go1.14 + +package cases + +// UnicodeVersion is the Unicode version from which the tables in this package are derived. +const UnicodeVersion = "11.0.0" + +var xorData string = "" + // Size: 188 bytes + "\x00\x06\x07\x00\x01?\x00\x0f\x03\x00\x0f\x12\x00\x0f\x1f\x00\x0f\x1d" + + "\x00\x01\x13\x00\x0f\x16\x00\x0f\x0b\x00\x0f3\x00\x0f7\x00\x01#\x00\x0f?" + + "\x00\x0e'\x00\x0f/\x00\x0e>\x00\x0f*\x00\x0c&\x00\x0c*\x00\x0c;\x00\x0c9" + + "\x00\x0c%\x00\x01\x08\x00\x03\x0d\x00\x03\x09\x00\x02\x06\x00\x02\x02" + + "\x00\x02\x0c\x00\x01\x00\x00\x01\x03\x00\x01\x01\x00\x01 \x00\x01\x0c" + + "\x00\x01\x10\x00\x03\x10\x00\x036 \x00\x037 \x00\x0b#\x10\x00\x0b 0\x00" + + "\x0b!\x10\x00\x0b!0\x001\x00\x00\x0b(\x04\x00\x03\x04\x1e\x00\x03\x0a" + + "\x00\x02:\x00\x02>\x00\x02,\x00\x02\x00\x00\x02\x10\x00\x01<\x00\x01&" + + "\x00\x01*\x00\x01.\x00\x010\x003 \x00\x01\x18\x00\x01(\x00\x01\x1e\x00" + + "\x01\x22" + +var exceptions string = "" + // Size: 2436 bytes + "\x00\x12\x12μΜΜ\x12\x12ssSSSs\x13\x18i̇i̇\x10\x09II\x13\x1bʼnʼNʼN\x11" + + "\x09sSS\x12\x12dždžDž\x12\x12dždžDŽ\x10\x12DŽDž\x12\x12ljljLj\x12\x12ljljLJ\x10\x12LJLj" + + "\x12\x12njnjNj\x12\x12njnjNJ\x10\x12NJNj\x13\x1bǰJ̌J̌\x12\x12dzdzDz\x12\x12dzdzDZ\x10" + + "\x12DZDz\x13\x18ⱥⱥ\x13\x18ⱦⱦ\x10\x1bⱾⱾ\x10\x1bⱿⱿ\x10\x1bⱯⱯ\x10\x1bⱭⱭ\x10" + + "\x1bⱰⱰ\x10\x1bꞫꞫ\x10\x1bꞬꞬ\x10\x1bꞍꞍ\x10\x1bꞪꞪ\x10\x1bꞮꞮ\x10\x1bⱢⱢ\x10" + + "\x1bꞭꞭ\x10\x1bⱮⱮ\x10\x1bⱤⱤ\x10\x1bꞱꞱ\x10\x1bꞲꞲ\x10\x1bꞰꞰ2\x12ιΙΙ\x166ΐ" + + "Ϊ́Ϊ́\x166ΰΫ́Ϋ́\x12\x12σΣΣ\x12\x12βΒΒ\x12\x12θΘΘ\x12\x12φΦΦ\x12" + + "\x12πΠΠ\x12\x12κΚΚ\x12\x12ρΡΡ\x12\x12εΕΕ\x14$եւԵՒԵւ\x10\x1bᲐა\x10\x1bᲑბ" + + "\x10\x1bᲒგ\x10\x1bᲓდ\x10\x1bᲔე\x10\x1bᲕვ\x10\x1bᲖზ\x10\x1bᲗთ\x10\x1bᲘი" + + "\x10\x1bᲙკ\x10\x1bᲚლ\x10\x1bᲛმ\x10\x1bᲜნ\x10\x1bᲝო\x10\x1bᲞპ\x10\x1bᲟჟ" + + "\x10\x1bᲠრ\x10\x1bᲡს\x10\x1bᲢტ\x10\x1bᲣუ\x10\x1bᲤფ\x10\x1bᲥქ\x10\x1bᲦღ" + + "\x10\x1bᲧყ\x10\x1bᲨშ\x10\x1bᲩჩ\x10\x1bᲪც\x10\x1bᲫძ\x10\x1bᲬწ\x10\x1bᲭჭ" + + "\x10\x1bᲮხ\x10\x1bᲯჯ\x10\x1bᲰჰ\x10\x1bᲱჱ\x10\x1bᲲჲ\x10\x1bᲳჳ\x10\x1bᲴჴ" + + "\x10\x1bᲵჵ\x10\x1bᲶჶ\x10\x1bᲷჷ\x10\x1bᲸჸ\x10\x1bᲹჹ\x10\x1bᲺჺ\x10\x1bᲽჽ" + + "\x10\x1bᲾჾ\x10\x1bᲿჿ\x12\x12вВВ\x12\x12дДД\x12\x12оОО\x12\x12сСС\x12\x12" + + "тТТ\x12\x12тТТ\x12\x12ъЪЪ\x12\x12ѣѢѢ\x13\x1bꙋꙊꙊ\x13\x1bẖH̱H̱\x13\x1bẗ" + + "T̈T̈\x13\x1bẘW̊W̊\x13\x1bẙY̊Y̊\x13\x1baʾAʾAʾ\x13\x1bṡṠṠ\x12\x10ssß\x14" + + "$ὐΥ̓Υ̓\x166ὒΥ̓̀Υ̓̀\x166ὔΥ̓́Υ̓́\x166ὖΥ̓͂Υ̓͂\x15+ἀιἈΙᾈ\x15+ἁιἉΙᾉ" + + "\x15+ἂιἊΙᾊ\x15+ἃιἋΙᾋ\x15+ἄιἌΙᾌ\x15+ἅιἍΙᾍ\x15+ἆιἎΙᾎ\x15+ἇιἏΙᾏ\x15\x1dἀιᾀἈ" + + "Ι\x15\x1dἁιᾁἉΙ\x15\x1dἂιᾂἊΙ\x15\x1dἃιᾃἋΙ\x15\x1dἄιᾄἌΙ\x15\x1dἅιᾅἍΙ\x15" + + "\x1dἆιᾆἎΙ\x15\x1dἇιᾇἏΙ\x15+ἠιἨΙᾘ\x15+ἡιἩΙᾙ\x15+ἢιἪΙᾚ\x15+ἣιἫΙᾛ\x15+ἤιἬΙᾜ" + + "\x15+ἥιἭΙᾝ\x15+ἦιἮΙᾞ\x15+ἧιἯΙᾟ\x15\x1dἠιᾐἨΙ\x15\x1dἡιᾑἩΙ\x15\x1dἢιᾒἪΙ" + + "\x15\x1dἣιᾓἫΙ\x15\x1dἤιᾔἬΙ\x15\x1dἥιᾕἭΙ\x15\x1dἦιᾖἮΙ\x15\x1dἧιᾗἯΙ\x15+ὠι" + + "ὨΙᾨ\x15+ὡιὩΙᾩ\x15+ὢιὪΙᾪ\x15+ὣιὫΙᾫ\x15+ὤιὬΙᾬ\x15+ὥιὭΙᾭ\x15+ὦιὮΙᾮ\x15+ὧι" + + "ὯΙᾯ\x15\x1dὠιᾠὨΙ\x15\x1dὡιᾡὩΙ\x15\x1dὢιᾢὪΙ\x15\x1dὣιᾣὫΙ\x15\x1dὤιᾤὬΙ" + + "\x15\x1dὥιᾥὭΙ\x15\x1dὦιᾦὮΙ\x15\x1dὧιᾧὯΙ\x15-ὰιᾺΙᾺͅ\x14#αιΑΙᾼ\x14$άιΆΙΆͅ" + + "\x14$ᾶΑ͂Α͂\x166ᾶιΑ͂Ιᾼ͂\x14\x1cαιᾳΑΙ\x12\x12ιΙΙ\x15-ὴιῊΙῊͅ\x14#ηιΗΙῌ" + + "\x14$ήιΉΙΉͅ\x14$ῆΗ͂Η͂\x166ῆιΗ͂Ιῌ͂\x14\x1cηιῃΗΙ\x166ῒΪ̀Ϊ̀\x166ΐΙ" + + "̈́Ϊ́\x14$ῖΙ͂Ι͂\x166ῗΪ͂Ϊ͂\x166ῢΫ̀Ϋ̀\x166ΰΫ́Ϋ́\x14$ῤΡ̓Ρ̓" + + "\x14$ῦΥ͂Υ͂\x166ῧΫ͂Ϋ͂\x15-ὼιῺΙῺͅ\x14#ωιΩΙῼ\x14$ώιΏΙΏͅ\x14$ῶΩ͂Ω͂\x16" + + "6ῶιΩ͂Ιῼ͂\x14\x1cωιῳΩΙ\x12\x10ωω\x11\x08kk\x12\x10åå\x12\x10ɫɫ\x12\x10ɽ" + + "ɽ\x10\x12ȺȺ\x10\x12ȾȾ\x12\x10ɑɑ\x12\x10ɱɱ\x12\x10ɐɐ\x12\x10ɒɒ\x12\x10ȿȿ" + + "\x12\x10ɀɀ\x12\x10ɥɥ\x12\x10ɦɦ\x12\x10ɜɜ\x12\x10ɡɡ\x12\x10ɬɬ\x12\x10ɪɪ" + + "\x12\x10ʞʞ\x12\x10ʇʇ\x12\x10ʝʝ\x12\x12ffFFFf\x12\x12fiFIFi\x12\x12flFLFl" + + "\x13\x1bffiFFIFfi\x13\x1bfflFFLFfl\x12\x12stSTSt\x12\x12stSTSt\x14$մնՄՆՄ" + + "ն\x14$մեՄԵՄե\x14$միՄԻՄի\x14$վնՎՆՎն\x14$մխՄԽՄխ" + +// lookup returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *caseTrie) lookup(s []byte) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return caseValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = caseIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *caseTrie) lookupUnsafe(s []byte) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return caseValues[c0] + } + i := caseIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = caseIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = caseIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// lookupString returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *caseTrie) lookupString(s string) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return caseValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = caseIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *caseTrie) lookupStringUnsafe(s string) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return caseValues[c0] + } + i := caseIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = caseIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = caseIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// caseTrie. Total size: 12250 bytes (11.96 KiB). Checksum: 53ff6cb7321675e1. +type caseTrie struct{} + +func newCaseTrie(i int) *caseTrie { + return &caseTrie{} +} + +// lookupValue determines the type of block n and looks up the value for b. +func (t *caseTrie) lookupValue(n uint32, b byte) uint16 { + switch { + case n < 20: + return uint16(caseValues[n<<6+uint32(b)]) + default: + n -= 20 + return uint16(sparse.lookup(n, b)) + } +} + +// caseValues: 22 blocks, 1408 entries, 2816 bytes +// The third block is the zero block. +var caseValues = [1408]uint16{ + // Block 0x0, offset 0x0 + 0x27: 0x0054, + 0x2e: 0x0054, + 0x30: 0x0010, 0x31: 0x0010, 0x32: 0x0010, 0x33: 0x0010, 0x34: 0x0010, 0x35: 0x0010, + 0x36: 0x0010, 0x37: 0x0010, 0x38: 0x0010, 0x39: 0x0010, 0x3a: 0x0054, + // Block 0x1, offset 0x40 + 0x41: 0x2013, 0x42: 0x2013, 0x43: 0x2013, 0x44: 0x2013, 0x45: 0x2013, + 0x46: 0x2013, 0x47: 0x2013, 0x48: 0x2013, 0x49: 0x2013, 0x4a: 0x2013, 0x4b: 0x2013, + 0x4c: 0x2013, 0x4d: 0x2013, 0x4e: 0x2013, 0x4f: 0x2013, 0x50: 0x2013, 0x51: 0x2013, + 0x52: 0x2013, 0x53: 0x2013, 0x54: 0x2013, 0x55: 0x2013, 0x56: 0x2013, 0x57: 0x2013, + 0x58: 0x2013, 0x59: 0x2013, 0x5a: 0x2013, + 0x5e: 0x0004, 0x5f: 0x0010, 0x60: 0x0004, 0x61: 0x2012, 0x62: 0x2012, 0x63: 0x2012, + 0x64: 0x2012, 0x65: 0x2012, 0x66: 0x2012, 0x67: 0x2012, 0x68: 0x2012, 0x69: 0x2012, + 0x6a: 0x2012, 0x6b: 0x2012, 0x6c: 0x2012, 0x6d: 0x2012, 0x6e: 0x2012, 0x6f: 0x2012, + 0x70: 0x2012, 0x71: 0x2012, 0x72: 0x2012, 0x73: 0x2012, 0x74: 0x2012, 0x75: 0x2012, + 0x76: 0x2012, 0x77: 0x2012, 0x78: 0x2012, 0x79: 0x2012, 0x7a: 0x2012, + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc0: 0x0852, 0xc1: 0x0b53, 0xc2: 0x0113, 0xc3: 0x0112, 0xc4: 0x0113, 0xc5: 0x0112, + 0xc6: 0x0b53, 0xc7: 0x0f13, 0xc8: 0x0f12, 0xc9: 0x0e53, 0xca: 0x1153, 0xcb: 0x0713, + 0xcc: 0x0712, 0xcd: 0x0012, 0xce: 0x1453, 0xcf: 0x1753, 0xd0: 0x1a53, 0xd1: 0x0313, + 0xd2: 0x0312, 0xd3: 0x1d53, 0xd4: 0x2053, 0xd5: 0x2352, 0xd6: 0x2653, 0xd7: 0x2653, + 0xd8: 0x0113, 0xd9: 0x0112, 0xda: 0x2952, 0xdb: 0x0012, 0xdc: 0x1d53, 0xdd: 0x2c53, + 0xde: 0x2f52, 0xdf: 0x3253, 0xe0: 0x0113, 0xe1: 0x0112, 0xe2: 0x0113, 0xe3: 0x0112, + 0xe4: 0x0113, 0xe5: 0x0112, 0xe6: 0x3553, 0xe7: 0x0f13, 0xe8: 0x0f12, 0xe9: 0x3853, + 0xea: 0x0012, 0xeb: 0x0012, 0xec: 0x0113, 0xed: 0x0112, 0xee: 0x3553, 0xef: 0x1f13, + 0xf0: 0x1f12, 0xf1: 0x3b53, 0xf2: 0x3e53, 0xf3: 0x0713, 0xf4: 0x0712, 0xf5: 0x0313, + 0xf6: 0x0312, 0xf7: 0x4153, 0xf8: 0x0113, 0xf9: 0x0112, 0xfa: 0x0012, 0xfb: 0x0010, + 0xfc: 0x0113, 0xfd: 0x0112, 0xfe: 0x0012, 0xff: 0x4452, + // Block 0x4, offset 0x100 + 0x100: 0x0010, 0x101: 0x0010, 0x102: 0x0010, 0x103: 0x0010, 0x104: 0x02db, 0x105: 0x0359, + 0x106: 0x03da, 0x107: 0x043b, 0x108: 0x04b9, 0x109: 0x053a, 0x10a: 0x059b, 0x10b: 0x0619, + 0x10c: 0x069a, 0x10d: 0x0313, 0x10e: 0x0312, 0x10f: 0x1f13, 0x110: 0x1f12, 0x111: 0x0313, + 0x112: 0x0312, 0x113: 0x0713, 0x114: 0x0712, 0x115: 0x0313, 0x116: 0x0312, 0x117: 0x0f13, + 0x118: 0x0f12, 0x119: 0x0313, 0x11a: 0x0312, 0x11b: 0x0713, 0x11c: 0x0712, 0x11d: 0x1452, + 0x11e: 0x0113, 0x11f: 0x0112, 0x120: 0x0113, 0x121: 0x0112, 0x122: 0x0113, 0x123: 0x0112, + 0x124: 0x0113, 0x125: 0x0112, 0x126: 0x0113, 0x127: 0x0112, 0x128: 0x0113, 0x129: 0x0112, + 0x12a: 0x0113, 0x12b: 0x0112, 0x12c: 0x0113, 0x12d: 0x0112, 0x12e: 0x0113, 0x12f: 0x0112, + 0x130: 0x06fa, 0x131: 0x07ab, 0x132: 0x0829, 0x133: 0x08aa, 0x134: 0x0113, 0x135: 0x0112, + 0x136: 0x2353, 0x137: 0x4453, 0x138: 0x0113, 0x139: 0x0112, 0x13a: 0x0113, 0x13b: 0x0112, + 0x13c: 0x0113, 0x13d: 0x0112, 0x13e: 0x0113, 0x13f: 0x0112, + // Block 0x5, offset 0x140 + 0x140: 0x0a8a, 0x141: 0x0313, 0x142: 0x0312, 0x143: 0x0853, 0x144: 0x4753, 0x145: 0x4a53, + 0x146: 0x0113, 0x147: 0x0112, 0x148: 0x0113, 0x149: 0x0112, 0x14a: 0x0113, 0x14b: 0x0112, + 0x14c: 0x0113, 0x14d: 0x0112, 0x14e: 0x0113, 0x14f: 0x0112, 0x150: 0x0b0a, 0x151: 0x0b8a, + 0x152: 0x0c0a, 0x153: 0x0b52, 0x154: 0x0b52, 0x155: 0x0012, 0x156: 0x0e52, 0x157: 0x1152, + 0x158: 0x0012, 0x159: 0x1752, 0x15a: 0x0012, 0x15b: 0x1a52, 0x15c: 0x0c8a, 0x15d: 0x0012, + 0x15e: 0x0012, 0x15f: 0x0012, 0x160: 0x1d52, 0x161: 0x0d0a, 0x162: 0x0012, 0x163: 0x2052, + 0x164: 0x0012, 0x165: 0x0d8a, 0x166: 0x0e0a, 0x167: 0x0012, 0x168: 0x2652, 0x169: 0x2652, + 0x16a: 0x0e8a, 0x16b: 0x0f0a, 0x16c: 0x0f8a, 0x16d: 0x0012, 0x16e: 0x0012, 0x16f: 0x1d52, + 0x170: 0x0012, 0x171: 0x100a, 0x172: 0x2c52, 0x173: 0x0012, 0x174: 0x0012, 0x175: 0x3252, + 0x176: 0x0012, 0x177: 0x0012, 0x178: 0x0012, 0x179: 0x0012, 0x17a: 0x0012, 0x17b: 0x0012, + 0x17c: 0x0012, 0x17d: 0x108a, 0x17e: 0x0012, 0x17f: 0x0012, + // Block 0x6, offset 0x180 + 0x180: 0x3552, 0x181: 0x0012, 0x182: 0x0012, 0x183: 0x3852, 0x184: 0x0012, 0x185: 0x0012, + 0x186: 0x0012, 0x187: 0x110a, 0x188: 0x3552, 0x189: 0x4752, 0x18a: 0x3b52, 0x18b: 0x3e52, + 0x18c: 0x4a52, 0x18d: 0x0012, 0x18e: 0x0012, 0x18f: 0x0012, 0x190: 0x0012, 0x191: 0x0012, + 0x192: 0x4152, 0x193: 0x0012, 0x194: 0x0010, 0x195: 0x0012, 0x196: 0x0012, 0x197: 0x0012, + 0x198: 0x0012, 0x199: 0x0012, 0x19a: 0x0012, 0x19b: 0x0012, 0x19c: 0x0012, 0x19d: 0x118a, + 0x19e: 0x120a, 0x19f: 0x0012, 0x1a0: 0x0012, 0x1a1: 0x0012, 0x1a2: 0x0012, 0x1a3: 0x0012, + 0x1a4: 0x0012, 0x1a5: 0x0012, 0x1a6: 0x0012, 0x1a7: 0x0012, 0x1a8: 0x0012, 0x1a9: 0x0012, + 0x1aa: 0x0012, 0x1ab: 0x0012, 0x1ac: 0x0012, 0x1ad: 0x0012, 0x1ae: 0x0012, 0x1af: 0x0012, + 0x1b0: 0x0015, 0x1b1: 0x0015, 0x1b2: 0x0015, 0x1b3: 0x0015, 0x1b4: 0x0015, 0x1b5: 0x0015, + 0x1b6: 0x0015, 0x1b7: 0x0015, 0x1b8: 0x0015, 0x1b9: 0x0014, 0x1ba: 0x0014, 0x1bb: 0x0014, + 0x1bc: 0x0014, 0x1bd: 0x0014, 0x1be: 0x0014, 0x1bf: 0x0014, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x0024, 0x1c1: 0x0024, 0x1c2: 0x0024, 0x1c3: 0x0024, 0x1c4: 0x0024, 0x1c5: 0x128d, + 0x1c6: 0x0024, 0x1c7: 0x0034, 0x1c8: 0x0034, 0x1c9: 0x0034, 0x1ca: 0x0024, 0x1cb: 0x0024, + 0x1cc: 0x0024, 0x1cd: 0x0034, 0x1ce: 0x0034, 0x1cf: 0x0014, 0x1d0: 0x0024, 0x1d1: 0x0024, + 0x1d2: 0x0024, 0x1d3: 0x0034, 0x1d4: 0x0034, 0x1d5: 0x0034, 0x1d6: 0x0034, 0x1d7: 0x0024, + 0x1d8: 0x0034, 0x1d9: 0x0034, 0x1da: 0x0034, 0x1db: 0x0024, 0x1dc: 0x0034, 0x1dd: 0x0034, + 0x1de: 0x0034, 0x1df: 0x0034, 0x1e0: 0x0034, 0x1e1: 0x0034, 0x1e2: 0x0034, 0x1e3: 0x0024, + 0x1e4: 0x0024, 0x1e5: 0x0024, 0x1e6: 0x0024, 0x1e7: 0x0024, 0x1e8: 0x0024, 0x1e9: 0x0024, + 0x1ea: 0x0024, 0x1eb: 0x0024, 0x1ec: 0x0024, 0x1ed: 0x0024, 0x1ee: 0x0024, 0x1ef: 0x0024, + 0x1f0: 0x0113, 0x1f1: 0x0112, 0x1f2: 0x0113, 0x1f3: 0x0112, 0x1f4: 0x0014, 0x1f5: 0x0004, + 0x1f6: 0x0113, 0x1f7: 0x0112, 0x1fa: 0x0015, 0x1fb: 0x4d52, + 0x1fc: 0x5052, 0x1fd: 0x5052, 0x1ff: 0x5353, + // Block 0x8, offset 0x200 + 0x204: 0x0004, 0x205: 0x0004, + 0x206: 0x2a13, 0x207: 0x0054, 0x208: 0x2513, 0x209: 0x2713, 0x20a: 0x2513, + 0x20c: 0x5653, 0x20e: 0x5953, 0x20f: 0x5c53, 0x210: 0x130a, 0x211: 0x2013, + 0x212: 0x2013, 0x213: 0x2013, 0x214: 0x2013, 0x215: 0x2013, 0x216: 0x2013, 0x217: 0x2013, + 0x218: 0x2013, 0x219: 0x2013, 0x21a: 0x2013, 0x21b: 0x2013, 0x21c: 0x2013, 0x21d: 0x2013, + 0x21e: 0x2013, 0x21f: 0x2013, 0x220: 0x5f53, 0x221: 0x5f53, 0x223: 0x5f53, + 0x224: 0x5f53, 0x225: 0x5f53, 0x226: 0x5f53, 0x227: 0x5f53, 0x228: 0x5f53, 0x229: 0x5f53, + 0x22a: 0x5f53, 0x22b: 0x5f53, 0x22c: 0x2a12, 0x22d: 0x2512, 0x22e: 0x2712, 0x22f: 0x2512, + 0x230: 0x144a, 0x231: 0x2012, 0x232: 0x2012, 0x233: 0x2012, 0x234: 0x2012, 0x235: 0x2012, + 0x236: 0x2012, 0x237: 0x2012, 0x238: 0x2012, 0x239: 0x2012, 0x23a: 0x2012, 0x23b: 0x2012, + 0x23c: 0x2012, 0x23d: 0x2012, 0x23e: 0x2012, 0x23f: 0x2012, + // Block 0x9, offset 0x240 + 0x240: 0x5f52, 0x241: 0x5f52, 0x242: 0x158a, 0x243: 0x5f52, 0x244: 0x5f52, 0x245: 0x5f52, + 0x246: 0x5f52, 0x247: 0x5f52, 0x248: 0x5f52, 0x249: 0x5f52, 0x24a: 0x5f52, 0x24b: 0x5f52, + 0x24c: 0x5652, 0x24d: 0x5952, 0x24e: 0x5c52, 0x24f: 0x1813, 0x250: 0x160a, 0x251: 0x168a, + 0x252: 0x0013, 0x253: 0x0013, 0x254: 0x0013, 0x255: 0x170a, 0x256: 0x178a, 0x257: 0x1812, + 0x258: 0x0113, 0x259: 0x0112, 0x25a: 0x0113, 0x25b: 0x0112, 0x25c: 0x0113, 0x25d: 0x0112, + 0x25e: 0x0113, 0x25f: 0x0112, 0x260: 0x0113, 0x261: 0x0112, 0x262: 0x0113, 0x263: 0x0112, + 0x264: 0x0113, 0x265: 0x0112, 0x266: 0x0113, 0x267: 0x0112, 0x268: 0x0113, 0x269: 0x0112, + 0x26a: 0x0113, 0x26b: 0x0112, 0x26c: 0x0113, 0x26d: 0x0112, 0x26e: 0x0113, 0x26f: 0x0112, + 0x270: 0x180a, 0x271: 0x188a, 0x272: 0x0b12, 0x273: 0x5352, 0x274: 0x6253, 0x275: 0x190a, + 0x277: 0x0f13, 0x278: 0x0f12, 0x279: 0x0b13, 0x27a: 0x0113, 0x27b: 0x0112, + 0x27c: 0x0012, 0x27d: 0x4d53, 0x27e: 0x5053, 0x27f: 0x5053, + // Block 0xa, offset 0x280 + 0x280: 0x6852, 0x281: 0x6852, 0x282: 0x6852, 0x283: 0x6852, 0x284: 0x6852, 0x285: 0x6852, + 0x286: 0x6852, 0x287: 0x198a, 0x288: 0x0012, + 0x291: 0x0034, + 0x292: 0x0024, 0x293: 0x0024, 0x294: 0x0024, 0x295: 0x0024, 0x296: 0x0034, 0x297: 0x0024, + 0x298: 0x0024, 0x299: 0x0024, 0x29a: 0x0034, 0x29b: 0x0034, 0x29c: 0x0024, 0x29d: 0x0024, + 0x29e: 0x0024, 0x29f: 0x0024, 0x2a0: 0x0024, 0x2a1: 0x0024, 0x2a2: 0x0034, 0x2a3: 0x0034, + 0x2a4: 0x0034, 0x2a5: 0x0034, 0x2a6: 0x0034, 0x2a7: 0x0034, 0x2a8: 0x0024, 0x2a9: 0x0024, + 0x2aa: 0x0034, 0x2ab: 0x0024, 0x2ac: 0x0024, 0x2ad: 0x0034, 0x2ae: 0x0034, 0x2af: 0x0024, + 0x2b0: 0x0034, 0x2b1: 0x0034, 0x2b2: 0x0034, 0x2b3: 0x0034, 0x2b4: 0x0034, 0x2b5: 0x0034, + 0x2b6: 0x0034, 0x2b7: 0x0034, 0x2b8: 0x0034, 0x2b9: 0x0034, 0x2ba: 0x0034, 0x2bb: 0x0034, + 0x2bc: 0x0034, 0x2bd: 0x0034, 0x2bf: 0x0034, + // Block 0xb, offset 0x2c0 + 0x2c0: 0x7053, 0x2c1: 0x7053, 0x2c2: 0x7053, 0x2c3: 0x7053, 0x2c4: 0x7053, 0x2c5: 0x7053, + 0x2c7: 0x7053, + 0x2cd: 0x7053, 0x2d0: 0x1a6a, 0x2d1: 0x1aea, + 0x2d2: 0x1b6a, 0x2d3: 0x1bea, 0x2d4: 0x1c6a, 0x2d5: 0x1cea, 0x2d6: 0x1d6a, 0x2d7: 0x1dea, + 0x2d8: 0x1e6a, 0x2d9: 0x1eea, 0x2da: 0x1f6a, 0x2db: 0x1fea, 0x2dc: 0x206a, 0x2dd: 0x20ea, + 0x2de: 0x216a, 0x2df: 0x21ea, 0x2e0: 0x226a, 0x2e1: 0x22ea, 0x2e2: 0x236a, 0x2e3: 0x23ea, + 0x2e4: 0x246a, 0x2e5: 0x24ea, 0x2e6: 0x256a, 0x2e7: 0x25ea, 0x2e8: 0x266a, 0x2e9: 0x26ea, + 0x2ea: 0x276a, 0x2eb: 0x27ea, 0x2ec: 0x286a, 0x2ed: 0x28ea, 0x2ee: 0x296a, 0x2ef: 0x29ea, + 0x2f0: 0x2a6a, 0x2f1: 0x2aea, 0x2f2: 0x2b6a, 0x2f3: 0x2bea, 0x2f4: 0x2c6a, 0x2f5: 0x2cea, + 0x2f6: 0x2d6a, 0x2f7: 0x2dea, 0x2f8: 0x2e6a, 0x2f9: 0x2eea, 0x2fa: 0x2f6a, + 0x2fc: 0x0014, 0x2fd: 0x2fea, 0x2fe: 0x306a, 0x2ff: 0x30ea, + // Block 0xc, offset 0x300 + 0x300: 0x0812, 0x301: 0x0812, 0x302: 0x0812, 0x303: 0x0812, 0x304: 0x0812, 0x305: 0x0812, + 0x308: 0x0813, 0x309: 0x0813, 0x30a: 0x0813, 0x30b: 0x0813, + 0x30c: 0x0813, 0x30d: 0x0813, 0x310: 0x3a9a, 0x311: 0x0812, + 0x312: 0x3b7a, 0x313: 0x0812, 0x314: 0x3cba, 0x315: 0x0812, 0x316: 0x3dfa, 0x317: 0x0812, + 0x319: 0x0813, 0x31b: 0x0813, 0x31d: 0x0813, + 0x31f: 0x0813, 0x320: 0x0812, 0x321: 0x0812, 0x322: 0x0812, 0x323: 0x0812, + 0x324: 0x0812, 0x325: 0x0812, 0x326: 0x0812, 0x327: 0x0812, 0x328: 0x0813, 0x329: 0x0813, + 0x32a: 0x0813, 0x32b: 0x0813, 0x32c: 0x0813, 0x32d: 0x0813, 0x32e: 0x0813, 0x32f: 0x0813, + 0x330: 0x8e52, 0x331: 0x8e52, 0x332: 0x9152, 0x333: 0x9152, 0x334: 0x9452, 0x335: 0x9452, + 0x336: 0x9752, 0x337: 0x9752, 0x338: 0x9a52, 0x339: 0x9a52, 0x33a: 0x9d52, 0x33b: 0x9d52, + 0x33c: 0x4d52, 0x33d: 0x4d52, + // Block 0xd, offset 0x340 + 0x340: 0x3f3a, 0x341: 0x402a, 0x342: 0x411a, 0x343: 0x420a, 0x344: 0x42fa, 0x345: 0x43ea, + 0x346: 0x44da, 0x347: 0x45ca, 0x348: 0x46b9, 0x349: 0x47a9, 0x34a: 0x4899, 0x34b: 0x4989, + 0x34c: 0x4a79, 0x34d: 0x4b69, 0x34e: 0x4c59, 0x34f: 0x4d49, 0x350: 0x4e3a, 0x351: 0x4f2a, + 0x352: 0x501a, 0x353: 0x510a, 0x354: 0x51fa, 0x355: 0x52ea, 0x356: 0x53da, 0x357: 0x54ca, + 0x358: 0x55b9, 0x359: 0x56a9, 0x35a: 0x5799, 0x35b: 0x5889, 0x35c: 0x5979, 0x35d: 0x5a69, + 0x35e: 0x5b59, 0x35f: 0x5c49, 0x360: 0x5d3a, 0x361: 0x5e2a, 0x362: 0x5f1a, 0x363: 0x600a, + 0x364: 0x60fa, 0x365: 0x61ea, 0x366: 0x62da, 0x367: 0x63ca, 0x368: 0x64b9, 0x369: 0x65a9, + 0x36a: 0x6699, 0x36b: 0x6789, 0x36c: 0x6879, 0x36d: 0x6969, 0x36e: 0x6a59, 0x36f: 0x6b49, + 0x370: 0x0812, 0x371: 0x0812, 0x372: 0x6c3a, 0x373: 0x6d4a, 0x374: 0x6e1a, + 0x376: 0x6efa, 0x377: 0x6fda, 0x378: 0x0813, 0x379: 0x0813, 0x37a: 0x8e53, 0x37b: 0x8e53, + 0x37c: 0x7119, 0x37d: 0x0004, 0x37e: 0x71ea, 0x37f: 0x0004, + // Block 0xe, offset 0x380 + 0x380: 0x0004, 0x381: 0x0004, 0x382: 0x726a, 0x383: 0x737a, 0x384: 0x744a, + 0x386: 0x752a, 0x387: 0x760a, 0x388: 0x9153, 0x389: 0x9153, 0x38a: 0x9453, 0x38b: 0x9453, + 0x38c: 0x7749, 0x38d: 0x0004, 0x38e: 0x0004, 0x38f: 0x0004, 0x390: 0x0812, 0x391: 0x0812, + 0x392: 0x781a, 0x393: 0x795a, 0x396: 0x7a9a, 0x397: 0x7b7a, + 0x398: 0x0813, 0x399: 0x0813, 0x39a: 0x9753, 0x39b: 0x9753, 0x39d: 0x0004, + 0x39e: 0x0004, 0x39f: 0x0004, 0x3a0: 0x0812, 0x3a1: 0x0812, 0x3a2: 0x7cba, 0x3a3: 0x7dfa, + 0x3a4: 0x7f3a, 0x3a5: 0x0912, 0x3a6: 0x801a, 0x3a7: 0x80fa, 0x3a8: 0x0813, 0x3a9: 0x0813, + 0x3aa: 0x9d53, 0x3ab: 0x9d53, 0x3ac: 0x0913, 0x3ad: 0x0004, 0x3ae: 0x0004, 0x3af: 0x0004, + 0x3b2: 0x823a, 0x3b3: 0x834a, 0x3b4: 0x841a, + 0x3b6: 0x84fa, 0x3b7: 0x85da, 0x3b8: 0x9a53, 0x3b9: 0x9a53, 0x3ba: 0x4d53, 0x3bb: 0x4d53, + 0x3bc: 0x8719, 0x3bd: 0x0004, 0x3be: 0x0004, + // Block 0xf, offset 0x3c0 + 0x3c2: 0x0013, + 0x3c7: 0x0013, 0x3ca: 0x0012, 0x3cb: 0x0013, + 0x3cc: 0x0013, 0x3cd: 0x0013, 0x3ce: 0x0012, 0x3cf: 0x0012, 0x3d0: 0x0013, 0x3d1: 0x0013, + 0x3d2: 0x0013, 0x3d3: 0x0012, 0x3d5: 0x0013, + 0x3d9: 0x0013, 0x3da: 0x0013, 0x3db: 0x0013, 0x3dc: 0x0013, 0x3dd: 0x0013, + 0x3e4: 0x0013, 0x3e6: 0x87eb, 0x3e8: 0x0013, + 0x3ea: 0x884b, 0x3eb: 0x888b, 0x3ec: 0x0013, 0x3ed: 0x0013, 0x3ef: 0x0012, + 0x3f0: 0x0013, 0x3f1: 0x0013, 0x3f2: 0xa053, 0x3f3: 0x0013, 0x3f4: 0x0012, 0x3f5: 0x0010, + 0x3f6: 0x0010, 0x3f7: 0x0010, 0x3f8: 0x0010, 0x3f9: 0x0012, + 0x3fc: 0x0012, 0x3fd: 0x0012, 0x3fe: 0x0013, 0x3ff: 0x0013, + // Block 0x10, offset 0x400 + 0x400: 0x1a13, 0x401: 0x1a13, 0x402: 0x1e13, 0x403: 0x1e13, 0x404: 0x1a13, 0x405: 0x1a13, + 0x406: 0x2613, 0x407: 0x2613, 0x408: 0x2a13, 0x409: 0x2a13, 0x40a: 0x2e13, 0x40b: 0x2e13, + 0x40c: 0x2a13, 0x40d: 0x2a13, 0x40e: 0x2613, 0x40f: 0x2613, 0x410: 0xa352, 0x411: 0xa352, + 0x412: 0xa652, 0x413: 0xa652, 0x414: 0xa952, 0x415: 0xa952, 0x416: 0xa652, 0x417: 0xa652, + 0x418: 0xa352, 0x419: 0xa352, 0x41a: 0x1a12, 0x41b: 0x1a12, 0x41c: 0x1e12, 0x41d: 0x1e12, + 0x41e: 0x1a12, 0x41f: 0x1a12, 0x420: 0x2612, 0x421: 0x2612, 0x422: 0x2a12, 0x423: 0x2a12, + 0x424: 0x2e12, 0x425: 0x2e12, 0x426: 0x2a12, 0x427: 0x2a12, 0x428: 0x2612, 0x429: 0x2612, + // Block 0x11, offset 0x440 + 0x440: 0x6552, 0x441: 0x6552, 0x442: 0x6552, 0x443: 0x6552, 0x444: 0x6552, 0x445: 0x6552, + 0x446: 0x6552, 0x447: 0x6552, 0x448: 0x6552, 0x449: 0x6552, 0x44a: 0x6552, 0x44b: 0x6552, + 0x44c: 0x6552, 0x44d: 0x6552, 0x44e: 0x6552, 0x44f: 0x6552, 0x450: 0xac52, 0x451: 0xac52, + 0x452: 0xac52, 0x453: 0xac52, 0x454: 0xac52, 0x455: 0xac52, 0x456: 0xac52, 0x457: 0xac52, + 0x458: 0xac52, 0x459: 0xac52, 0x45a: 0xac52, 0x45b: 0xac52, 0x45c: 0xac52, 0x45d: 0xac52, + 0x45e: 0xac52, 0x460: 0x0113, 0x461: 0x0112, 0x462: 0x88eb, 0x463: 0x8b53, + 0x464: 0x894b, 0x465: 0x89aa, 0x466: 0x8a0a, 0x467: 0x0f13, 0x468: 0x0f12, 0x469: 0x0313, + 0x46a: 0x0312, 0x46b: 0x0713, 0x46c: 0x0712, 0x46d: 0x8a6b, 0x46e: 0x8acb, 0x46f: 0x8b2b, + 0x470: 0x8b8b, 0x471: 0x0012, 0x472: 0x0113, 0x473: 0x0112, 0x474: 0x0012, 0x475: 0x0313, + 0x476: 0x0312, 0x477: 0x0012, 0x478: 0x0012, 0x479: 0x0012, 0x47a: 0x0012, 0x47b: 0x0012, + 0x47c: 0x0015, 0x47d: 0x0015, 0x47e: 0x8beb, 0x47f: 0x8c4b, + // Block 0x12, offset 0x480 + 0x480: 0x0113, 0x481: 0x0112, 0x482: 0x0113, 0x483: 0x0112, 0x484: 0x0113, 0x485: 0x0112, + 0x486: 0x0113, 0x487: 0x0112, 0x488: 0x0014, 0x489: 0x0014, 0x48a: 0x0014, 0x48b: 0x0713, + 0x48c: 0x0712, 0x48d: 0x8cab, 0x48e: 0x0012, 0x48f: 0x0010, 0x490: 0x0113, 0x491: 0x0112, + 0x492: 0x0113, 0x493: 0x0112, 0x494: 0x0012, 0x495: 0x0012, 0x496: 0x0113, 0x497: 0x0112, + 0x498: 0x0113, 0x499: 0x0112, 0x49a: 0x0113, 0x49b: 0x0112, 0x49c: 0x0113, 0x49d: 0x0112, + 0x49e: 0x0113, 0x49f: 0x0112, 0x4a0: 0x0113, 0x4a1: 0x0112, 0x4a2: 0x0113, 0x4a3: 0x0112, + 0x4a4: 0x0113, 0x4a5: 0x0112, 0x4a6: 0x0113, 0x4a7: 0x0112, 0x4a8: 0x0113, 0x4a9: 0x0112, + 0x4aa: 0x8d0b, 0x4ab: 0x8d6b, 0x4ac: 0x8dcb, 0x4ad: 0x8e2b, 0x4ae: 0x8e8b, 0x4af: 0x0012, + 0x4b0: 0x8eeb, 0x4b1: 0x8f4b, 0x4b2: 0x8fab, 0x4b3: 0xaf53, 0x4b4: 0x0113, 0x4b5: 0x0112, + 0x4b6: 0x0113, 0x4b7: 0x0112, 0x4b8: 0x0113, 0x4b9: 0x0112, + // Block 0x13, offset 0x4c0 + 0x4c0: 0x900a, 0x4c1: 0x908a, 0x4c2: 0x910a, 0x4c3: 0x918a, 0x4c4: 0x923a, 0x4c5: 0x92ea, + 0x4c6: 0x936a, + 0x4d3: 0x93ea, 0x4d4: 0x94ca, 0x4d5: 0x95aa, 0x4d6: 0x968a, 0x4d7: 0x976a, + 0x4dd: 0x0010, + 0x4de: 0x0034, 0x4df: 0x0010, 0x4e0: 0x0010, 0x4e1: 0x0010, 0x4e2: 0x0010, 0x4e3: 0x0010, + 0x4e4: 0x0010, 0x4e5: 0x0010, 0x4e6: 0x0010, 0x4e7: 0x0010, 0x4e8: 0x0010, + 0x4ea: 0x0010, 0x4eb: 0x0010, 0x4ec: 0x0010, 0x4ed: 0x0010, 0x4ee: 0x0010, 0x4ef: 0x0010, + 0x4f0: 0x0010, 0x4f1: 0x0010, 0x4f2: 0x0010, 0x4f3: 0x0010, 0x4f4: 0x0010, 0x4f5: 0x0010, + 0x4f6: 0x0010, 0x4f8: 0x0010, 0x4f9: 0x0010, 0x4fa: 0x0010, 0x4fb: 0x0010, + 0x4fc: 0x0010, 0x4fe: 0x0010, + // Block 0x14, offset 0x500 + 0x500: 0x2213, 0x501: 0x2213, 0x502: 0x2613, 0x503: 0x2613, 0x504: 0x2213, 0x505: 0x2213, + 0x506: 0x2e13, 0x507: 0x2e13, 0x508: 0x2213, 0x509: 0x2213, 0x50a: 0x2613, 0x50b: 0x2613, + 0x50c: 0x2213, 0x50d: 0x2213, 0x50e: 0x3e13, 0x50f: 0x3e13, 0x510: 0x2213, 0x511: 0x2213, + 0x512: 0x2613, 0x513: 0x2613, 0x514: 0x2213, 0x515: 0x2213, 0x516: 0x2e13, 0x517: 0x2e13, + 0x518: 0x2213, 0x519: 0x2213, 0x51a: 0x2613, 0x51b: 0x2613, 0x51c: 0x2213, 0x51d: 0x2213, + 0x51e: 0xb853, 0x51f: 0xb853, 0x520: 0xbb53, 0x521: 0xbb53, 0x522: 0x2212, 0x523: 0x2212, + 0x524: 0x2612, 0x525: 0x2612, 0x526: 0x2212, 0x527: 0x2212, 0x528: 0x2e12, 0x529: 0x2e12, + 0x52a: 0x2212, 0x52b: 0x2212, 0x52c: 0x2612, 0x52d: 0x2612, 0x52e: 0x2212, 0x52f: 0x2212, + 0x530: 0x3e12, 0x531: 0x3e12, 0x532: 0x2212, 0x533: 0x2212, 0x534: 0x2612, 0x535: 0x2612, + 0x536: 0x2212, 0x537: 0x2212, 0x538: 0x2e12, 0x539: 0x2e12, 0x53a: 0x2212, 0x53b: 0x2212, + 0x53c: 0x2612, 0x53d: 0x2612, 0x53e: 0x2212, 0x53f: 0x2212, + // Block 0x15, offset 0x540 + 0x542: 0x0010, + 0x547: 0x0010, 0x549: 0x0010, 0x54b: 0x0010, + 0x54d: 0x0010, 0x54e: 0x0010, 0x54f: 0x0010, 0x551: 0x0010, + 0x552: 0x0010, 0x554: 0x0010, 0x557: 0x0010, + 0x559: 0x0010, 0x55b: 0x0010, 0x55d: 0x0010, + 0x55f: 0x0010, 0x561: 0x0010, 0x562: 0x0010, + 0x564: 0x0010, 0x567: 0x0010, 0x568: 0x0010, 0x569: 0x0010, + 0x56a: 0x0010, 0x56c: 0x0010, 0x56d: 0x0010, 0x56e: 0x0010, 0x56f: 0x0010, + 0x570: 0x0010, 0x571: 0x0010, 0x572: 0x0010, 0x574: 0x0010, 0x575: 0x0010, + 0x576: 0x0010, 0x577: 0x0010, 0x579: 0x0010, 0x57a: 0x0010, 0x57b: 0x0010, + 0x57c: 0x0010, 0x57e: 0x0010, +} + +// caseIndex: 25 blocks, 1600 entries, 3200 bytes +// Block 0 is the zero block. +var caseIndex = [1600]uint16{ + // Block 0x0, offset 0x0 + // Block 0x1, offset 0x40 + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc2: 0x14, 0xc3: 0x15, 0xc4: 0x16, 0xc5: 0x17, 0xc6: 0x01, 0xc7: 0x02, + 0xc8: 0x18, 0xc9: 0x03, 0xca: 0x04, 0xcb: 0x19, 0xcc: 0x1a, 0xcd: 0x05, 0xce: 0x06, 0xcf: 0x07, + 0xd0: 0x1b, 0xd1: 0x1c, 0xd2: 0x1d, 0xd3: 0x1e, 0xd4: 0x1f, 0xd5: 0x20, 0xd6: 0x08, 0xd7: 0x21, + 0xd8: 0x22, 0xd9: 0x23, 0xda: 0x24, 0xdb: 0x25, 0xdc: 0x26, 0xdd: 0x27, 0xde: 0x28, 0xdf: 0x29, + 0xe0: 0x02, 0xe1: 0x03, 0xe2: 0x04, 0xe3: 0x05, + 0xea: 0x06, 0xeb: 0x07, 0xec: 0x07, 0xed: 0x08, 0xef: 0x09, + 0xf0: 0x14, 0xf3: 0x16, + // Block 0x4, offset 0x100 + 0x120: 0x2a, 0x121: 0x2b, 0x122: 0x2c, 0x123: 0x2d, 0x124: 0x2e, 0x125: 0x2f, 0x126: 0x30, 0x127: 0x31, + 0x128: 0x32, 0x129: 0x33, 0x12a: 0x34, 0x12b: 0x35, 0x12c: 0x36, 0x12d: 0x37, 0x12e: 0x38, 0x12f: 0x39, + 0x130: 0x3a, 0x131: 0x3b, 0x132: 0x3c, 0x133: 0x3d, 0x134: 0x3e, 0x135: 0x3f, 0x136: 0x40, 0x137: 0x41, + 0x138: 0x42, 0x139: 0x43, 0x13a: 0x44, 0x13b: 0x45, 0x13c: 0x46, 0x13d: 0x47, 0x13e: 0x48, 0x13f: 0x49, + // Block 0x5, offset 0x140 + 0x140: 0x4a, 0x141: 0x4b, 0x142: 0x4c, 0x143: 0x09, 0x144: 0x24, 0x145: 0x24, 0x146: 0x24, 0x147: 0x24, + 0x148: 0x24, 0x149: 0x4d, 0x14a: 0x4e, 0x14b: 0x4f, 0x14c: 0x50, 0x14d: 0x51, 0x14e: 0x52, 0x14f: 0x53, + 0x150: 0x54, 0x151: 0x24, 0x152: 0x24, 0x153: 0x24, 0x154: 0x24, 0x155: 0x24, 0x156: 0x24, 0x157: 0x24, + 0x158: 0x24, 0x159: 0x55, 0x15a: 0x56, 0x15b: 0x57, 0x15c: 0x58, 0x15d: 0x59, 0x15e: 0x5a, 0x15f: 0x5b, + 0x160: 0x5c, 0x161: 0x5d, 0x162: 0x5e, 0x163: 0x5f, 0x164: 0x60, 0x165: 0x61, 0x167: 0x62, + 0x168: 0x63, 0x169: 0x64, 0x16a: 0x65, 0x16c: 0x66, 0x16d: 0x67, 0x16e: 0x68, 0x16f: 0x69, + 0x170: 0x6a, 0x171: 0x6b, 0x172: 0x6c, 0x173: 0x6d, 0x174: 0x6e, 0x175: 0x6f, 0x176: 0x70, 0x177: 0x71, + 0x178: 0x72, 0x179: 0x72, 0x17a: 0x73, 0x17b: 0x72, 0x17c: 0x74, 0x17d: 0x0a, 0x17e: 0x0b, 0x17f: 0x0c, + // Block 0x6, offset 0x180 + 0x180: 0x75, 0x181: 0x76, 0x182: 0x77, 0x183: 0x78, 0x184: 0x0d, 0x185: 0x79, 0x186: 0x7a, + 0x192: 0x7b, 0x193: 0x0e, + 0x1b0: 0x7c, 0x1b1: 0x0f, 0x1b2: 0x72, 0x1b3: 0x7d, 0x1b4: 0x7e, 0x1b5: 0x7f, 0x1b6: 0x80, 0x1b7: 0x81, + 0x1b8: 0x82, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x83, 0x1c2: 0x84, 0x1c3: 0x85, 0x1c4: 0x86, 0x1c5: 0x24, 0x1c6: 0x87, + // Block 0x8, offset 0x200 + 0x200: 0x88, 0x201: 0x24, 0x202: 0x24, 0x203: 0x24, 0x204: 0x24, 0x205: 0x24, 0x206: 0x24, 0x207: 0x24, + 0x208: 0x24, 0x209: 0x24, 0x20a: 0x24, 0x20b: 0x24, 0x20c: 0x24, 0x20d: 0x24, 0x20e: 0x24, 0x20f: 0x24, + 0x210: 0x24, 0x211: 0x24, 0x212: 0x89, 0x213: 0x8a, 0x214: 0x24, 0x215: 0x24, 0x216: 0x24, 0x217: 0x24, + 0x218: 0x8b, 0x219: 0x8c, 0x21a: 0x8d, 0x21b: 0x8e, 0x21c: 0x8f, 0x21d: 0x90, 0x21e: 0x10, 0x21f: 0x91, + 0x220: 0x92, 0x221: 0x93, 0x222: 0x24, 0x223: 0x94, 0x224: 0x95, 0x225: 0x96, 0x226: 0x97, 0x227: 0x98, + 0x228: 0x99, 0x229: 0x9a, 0x22a: 0x9b, 0x22b: 0x9c, 0x22c: 0x9d, 0x22d: 0x9e, 0x22e: 0x9f, 0x22f: 0xa0, + 0x230: 0x24, 0x231: 0x24, 0x232: 0x24, 0x233: 0x24, 0x234: 0x24, 0x235: 0x24, 0x236: 0x24, 0x237: 0x24, + 0x238: 0x24, 0x239: 0x24, 0x23a: 0x24, 0x23b: 0x24, 0x23c: 0x24, 0x23d: 0x24, 0x23e: 0x24, 0x23f: 0x24, + // Block 0x9, offset 0x240 + 0x240: 0x24, 0x241: 0x24, 0x242: 0x24, 0x243: 0x24, 0x244: 0x24, 0x245: 0x24, 0x246: 0x24, 0x247: 0x24, + 0x248: 0x24, 0x249: 0x24, 0x24a: 0x24, 0x24b: 0x24, 0x24c: 0x24, 0x24d: 0x24, 0x24e: 0x24, 0x24f: 0x24, + 0x250: 0x24, 0x251: 0x24, 0x252: 0x24, 0x253: 0x24, 0x254: 0x24, 0x255: 0x24, 0x256: 0x24, 0x257: 0x24, + 0x258: 0x24, 0x259: 0x24, 0x25a: 0x24, 0x25b: 0x24, 0x25c: 0x24, 0x25d: 0x24, 0x25e: 0x24, 0x25f: 0x24, + 0x260: 0x24, 0x261: 0x24, 0x262: 0x24, 0x263: 0x24, 0x264: 0x24, 0x265: 0x24, 0x266: 0x24, 0x267: 0x24, + 0x268: 0x24, 0x269: 0x24, 0x26a: 0x24, 0x26b: 0x24, 0x26c: 0x24, 0x26d: 0x24, 0x26e: 0x24, 0x26f: 0x24, + 0x270: 0x24, 0x271: 0x24, 0x272: 0x24, 0x273: 0x24, 0x274: 0x24, 0x275: 0x24, 0x276: 0x24, 0x277: 0x24, + 0x278: 0x24, 0x279: 0x24, 0x27a: 0x24, 0x27b: 0x24, 0x27c: 0x24, 0x27d: 0x24, 0x27e: 0x24, 0x27f: 0x24, + // Block 0xa, offset 0x280 + 0x280: 0x24, 0x281: 0x24, 0x282: 0x24, 0x283: 0x24, 0x284: 0x24, 0x285: 0x24, 0x286: 0x24, 0x287: 0x24, + 0x288: 0x24, 0x289: 0x24, 0x28a: 0x24, 0x28b: 0x24, 0x28c: 0x24, 0x28d: 0x24, 0x28e: 0x24, 0x28f: 0x24, + 0x290: 0x24, 0x291: 0x24, 0x292: 0x24, 0x293: 0x24, 0x294: 0x24, 0x295: 0x24, 0x296: 0x24, 0x297: 0x24, + 0x298: 0x24, 0x299: 0x24, 0x29a: 0x24, 0x29b: 0x24, 0x29c: 0x24, 0x29d: 0x24, 0x29e: 0xa1, 0x29f: 0xa2, + // Block 0xb, offset 0x2c0 + 0x2ec: 0x11, 0x2ed: 0xa3, 0x2ee: 0xa4, 0x2ef: 0xa5, + 0x2f0: 0x24, 0x2f1: 0x24, 0x2f2: 0x24, 0x2f3: 0x24, 0x2f4: 0xa6, 0x2f5: 0xa7, 0x2f6: 0xa8, 0x2f7: 0xa9, + 0x2f8: 0xaa, 0x2f9: 0xab, 0x2fa: 0x24, 0x2fb: 0xac, 0x2fc: 0xad, 0x2fd: 0xae, 0x2fe: 0xaf, 0x2ff: 0xb0, + // Block 0xc, offset 0x300 + 0x300: 0xb1, 0x301: 0xb2, 0x302: 0x24, 0x303: 0xb3, 0x305: 0xb4, 0x307: 0xb5, + 0x30a: 0xb6, 0x30b: 0xb7, 0x30c: 0xb8, 0x30d: 0xb9, 0x30e: 0xba, 0x30f: 0xbb, + 0x310: 0xbc, 0x311: 0xbd, 0x312: 0xbe, 0x313: 0xbf, 0x314: 0xc0, 0x315: 0xc1, + 0x318: 0x24, 0x319: 0x24, 0x31a: 0x24, 0x31b: 0x24, 0x31c: 0xc2, 0x31d: 0xc3, + 0x320: 0xc4, 0x321: 0xc5, 0x322: 0xc6, 0x323: 0xc7, 0x324: 0xc8, 0x326: 0xc9, + 0x328: 0xca, 0x329: 0xcb, 0x32a: 0xcc, 0x32b: 0xcd, 0x32c: 0x5f, 0x32d: 0xce, 0x32e: 0xcf, + 0x330: 0x24, 0x331: 0xd0, 0x332: 0xd1, 0x333: 0xd2, 0x334: 0xd3, + 0x33c: 0xd4, 0x33d: 0xd5, + // Block 0xd, offset 0x340 + 0x340: 0xd6, 0x341: 0xd7, 0x342: 0xd8, 0x343: 0xd9, 0x344: 0xda, 0x345: 0xdb, 0x346: 0xdc, 0x347: 0xdd, + 0x348: 0xde, 0x34a: 0xdf, 0x34b: 0xe0, 0x34c: 0xe1, 0x34d: 0xe2, + 0x350: 0xe3, 0x351: 0xe4, 0x352: 0xe5, 0x353: 0xe6, 0x356: 0xe7, 0x357: 0xe8, + 0x358: 0xe9, 0x359: 0xea, 0x35a: 0xeb, 0x35b: 0xec, 0x35c: 0xed, + 0x360: 0xee, 0x362: 0xef, 0x363: 0xf0, + 0x368: 0xf1, 0x369: 0xf2, 0x36a: 0xf3, 0x36b: 0xf4, + 0x370: 0xf5, 0x371: 0xf6, 0x372: 0xf7, 0x374: 0xf8, 0x375: 0xf9, 0x376: 0xfa, + 0x37b: 0xfb, + // Block 0xe, offset 0x380 + 0x380: 0x24, 0x381: 0x24, 0x382: 0x24, 0x383: 0x24, 0x384: 0x24, 0x385: 0x24, 0x386: 0x24, 0x387: 0x24, + 0x388: 0x24, 0x389: 0x24, 0x38a: 0x24, 0x38b: 0x24, 0x38c: 0x24, 0x38d: 0x24, 0x38e: 0xfc, + 0x390: 0x24, 0x391: 0xfd, 0x392: 0x24, 0x393: 0x24, 0x394: 0x24, 0x395: 0xfe, + // Block 0xf, offset 0x3c0 + 0x3c0: 0x24, 0x3c1: 0x24, 0x3c2: 0x24, 0x3c3: 0x24, 0x3c4: 0x24, 0x3c5: 0x24, 0x3c6: 0x24, 0x3c7: 0x24, + 0x3c8: 0x24, 0x3c9: 0x24, 0x3ca: 0x24, 0x3cb: 0x24, 0x3cc: 0x24, 0x3cd: 0x24, 0x3ce: 0x24, 0x3cf: 0x24, + 0x3d0: 0xfd, + // Block 0x10, offset 0x400 + 0x410: 0x24, 0x411: 0x24, 0x412: 0x24, 0x413: 0x24, 0x414: 0x24, 0x415: 0x24, 0x416: 0x24, 0x417: 0x24, + 0x418: 0x24, 0x419: 0xff, + // Block 0x11, offset 0x440 + 0x460: 0x24, 0x461: 0x24, 0x462: 0x24, 0x463: 0x24, 0x464: 0x24, 0x465: 0x24, 0x466: 0x24, 0x467: 0x24, + 0x468: 0xf4, 0x469: 0x100, 0x46b: 0x101, 0x46c: 0x102, 0x46d: 0x103, 0x46e: 0x104, + 0x479: 0x105, 0x47c: 0x24, 0x47d: 0x106, 0x47e: 0x107, 0x47f: 0x108, + // Block 0x12, offset 0x480 + 0x4b0: 0x24, 0x4b1: 0x109, 0x4b2: 0x10a, + // Block 0x13, offset 0x4c0 + 0x4c5: 0x10b, 0x4c6: 0x10c, + 0x4c9: 0x10d, + 0x4d0: 0x10e, 0x4d1: 0x10f, 0x4d2: 0x110, 0x4d3: 0x111, 0x4d4: 0x112, 0x4d5: 0x113, 0x4d6: 0x114, 0x4d7: 0x115, + 0x4d8: 0x116, 0x4d9: 0x117, 0x4da: 0x118, 0x4db: 0x119, 0x4dc: 0x11a, 0x4dd: 0x11b, 0x4de: 0x11c, 0x4df: 0x11d, + 0x4e8: 0x11e, 0x4e9: 0x11f, 0x4ea: 0x120, + // Block 0x14, offset 0x500 + 0x500: 0x121, + 0x520: 0x24, 0x521: 0x24, 0x522: 0x24, 0x523: 0x122, 0x524: 0x12, 0x525: 0x123, + 0x538: 0x124, 0x539: 0x13, 0x53a: 0x125, + // Block 0x15, offset 0x540 + 0x544: 0x126, 0x545: 0x127, 0x546: 0x128, + 0x54f: 0x129, + // Block 0x16, offset 0x580 + 0x590: 0x0a, 0x591: 0x0b, 0x592: 0x0c, 0x593: 0x0d, 0x594: 0x0e, 0x596: 0x0f, + 0x59b: 0x10, 0x59d: 0x11, 0x59e: 0x12, 0x59f: 0x13, + // Block 0x17, offset 0x5c0 + 0x5c0: 0x12a, 0x5c1: 0x12b, 0x5c4: 0x12b, 0x5c5: 0x12b, 0x5c6: 0x12b, 0x5c7: 0x12c, + // Block 0x18, offset 0x600 + 0x620: 0x15, +} + +// sparseOffsets: 282 entries, 564 bytes +var sparseOffsets = []uint16{0x0, 0x9, 0xf, 0x18, 0x24, 0x2e, 0x35, 0x38, 0x3c, 0x3f, 0x43, 0x4d, 0x4f, 0x57, 0x5e, 0x63, 0x71, 0x72, 0x80, 0x8f, 0x99, 0x9c, 0xa3, 0xab, 0xae, 0xb0, 0xbf, 0xc5, 0xd3, 0xde, 0xeb, 0xf6, 0x102, 0x10c, 0x118, 0x123, 0x12f, 0x13b, 0x143, 0x14c, 0x156, 0x161, 0x16d, 0x174, 0x17f, 0x184, 0x18c, 0x18f, 0x194, 0x198, 0x19c, 0x1a3, 0x1ac, 0x1b4, 0x1b5, 0x1be, 0x1c5, 0x1cd, 0x1d3, 0x1d8, 0x1dc, 0x1df, 0x1e1, 0x1e4, 0x1e9, 0x1ea, 0x1ec, 0x1ee, 0x1f0, 0x1f7, 0x1fc, 0x200, 0x209, 0x20c, 0x20f, 0x215, 0x216, 0x221, 0x222, 0x223, 0x228, 0x235, 0x23d, 0x245, 0x24e, 0x257, 0x260, 0x265, 0x268, 0x273, 0x280, 0x282, 0x289, 0x28b, 0x297, 0x298, 0x2a3, 0x2ab, 0x2b3, 0x2b9, 0x2ba, 0x2c8, 0x2cd, 0x2d0, 0x2d5, 0x2d9, 0x2df, 0x2e4, 0x2e7, 0x2ec, 0x2f1, 0x2f2, 0x2f8, 0x2fa, 0x2fb, 0x2fd, 0x2ff, 0x302, 0x303, 0x305, 0x308, 0x30e, 0x312, 0x314, 0x319, 0x320, 0x324, 0x32d, 0x32e, 0x337, 0x33b, 0x340, 0x348, 0x34e, 0x354, 0x35e, 0x363, 0x36c, 0x372, 0x379, 0x37d, 0x385, 0x387, 0x389, 0x38c, 0x38e, 0x390, 0x391, 0x392, 0x394, 0x396, 0x39c, 0x3a1, 0x3a3, 0x3a9, 0x3ac, 0x3ae, 0x3b4, 0x3b9, 0x3bb, 0x3bc, 0x3bd, 0x3be, 0x3c0, 0x3c2, 0x3c4, 0x3c7, 0x3c9, 0x3cc, 0x3d4, 0x3d7, 0x3db, 0x3e3, 0x3e5, 0x3e6, 0x3e7, 0x3e9, 0x3ef, 0x3f1, 0x3f2, 0x3f4, 0x3f6, 0x3f8, 0x405, 0x406, 0x407, 0x40b, 0x40d, 0x40e, 0x40f, 0x410, 0x411, 0x414, 0x417, 0x41d, 0x421, 0x425, 0x42b, 0x42e, 0x435, 0x439, 0x43d, 0x444, 0x44d, 0x453, 0x459, 0x463, 0x46d, 0x46f, 0x477, 0x47d, 0x483, 0x489, 0x48c, 0x492, 0x495, 0x49d, 0x49e, 0x4a5, 0x4a9, 0x4aa, 0x4ad, 0x4b5, 0x4bb, 0x4c2, 0x4c3, 0x4c9, 0x4cc, 0x4d4, 0x4db, 0x4e5, 0x4ed, 0x4f0, 0x4f1, 0x4f2, 0x4f3, 0x4f4, 0x4f6, 0x4f8, 0x4fa, 0x4fe, 0x4ff, 0x501, 0x503, 0x504, 0x505, 0x507, 0x50c, 0x511, 0x515, 0x516, 0x519, 0x51d, 0x528, 0x52c, 0x534, 0x539, 0x53d, 0x540, 0x544, 0x547, 0x54a, 0x54f, 0x553, 0x557, 0x55b, 0x55f, 0x561, 0x563, 0x566, 0x56b, 0x56d, 0x572, 0x57b, 0x580, 0x581, 0x584, 0x585, 0x586, 0x588, 0x589, 0x58a} + +// sparseValues: 1418 entries, 5672 bytes +var sparseValues = [1418]valueRange{ + // Block 0x0, offset 0x0 + {value: 0x0004, lo: 0xa8, hi: 0xa8}, + {value: 0x0012, lo: 0xaa, hi: 0xaa}, + {value: 0x0014, lo: 0xad, hi: 0xad}, + {value: 0x0004, lo: 0xaf, hi: 0xaf}, + {value: 0x0004, lo: 0xb4, hi: 0xb4}, + {value: 0x001a, lo: 0xb5, hi: 0xb5}, + {value: 0x0054, lo: 0xb7, hi: 0xb7}, + {value: 0x0004, lo: 0xb8, hi: 0xb8}, + {value: 0x0012, lo: 0xba, hi: 0xba}, + // Block 0x1, offset 0x9 + {value: 0x2013, lo: 0x80, hi: 0x96}, + {value: 0x2013, lo: 0x98, hi: 0x9e}, + {value: 0x009a, lo: 0x9f, hi: 0x9f}, + {value: 0x2012, lo: 0xa0, hi: 0xb6}, + {value: 0x2012, lo: 0xb8, hi: 0xbe}, + {value: 0x0252, lo: 0xbf, hi: 0xbf}, + // Block 0x2, offset 0xf + {value: 0x0117, lo: 0x80, hi: 0xaf}, + {value: 0x011b, lo: 0xb0, hi: 0xb0}, + {value: 0x019a, lo: 0xb1, hi: 0xb1}, + {value: 0x0117, lo: 0xb2, hi: 0xb7}, + {value: 0x0012, lo: 0xb8, hi: 0xb8}, + {value: 0x0316, lo: 0xb9, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x0316, lo: 0xbd, hi: 0xbe}, + {value: 0x0553, lo: 0xbf, hi: 0xbf}, + // Block 0x3, offset 0x18 + {value: 0x0552, lo: 0x80, hi: 0x80}, + {value: 0x0316, lo: 0x81, hi: 0x82}, + {value: 0x0716, lo: 0x83, hi: 0x84}, + {value: 0x0316, lo: 0x85, hi: 0x86}, + {value: 0x0f16, lo: 0x87, hi: 0x88}, + {value: 0x01da, lo: 0x89, hi: 0x89}, + {value: 0x0117, lo: 0x8a, hi: 0xb7}, + {value: 0x0253, lo: 0xb8, hi: 0xb8}, + {value: 0x0316, lo: 0xb9, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x0316, lo: 0xbd, hi: 0xbe}, + {value: 0x028a, lo: 0xbf, hi: 0xbf}, + // Block 0x4, offset 0x24 + {value: 0x0117, lo: 0x80, hi: 0x9f}, + {value: 0x2f53, lo: 0xa0, hi: 0xa0}, + {value: 0x0012, lo: 0xa1, hi: 0xa1}, + {value: 0x0117, lo: 0xa2, hi: 0xb3}, + {value: 0x0012, lo: 0xb4, hi: 0xb9}, + {value: 0x090b, lo: 0xba, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x2953, lo: 0xbd, hi: 0xbd}, + {value: 0x098b, lo: 0xbe, hi: 0xbe}, + {value: 0x0a0a, lo: 0xbf, hi: 0xbf}, + // Block 0x5, offset 0x2e + {value: 0x0015, lo: 0x80, hi: 0x81}, + {value: 0x0014, lo: 0x82, hi: 0x97}, + {value: 0x0004, lo: 0x98, hi: 0x9d}, + {value: 0x0014, lo: 0x9e, hi: 0x9f}, + {value: 0x0015, lo: 0xa0, hi: 0xa4}, + {value: 0x0004, lo: 0xa5, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xbf}, + // Block 0x6, offset 0x35 + {value: 0x0024, lo: 0x80, hi: 0x94}, + {value: 0x0034, lo: 0x95, hi: 0xbc}, + {value: 0x0024, lo: 0xbd, hi: 0xbf}, + // Block 0x7, offset 0x38 + {value: 0x6553, lo: 0x80, hi: 0x8f}, + {value: 0x2013, lo: 0x90, hi: 0x9f}, + {value: 0x5f53, lo: 0xa0, hi: 0xaf}, + {value: 0x2012, lo: 0xb0, hi: 0xbf}, + // Block 0x8, offset 0x3c + {value: 0x5f52, lo: 0x80, hi: 0x8f}, + {value: 0x6552, lo: 0x90, hi: 0x9f}, + {value: 0x0117, lo: 0xa0, hi: 0xbf}, + // Block 0x9, offset 0x3f + {value: 0x0117, lo: 0x80, hi: 0x81}, + {value: 0x0024, lo: 0x83, hi: 0x87}, + {value: 0x0014, lo: 0x88, hi: 0x89}, + {value: 0x0117, lo: 0x8a, hi: 0xbf}, + // Block 0xa, offset 0x43 + {value: 0x0f13, lo: 0x80, hi: 0x80}, + {value: 0x0316, lo: 0x81, hi: 0x82}, + {value: 0x0716, lo: 0x83, hi: 0x84}, + {value: 0x0316, lo: 0x85, hi: 0x86}, + {value: 0x0f16, lo: 0x87, hi: 0x88}, + {value: 0x0316, lo: 0x89, hi: 0x8a}, + {value: 0x0716, lo: 0x8b, hi: 0x8c}, + {value: 0x0316, lo: 0x8d, hi: 0x8e}, + {value: 0x0f12, lo: 0x8f, hi: 0x8f}, + {value: 0x0117, lo: 0x90, hi: 0xbf}, + // Block 0xb, offset 0x4d + {value: 0x0117, lo: 0x80, hi: 0xaf}, + {value: 0x6553, lo: 0xb1, hi: 0xbf}, + // Block 0xc, offset 0x4f + {value: 0x3013, lo: 0x80, hi: 0x8f}, + {value: 0x6853, lo: 0x90, hi: 0x96}, + {value: 0x0014, lo: 0x99, hi: 0x99}, + {value: 0x0010, lo: 0x9b, hi: 0x9c}, + {value: 0x0010, lo: 0x9e, hi: 0x9e}, + {value: 0x0012, lo: 0xa0, hi: 0xa0}, + {value: 0x6552, lo: 0xa1, hi: 0xaf}, + {value: 0x3012, lo: 0xb0, hi: 0xbf}, + // Block 0xd, offset 0x57 + {value: 0x0034, lo: 0x81, hi: 0x82}, + {value: 0x0024, lo: 0x84, hi: 0x84}, + {value: 0x0034, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0x87, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0xaa}, + {value: 0x0010, lo: 0xaf, hi: 0xb3}, + {value: 0x0054, lo: 0xb4, hi: 0xb4}, + // Block 0xe, offset 0x5e + {value: 0x0014, lo: 0x80, hi: 0x85}, + {value: 0x0024, lo: 0x90, hi: 0x97}, + {value: 0x0034, lo: 0x98, hi: 0x9a}, + {value: 0x0014, lo: 0x9c, hi: 0x9c}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0xf, offset 0x63 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x8a}, + {value: 0x0034, lo: 0x8b, hi: 0x92}, + {value: 0x0024, lo: 0x93, hi: 0x94}, + {value: 0x0034, lo: 0x95, hi: 0x96}, + {value: 0x0024, lo: 0x97, hi: 0x9b}, + {value: 0x0034, lo: 0x9c, hi: 0x9c}, + {value: 0x0024, lo: 0x9d, hi: 0x9e}, + {value: 0x0034, lo: 0x9f, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0x0010, lo: 0xab, hi: 0xab}, + {value: 0x0010, lo: 0xae, hi: 0xaf}, + {value: 0x0034, lo: 0xb0, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xbf}, + // Block 0x10, offset 0x71 + {value: 0x0010, lo: 0x80, hi: 0xbf}, + // Block 0x11, offset 0x72 + {value: 0x0010, lo: 0x80, hi: 0x93}, + {value: 0x0010, lo: 0x95, hi: 0x95}, + {value: 0x0024, lo: 0x96, hi: 0x9c}, + {value: 0x0014, lo: 0x9d, hi: 0x9d}, + {value: 0x0024, lo: 0x9f, hi: 0xa2}, + {value: 0x0034, lo: 0xa3, hi: 0xa3}, + {value: 0x0024, lo: 0xa4, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xa6}, + {value: 0x0024, lo: 0xa7, hi: 0xa8}, + {value: 0x0034, lo: 0xaa, hi: 0xaa}, + {value: 0x0024, lo: 0xab, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xbc}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x12, offset 0x80 + {value: 0x0014, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0034, lo: 0x91, hi: 0x91}, + {value: 0x0010, lo: 0x92, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb0}, + {value: 0x0034, lo: 0xb1, hi: 0xb1}, + {value: 0x0024, lo: 0xb2, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0024, lo: 0xb5, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb9}, + {value: 0x0024, lo: 0xba, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbc}, + {value: 0x0024, lo: 0xbd, hi: 0xbd}, + {value: 0x0034, lo: 0xbe, hi: 0xbe}, + {value: 0x0024, lo: 0xbf, hi: 0xbf}, + // Block 0x13, offset 0x8f + {value: 0x0024, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0024, lo: 0x83, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x84}, + {value: 0x0024, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0024, lo: 0x87, hi: 0x87}, + {value: 0x0034, lo: 0x88, hi: 0x88}, + {value: 0x0024, lo: 0x89, hi: 0x8a}, + {value: 0x0010, lo: 0x8d, hi: 0xbf}, + // Block 0x14, offset 0x99 + {value: 0x0010, lo: 0x80, hi: 0xa5}, + {value: 0x0014, lo: 0xa6, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + // Block 0x15, offset 0x9c + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0024, lo: 0xab, hi: 0xb1}, + {value: 0x0034, lo: 0xb2, hi: 0xb2}, + {value: 0x0024, lo: 0xb3, hi: 0xb3}, + {value: 0x0014, lo: 0xb4, hi: 0xb5}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + {value: 0x0034, lo: 0xbd, hi: 0xbd}, + // Block 0x16, offset 0xa3 + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0024, lo: 0x96, hi: 0x99}, + {value: 0x0014, lo: 0x9a, hi: 0x9a}, + {value: 0x0024, lo: 0x9b, hi: 0xa3}, + {value: 0x0014, lo: 0xa4, hi: 0xa4}, + {value: 0x0024, lo: 0xa5, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa8}, + {value: 0x0024, lo: 0xa9, hi: 0xad}, + // Block 0x17, offset 0xab + {value: 0x0010, lo: 0x80, hi: 0x98}, + {value: 0x0034, lo: 0x99, hi: 0x9b}, + {value: 0x0010, lo: 0xa0, hi: 0xaa}, + // Block 0x18, offset 0xae + {value: 0x0010, lo: 0xa0, hi: 0xb4}, + {value: 0x0010, lo: 0xb6, hi: 0xbd}, + // Block 0x19, offset 0xb0 + {value: 0x0034, lo: 0x93, hi: 0x93}, + {value: 0x0024, lo: 0x94, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa2}, + {value: 0x0034, lo: 0xa3, hi: 0xa3}, + {value: 0x0024, lo: 0xa4, hi: 0xa5}, + {value: 0x0034, lo: 0xa6, hi: 0xa6}, + {value: 0x0024, lo: 0xa7, hi: 0xa8}, + {value: 0x0034, lo: 0xa9, hi: 0xa9}, + {value: 0x0024, lo: 0xaa, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xb2}, + {value: 0x0024, lo: 0xb3, hi: 0xb5}, + {value: 0x0034, lo: 0xb6, hi: 0xb6}, + {value: 0x0024, lo: 0xb7, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0024, lo: 0xbb, hi: 0xbf}, + // Block 0x1a, offset 0xbf + {value: 0x0014, lo: 0x80, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0xb9}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x1b, offset 0xc5 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x88}, + {value: 0x0010, lo: 0x89, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0024, lo: 0x91, hi: 0x91}, + {value: 0x0034, lo: 0x92, hi: 0x92}, + {value: 0x0024, lo: 0x93, hi: 0x94}, + {value: 0x0014, lo: 0x95, hi: 0x97}, + {value: 0x0010, lo: 0x98, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0014, lo: 0xb1, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xbf}, + // Block 0x1c, offset 0xd3 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb2}, + {value: 0x0010, lo: 0xb6, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x1d, offset 0xde + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8e, hi: 0x8e}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0x9c, hi: 0x9d}, + {value: 0x0010, lo: 0x9f, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xb1}, + {value: 0x0010, lo: 0xbc, hi: 0xbc}, + {value: 0x0024, lo: 0xbe, hi: 0xbe}, + // Block 0x1e, offset 0xeb + {value: 0x0014, lo: 0x81, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8a}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb6}, + {value: 0x0010, lo: 0xb8, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x1f, offset 0xf6 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x82}, + {value: 0x0014, lo: 0x87, hi: 0x88}, + {value: 0x0014, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0014, lo: 0x91, hi: 0x91}, + {value: 0x0010, lo: 0x99, hi: 0x9c}, + {value: 0x0010, lo: 0x9e, hi: 0x9e}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb5}, + // Block 0x20, offset 0x102 + {value: 0x0014, lo: 0x81, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8d}, + {value: 0x0010, lo: 0x8f, hi: 0x91}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x21, offset 0x10c + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x85}, + {value: 0x0014, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x89, hi: 0x89}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb9, hi: 0xb9}, + {value: 0x0014, lo: 0xba, hi: 0xbf}, + // Block 0x22, offset 0x118 + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbe}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x23, offset 0x123 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0014, lo: 0x96, hi: 0x96}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0x9c, hi: 0x9d}, + {value: 0x0010, lo: 0x9f, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + // Block 0x24, offset 0x12f + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8a}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0x95}, + {value: 0x0010, lo: 0x99, hi: 0x9a}, + {value: 0x0010, lo: 0x9c, hi: 0x9c}, + {value: 0x0010, lo: 0x9e, hi: 0x9f}, + {value: 0x0010, lo: 0xa3, hi: 0xa4}, + {value: 0x0010, lo: 0xa8, hi: 0xaa}, + {value: 0x0010, lo: 0xae, hi: 0xb9}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x25, offset 0x13b + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x82}, + {value: 0x0010, lo: 0x86, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + // Block 0x26, offset 0x143 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x83}, + {value: 0x0014, lo: 0x84, hi: 0x84}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb9}, + {value: 0x0010, lo: 0xbd, hi: 0xbd}, + {value: 0x0014, lo: 0xbe, hi: 0xbf}, + // Block 0x27, offset 0x14c + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x84}, + {value: 0x0014, lo: 0x86, hi: 0x88}, + {value: 0x0014, lo: 0x8a, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0034, lo: 0x95, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x9a}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + // Block 0x28, offset 0x156 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbe}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x29, offset 0x161 + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0014, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x95, hi: 0x96}, + {value: 0x0010, lo: 0x9e, hi: 0x9e}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb1, hi: 0xb2}, + // Block 0x2a, offset 0x16d + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x2b, offset 0x174 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x86, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8e, hi: 0x8e}, + {value: 0x0010, lo: 0x94, hi: 0x97}, + {value: 0x0010, lo: 0x9f, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xba, hi: 0xbf}, + // Block 0x2c, offset 0x17f + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x96}, + {value: 0x0010, lo: 0x9a, hi: 0xb1}, + {value: 0x0010, lo: 0xb3, hi: 0xbb}, + {value: 0x0010, lo: 0xbd, hi: 0xbd}, + // Block 0x2d, offset 0x184 + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0010, lo: 0x8f, hi: 0x91}, + {value: 0x0014, lo: 0x92, hi: 0x94}, + {value: 0x0014, lo: 0x96, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x9f}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + // Block 0x2e, offset 0x18c + {value: 0x0014, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb4, hi: 0xb7}, + {value: 0x0034, lo: 0xb8, hi: 0xba}, + // Block 0x2f, offset 0x18f + {value: 0x0004, lo: 0x86, hi: 0x86}, + {value: 0x0014, lo: 0x87, hi: 0x87}, + {value: 0x0034, lo: 0x88, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8e}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x30, offset 0x194 + {value: 0x0014, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb4, hi: 0xb7}, + {value: 0x0034, lo: 0xb8, hi: 0xb9}, + {value: 0x0014, lo: 0xbb, hi: 0xbc}, + // Block 0x31, offset 0x198 + {value: 0x0004, lo: 0x86, hi: 0x86}, + {value: 0x0034, lo: 0x88, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x32, offset 0x19c + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0034, lo: 0x98, hi: 0x99}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0x0034, lo: 0xb5, hi: 0xb5}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + {value: 0x0034, lo: 0xb9, hi: 0xb9}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x33, offset 0x1a3 + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0010, lo: 0x89, hi: 0xac}, + {value: 0x0034, lo: 0xb1, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xba, hi: 0xbd}, + {value: 0x0014, lo: 0xbe, hi: 0xbe}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x34, offset 0x1ac + {value: 0x0034, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0024, lo: 0x82, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x84}, + {value: 0x0024, lo: 0x86, hi: 0x87}, + {value: 0x0010, lo: 0x88, hi: 0x8c}, + {value: 0x0014, lo: 0x8d, hi: 0x97}, + {value: 0x0014, lo: 0x99, hi: 0xbc}, + // Block 0x35, offset 0x1b4 + {value: 0x0034, lo: 0x86, hi: 0x86}, + // Block 0x36, offset 0x1b5 + {value: 0x0010, lo: 0xab, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + {value: 0x0010, lo: 0xb8, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbc}, + {value: 0x0014, lo: 0xbd, hi: 0xbe}, + // Block 0x37, offset 0x1be + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x96, hi: 0x97}, + {value: 0x0014, lo: 0x98, hi: 0x99}, + {value: 0x0014, lo: 0x9e, hi: 0xa0}, + {value: 0x0010, lo: 0xa2, hi: 0xa4}, + {value: 0x0010, lo: 0xa7, hi: 0xad}, + {value: 0x0014, lo: 0xb1, hi: 0xb4}, + // Block 0x38, offset 0x1c5 + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x84}, + {value: 0x0014, lo: 0x85, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8f, hi: 0x9c}, + {value: 0x0014, lo: 0x9d, hi: 0x9d}, + {value: 0x6c53, lo: 0xa0, hi: 0xbf}, + // Block 0x39, offset 0x1cd + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x98}, + {value: 0x0010, lo: 0x9a, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x3a, offset 0x1d3 + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb5}, + {value: 0x0010, lo: 0xb8, hi: 0xbe}, + // Block 0x3b, offset 0x1d8 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x82, hi: 0x85}, + {value: 0x0010, lo: 0x88, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0xbf}, + // Block 0x3c, offset 0x1dc + {value: 0x0010, lo: 0x80, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0x95}, + {value: 0x0010, lo: 0x98, hi: 0xbf}, + // Block 0x3d, offset 0x1df + {value: 0x0010, lo: 0x80, hi: 0x9a}, + {value: 0x0024, lo: 0x9d, hi: 0x9f}, + // Block 0x3e, offset 0x1e1 + {value: 0x0010, lo: 0x80, hi: 0x8f}, + {value: 0x7453, lo: 0xa0, hi: 0xaf}, + {value: 0x7853, lo: 0xb0, hi: 0xbf}, + // Block 0x3f, offset 0x1e4 + {value: 0x7c53, lo: 0x80, hi: 0x8f}, + {value: 0x8053, lo: 0x90, hi: 0x9f}, + {value: 0x7c53, lo: 0xa0, hi: 0xaf}, + {value: 0x0813, lo: 0xb0, hi: 0xb5}, + {value: 0x0892, lo: 0xb8, hi: 0xbd}, + // Block 0x40, offset 0x1e9 + {value: 0x0010, lo: 0x81, hi: 0xbf}, + // Block 0x41, offset 0x1ea + {value: 0x0010, lo: 0x80, hi: 0xac}, + {value: 0x0010, lo: 0xaf, hi: 0xbf}, + // Block 0x42, offset 0x1ec + {value: 0x0010, lo: 0x81, hi: 0x9a}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x43, offset 0x1ee + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0010, lo: 0xae, hi: 0xb8}, + // Block 0x44, offset 0x1f0 + {value: 0x0010, lo: 0x80, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x91}, + {value: 0x0014, lo: 0x92, hi: 0x93}, + {value: 0x0034, lo: 0x94, hi: 0x94}, + {value: 0x0010, lo: 0xa0, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + // Block 0x45, offset 0x1f7 + {value: 0x0010, lo: 0x80, hi: 0x91}, + {value: 0x0014, lo: 0x92, hi: 0x93}, + {value: 0x0010, lo: 0xa0, hi: 0xac}, + {value: 0x0010, lo: 0xae, hi: 0xb0}, + {value: 0x0014, lo: 0xb2, hi: 0xb3}, + // Block 0x46, offset 0x1fc + {value: 0x0014, lo: 0xb4, hi: 0xb5}, + {value: 0x0010, lo: 0xb6, hi: 0xb6}, + {value: 0x0014, lo: 0xb7, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x47, offset 0x200 + {value: 0x0010, lo: 0x80, hi: 0x85}, + {value: 0x0014, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0014, lo: 0x89, hi: 0x91}, + {value: 0x0034, lo: 0x92, hi: 0x92}, + {value: 0x0014, lo: 0x93, hi: 0x93}, + {value: 0x0004, lo: 0x97, hi: 0x97}, + {value: 0x0024, lo: 0x9d, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + // Block 0x48, offset 0x209 + {value: 0x0014, lo: 0x8b, hi: 0x8e}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x49, offset 0x20c + {value: 0x0010, lo: 0x80, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0xb8}, + // Block 0x4a, offset 0x20f + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0014, lo: 0x85, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0xa8}, + {value: 0x0034, lo: 0xa9, hi: 0xa9}, + {value: 0x0010, lo: 0xaa, hi: 0xaa}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x4b, offset 0x215 + {value: 0x0010, lo: 0x80, hi: 0xb5}, + // Block 0x4c, offset 0x216 + {value: 0x0010, lo: 0x80, hi: 0x9e}, + {value: 0x0014, lo: 0xa0, hi: 0xa2}, + {value: 0x0010, lo: 0xa3, hi: 0xa6}, + {value: 0x0014, lo: 0xa7, hi: 0xa8}, + {value: 0x0010, lo: 0xa9, hi: 0xab}, + {value: 0x0010, lo: 0xb0, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb2}, + {value: 0x0010, lo: 0xb3, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xb9}, + {value: 0x0024, lo: 0xba, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbb}, + // Block 0x4d, offset 0x221 + {value: 0x0010, lo: 0x86, hi: 0x8f}, + // Block 0x4e, offset 0x222 + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x4f, offset 0x223 + {value: 0x0010, lo: 0x80, hi: 0x96}, + {value: 0x0024, lo: 0x97, hi: 0x97}, + {value: 0x0034, lo: 0x98, hi: 0x98}, + {value: 0x0010, lo: 0x99, hi: 0x9a}, + {value: 0x0014, lo: 0x9b, hi: 0x9b}, + // Block 0x50, offset 0x228 + {value: 0x0010, lo: 0x95, hi: 0x95}, + {value: 0x0014, lo: 0x96, hi: 0x96}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0014, lo: 0x98, hi: 0x9e}, + {value: 0x0034, lo: 0xa0, hi: 0xa0}, + {value: 0x0010, lo: 0xa1, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa2}, + {value: 0x0010, lo: 0xa3, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xac}, + {value: 0x0010, lo: 0xad, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb4}, + {value: 0x0024, lo: 0xb5, hi: 0xbc}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0x51, offset 0x235 + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0004, lo: 0xa7, hi: 0xa7}, + {value: 0x0024, lo: 0xb0, hi: 0xb4}, + {value: 0x0034, lo: 0xb5, hi: 0xba}, + {value: 0x0024, lo: 0xbb, hi: 0xbc}, + {value: 0x0034, lo: 0xbd, hi: 0xbd}, + {value: 0x0014, lo: 0xbe, hi: 0xbe}, + // Block 0x52, offset 0x23d + {value: 0x0014, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x53, offset 0x245 + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0030, lo: 0x84, hi: 0x84}, + {value: 0x0010, lo: 0x85, hi: 0x8b}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0024, lo: 0xab, hi: 0xab}, + {value: 0x0034, lo: 0xac, hi: 0xac}, + {value: 0x0024, lo: 0xad, hi: 0xb3}, + // Block 0x54, offset 0x24e + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa5}, + {value: 0x0010, lo: 0xa6, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa9}, + {value: 0x0030, lo: 0xaa, hi: 0xaa}, + {value: 0x0034, lo: 0xab, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xbf}, + // Block 0x55, offset 0x257 + {value: 0x0010, lo: 0x80, hi: 0xa5}, + {value: 0x0034, lo: 0xa6, hi: 0xa6}, + {value: 0x0010, lo: 0xa7, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa9}, + {value: 0x0010, lo: 0xaa, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xae}, + {value: 0x0014, lo: 0xaf, hi: 0xb1}, + {value: 0x0030, lo: 0xb2, hi: 0xb3}, + // Block 0x56, offset 0x260 + {value: 0x0010, lo: 0x80, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xb3}, + {value: 0x0010, lo: 0xb4, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + // Block 0x57, offset 0x265 + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x8d, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbd}, + // Block 0x58, offset 0x268 + {value: 0x316a, lo: 0x80, hi: 0x80}, + {value: 0x31ea, lo: 0x81, hi: 0x81}, + {value: 0x326a, lo: 0x82, hi: 0x82}, + {value: 0x32ea, lo: 0x83, hi: 0x83}, + {value: 0x336a, lo: 0x84, hi: 0x84}, + {value: 0x33ea, lo: 0x85, hi: 0x85}, + {value: 0x346a, lo: 0x86, hi: 0x86}, + {value: 0x34ea, lo: 0x87, hi: 0x87}, + {value: 0x356a, lo: 0x88, hi: 0x88}, + {value: 0x8353, lo: 0x90, hi: 0xba}, + {value: 0x8353, lo: 0xbd, hi: 0xbf}, + // Block 0x59, offset 0x273 + {value: 0x0024, lo: 0x90, hi: 0x92}, + {value: 0x0034, lo: 0x94, hi: 0x99}, + {value: 0x0024, lo: 0x9a, hi: 0x9b}, + {value: 0x0034, lo: 0x9c, hi: 0x9f}, + {value: 0x0024, lo: 0xa0, hi: 0xa0}, + {value: 0x0010, lo: 0xa1, hi: 0xa1}, + {value: 0x0034, lo: 0xa2, hi: 0xa8}, + {value: 0x0010, lo: 0xa9, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xb3}, + {value: 0x0024, lo: 0xb4, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb7}, + {value: 0x0024, lo: 0xb8, hi: 0xb9}, + // Block 0x5a, offset 0x280 + {value: 0x0012, lo: 0x80, hi: 0xab}, + {value: 0x0015, lo: 0xac, hi: 0xbf}, + // Block 0x5b, offset 0x282 + {value: 0x0015, lo: 0x80, hi: 0xaa}, + {value: 0x0012, lo: 0xab, hi: 0xb7}, + {value: 0x0015, lo: 0xb8, hi: 0xb8}, + {value: 0x8752, lo: 0xb9, hi: 0xb9}, + {value: 0x0012, lo: 0xba, hi: 0xbc}, + {value: 0x8b52, lo: 0xbd, hi: 0xbd}, + {value: 0x0012, lo: 0xbe, hi: 0xbf}, + // Block 0x5c, offset 0x289 + {value: 0x0012, lo: 0x80, hi: 0x9a}, + {value: 0x0015, lo: 0x9b, hi: 0xbf}, + // Block 0x5d, offset 0x28b + {value: 0x0024, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0024, lo: 0x83, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0024, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x90}, + {value: 0x0024, lo: 0x91, hi: 0xb5}, + {value: 0x0034, lo: 0xb6, hi: 0xb9}, + {value: 0x0024, lo: 0xbb, hi: 0xbb}, + {value: 0x0034, lo: 0xbc, hi: 0xbd}, + {value: 0x0024, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0x5e, offset 0x297 + {value: 0x0117, lo: 0x80, hi: 0xbf}, + // Block 0x5f, offset 0x298 + {value: 0x0117, lo: 0x80, hi: 0x95}, + {value: 0x361a, lo: 0x96, hi: 0x96}, + {value: 0x36ca, lo: 0x97, hi: 0x97}, + {value: 0x377a, lo: 0x98, hi: 0x98}, + {value: 0x382a, lo: 0x99, hi: 0x99}, + {value: 0x38da, lo: 0x9a, hi: 0x9a}, + {value: 0x398a, lo: 0x9b, hi: 0x9b}, + {value: 0x0012, lo: 0x9c, hi: 0x9d}, + {value: 0x3a3b, lo: 0x9e, hi: 0x9e}, + {value: 0x0012, lo: 0x9f, hi: 0x9f}, + {value: 0x0117, lo: 0xa0, hi: 0xbf}, + // Block 0x60, offset 0x2a3 + {value: 0x0812, lo: 0x80, hi: 0x87}, + {value: 0x0813, lo: 0x88, hi: 0x8f}, + {value: 0x0812, lo: 0x90, hi: 0x95}, + {value: 0x0813, lo: 0x98, hi: 0x9d}, + {value: 0x0812, lo: 0xa0, hi: 0xa7}, + {value: 0x0813, lo: 0xa8, hi: 0xaf}, + {value: 0x0812, lo: 0xb0, hi: 0xb7}, + {value: 0x0813, lo: 0xb8, hi: 0xbf}, + // Block 0x61, offset 0x2ab + {value: 0x0004, lo: 0x8b, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8f}, + {value: 0x0054, lo: 0x98, hi: 0x99}, + {value: 0x0054, lo: 0xa4, hi: 0xa4}, + {value: 0x0054, lo: 0xa7, hi: 0xa7}, + {value: 0x0014, lo: 0xaa, hi: 0xae}, + {value: 0x0010, lo: 0xaf, hi: 0xaf}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x62, offset 0x2b3 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x94, hi: 0x94}, + {value: 0x0014, lo: 0xa0, hi: 0xa4}, + {value: 0x0014, lo: 0xa6, hi: 0xaf}, + {value: 0x0015, lo: 0xb1, hi: 0xb1}, + {value: 0x0015, lo: 0xbf, hi: 0xbf}, + // Block 0x63, offset 0x2b9 + {value: 0x0015, lo: 0x90, hi: 0x9c}, + // Block 0x64, offset 0x2ba + {value: 0x0024, lo: 0x90, hi: 0x91}, + {value: 0x0034, lo: 0x92, hi: 0x93}, + {value: 0x0024, lo: 0x94, hi: 0x97}, + {value: 0x0034, lo: 0x98, hi: 0x9a}, + {value: 0x0024, lo: 0x9b, hi: 0x9c}, + {value: 0x0014, lo: 0x9d, hi: 0xa0}, + {value: 0x0024, lo: 0xa1, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa4}, + {value: 0x0034, lo: 0xa5, hi: 0xa6}, + {value: 0x0024, lo: 0xa7, hi: 0xa7}, + {value: 0x0034, lo: 0xa8, hi: 0xa8}, + {value: 0x0024, lo: 0xa9, hi: 0xa9}, + {value: 0x0034, lo: 0xaa, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb0}, + // Block 0x65, offset 0x2c8 + {value: 0x0016, lo: 0x85, hi: 0x86}, + {value: 0x0012, lo: 0x87, hi: 0x89}, + {value: 0xa052, lo: 0x8e, hi: 0x8e}, + {value: 0x1013, lo: 0xa0, hi: 0xaf}, + {value: 0x1012, lo: 0xb0, hi: 0xbf}, + // Block 0x66, offset 0x2cd + {value: 0x0010, lo: 0x80, hi: 0x82}, + {value: 0x0716, lo: 0x83, hi: 0x84}, + {value: 0x0010, lo: 0x85, hi: 0x88}, + // Block 0x67, offset 0x2d0 + {value: 0xa353, lo: 0xb6, hi: 0xb7}, + {value: 0xa653, lo: 0xb8, hi: 0xb9}, + {value: 0xa953, lo: 0xba, hi: 0xbb}, + {value: 0xa653, lo: 0xbc, hi: 0xbd}, + {value: 0xa353, lo: 0xbe, hi: 0xbf}, + // Block 0x68, offset 0x2d5 + {value: 0x3013, lo: 0x80, hi: 0x8f}, + {value: 0x6553, lo: 0x90, hi: 0x9f}, + {value: 0xac53, lo: 0xa0, hi: 0xae}, + {value: 0x3012, lo: 0xb0, hi: 0xbf}, + // Block 0x69, offset 0x2d9 + {value: 0x0117, lo: 0x80, hi: 0xa3}, + {value: 0x0012, lo: 0xa4, hi: 0xa4}, + {value: 0x0716, lo: 0xab, hi: 0xac}, + {value: 0x0316, lo: 0xad, hi: 0xae}, + {value: 0x0024, lo: 0xaf, hi: 0xb1}, + {value: 0x0117, lo: 0xb2, hi: 0xb3}, + // Block 0x6a, offset 0x2df + {value: 0x6c52, lo: 0x80, hi: 0x9f}, + {value: 0x7052, lo: 0xa0, hi: 0xa5}, + {value: 0x7052, lo: 0xa7, hi: 0xa7}, + {value: 0x7052, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x6b, offset 0x2e4 + {value: 0x0010, lo: 0x80, hi: 0xa7}, + {value: 0x0014, lo: 0xaf, hi: 0xaf}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0x6c, offset 0x2e7 + {value: 0x0010, lo: 0x80, hi: 0x96}, + {value: 0x0010, lo: 0xa0, hi: 0xa6}, + {value: 0x0010, lo: 0xa8, hi: 0xae}, + {value: 0x0010, lo: 0xb0, hi: 0xb6}, + {value: 0x0010, lo: 0xb8, hi: 0xbe}, + // Block 0x6d, offset 0x2ec + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x88, hi: 0x8e}, + {value: 0x0010, lo: 0x90, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x9e}, + {value: 0x0024, lo: 0xa0, hi: 0xbf}, + // Block 0x6e, offset 0x2f1 + {value: 0x0014, lo: 0xaf, hi: 0xaf}, + // Block 0x6f, offset 0x2f2 + {value: 0x0014, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0xaa, hi: 0xad}, + {value: 0x0030, lo: 0xae, hi: 0xaf}, + {value: 0x0004, lo: 0xb1, hi: 0xb5}, + {value: 0x0014, lo: 0xbb, hi: 0xbb}, + {value: 0x0010, lo: 0xbc, hi: 0xbc}, + // Block 0x70, offset 0x2f8 + {value: 0x0034, lo: 0x99, hi: 0x9a}, + {value: 0x0004, lo: 0x9b, hi: 0x9e}, + // Block 0x71, offset 0x2fa + {value: 0x0004, lo: 0xbc, hi: 0xbe}, + // Block 0x72, offset 0x2fb + {value: 0x0010, lo: 0x85, hi: 0xaf}, + {value: 0x0010, lo: 0xb1, hi: 0xbf}, + // Block 0x73, offset 0x2fd + {value: 0x0010, lo: 0x80, hi: 0x8e}, + {value: 0x0010, lo: 0xa0, hi: 0xba}, + // Block 0x74, offset 0x2ff + {value: 0x0010, lo: 0x80, hi: 0x94}, + {value: 0x0014, lo: 0x95, hi: 0x95}, + {value: 0x0010, lo: 0x96, hi: 0xbf}, + // Block 0x75, offset 0x302 + {value: 0x0010, lo: 0x80, hi: 0x8c}, + // Block 0x76, offset 0x303 + {value: 0x0010, lo: 0x90, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbd}, + // Block 0x77, offset 0x305 + {value: 0x0010, lo: 0x80, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0010, lo: 0x90, hi: 0xab}, + // Block 0x78, offset 0x308 + {value: 0x0117, lo: 0x80, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xae}, + {value: 0x0024, lo: 0xaf, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb2}, + {value: 0x0024, lo: 0xb4, hi: 0xbd}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x79, offset 0x30e + {value: 0x0117, lo: 0x80, hi: 0x9b}, + {value: 0x0015, lo: 0x9c, hi: 0x9d}, + {value: 0x0024, lo: 0x9e, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x7a, offset 0x312 + {value: 0x0010, lo: 0x80, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb1}, + // Block 0x7b, offset 0x314 + {value: 0x0004, lo: 0x80, hi: 0x96}, + {value: 0x0014, lo: 0x97, hi: 0xa1}, + {value: 0x0117, lo: 0xa2, hi: 0xaf}, + {value: 0x0012, lo: 0xb0, hi: 0xb1}, + {value: 0x0117, lo: 0xb2, hi: 0xbf}, + // Block 0x7c, offset 0x319 + {value: 0x0117, lo: 0x80, hi: 0xaf}, + {value: 0x0015, lo: 0xb0, hi: 0xb0}, + {value: 0x0012, lo: 0xb1, hi: 0xb8}, + {value: 0x0316, lo: 0xb9, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x8753, lo: 0xbd, hi: 0xbd}, + {value: 0x0117, lo: 0xbe, hi: 0xbf}, + // Block 0x7d, offset 0x320 + {value: 0x0010, lo: 0xb7, hi: 0xb7}, + {value: 0x0015, lo: 0xb8, hi: 0xb9}, + {value: 0x0012, lo: 0xba, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbf}, + // Block 0x7e, offset 0x324 + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x8a}, + {value: 0x0014, lo: 0x8b, hi: 0x8b}, + {value: 0x0010, lo: 0x8c, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xa6}, + {value: 0x0010, lo: 0xa7, hi: 0xa7}, + // Block 0x7f, offset 0x32d + {value: 0x0010, lo: 0x80, hi: 0xb3}, + // Block 0x80, offset 0x32e + {value: 0x0010, lo: 0x80, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x84}, + {value: 0x0014, lo: 0x85, hi: 0x85}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0024, lo: 0xa0, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xb7}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0010, lo: 0xbd, hi: 0xbe}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x81, offset 0x337 + {value: 0x0010, lo: 0x80, hi: 0xa5}, + {value: 0x0014, lo: 0xa6, hi: 0xaa}, + {value: 0x0034, lo: 0xab, hi: 0xad}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x82, offset 0x33b + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0014, lo: 0x87, hi: 0x91}, + {value: 0x0010, lo: 0x92, hi: 0x92}, + {value: 0x0030, lo: 0x93, hi: 0x93}, + {value: 0x0010, lo: 0xa0, hi: 0xbc}, + // Block 0x83, offset 0x340 + {value: 0x0014, lo: 0x80, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0xb2}, + {value: 0x0034, lo: 0xb3, hi: 0xb3}, + {value: 0x0010, lo: 0xb4, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xb9}, + {value: 0x0010, lo: 0xba, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x84, offset 0x348 + {value: 0x0030, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0014, lo: 0xa5, hi: 0xa5}, + {value: 0x0004, lo: 0xa6, hi: 0xa6}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0x85, offset 0x34e + {value: 0x0010, lo: 0x80, hi: 0xa8}, + {value: 0x0014, lo: 0xa9, hi: 0xae}, + {value: 0x0010, lo: 0xaf, hi: 0xb0}, + {value: 0x0014, lo: 0xb1, hi: 0xb2}, + {value: 0x0010, lo: 0xb3, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb6}, + // Block 0x86, offset 0x354 + {value: 0x0010, lo: 0x80, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0010, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0004, lo: 0xb0, hi: 0xb0}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbd}, + // Block 0x87, offset 0x35e + {value: 0x0024, lo: 0xb0, hi: 0xb0}, + {value: 0x0024, lo: 0xb2, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0024, lo: 0xb7, hi: 0xb8}, + {value: 0x0024, lo: 0xbe, hi: 0xbf}, + // Block 0x88, offset 0x363 + {value: 0x0024, lo: 0x81, hi: 0x81}, + {value: 0x0004, lo: 0x9d, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xaf}, + {value: 0x0010, lo: 0xb2, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb5}, + {value: 0x0034, lo: 0xb6, hi: 0xb6}, + // Block 0x89, offset 0x36c + {value: 0x0010, lo: 0x81, hi: 0x86}, + {value: 0x0010, lo: 0x89, hi: 0x8e}, + {value: 0x0010, lo: 0x91, hi: 0x96}, + {value: 0x0010, lo: 0xa0, hi: 0xa6}, + {value: 0x0010, lo: 0xa8, hi: 0xae}, + {value: 0x0012, lo: 0xb0, hi: 0xbf}, + // Block 0x8a, offset 0x372 + {value: 0x0012, lo: 0x80, hi: 0x92}, + {value: 0xaf52, lo: 0x93, hi: 0x93}, + {value: 0x0012, lo: 0x94, hi: 0x9a}, + {value: 0x0014, lo: 0x9b, hi: 0x9b}, + {value: 0x0015, lo: 0x9c, hi: 0x9f}, + {value: 0x0012, lo: 0xa0, hi: 0xa5}, + {value: 0x74d2, lo: 0xb0, hi: 0xbf}, + // Block 0x8b, offset 0x379 + {value: 0x78d2, lo: 0x80, hi: 0x8f}, + {value: 0x7cd2, lo: 0x90, hi: 0x9f}, + {value: 0x80d2, lo: 0xa0, hi: 0xaf}, + {value: 0x7cd2, lo: 0xb0, hi: 0xbf}, + // Block 0x8c, offset 0x37d + {value: 0x0010, lo: 0x80, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xa5}, + {value: 0x0010, lo: 0xa6, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa8}, + {value: 0x0010, lo: 0xa9, hi: 0xaa}, + {value: 0x0010, lo: 0xac, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0x8d, offset 0x385 + {value: 0x0010, lo: 0x80, hi: 0xa3}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x8e, offset 0x387 + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x8b, hi: 0xbb}, + // Block 0x8f, offset 0x389 + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x83, hi: 0x84}, + {value: 0x0010, lo: 0x86, hi: 0xbf}, + // Block 0x90, offset 0x38c + {value: 0x0010, lo: 0x80, hi: 0xb1}, + {value: 0x0004, lo: 0xb2, hi: 0xbf}, + // Block 0x91, offset 0x38e + {value: 0x0004, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x93, hi: 0xbf}, + // Block 0x92, offset 0x390 + {value: 0x0010, lo: 0x80, hi: 0xbd}, + // Block 0x93, offset 0x391 + {value: 0x0010, lo: 0x90, hi: 0xbf}, + // Block 0x94, offset 0x392 + {value: 0x0010, lo: 0x80, hi: 0x8f}, + {value: 0x0010, lo: 0x92, hi: 0xbf}, + // Block 0x95, offset 0x394 + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0010, lo: 0xb0, hi: 0xbb}, + // Block 0x96, offset 0x396 + {value: 0x0014, lo: 0x80, hi: 0x8f}, + {value: 0x0054, lo: 0x93, hi: 0x93}, + {value: 0x0024, lo: 0xa0, hi: 0xa6}, + {value: 0x0034, lo: 0xa7, hi: 0xad}, + {value: 0x0024, lo: 0xae, hi: 0xaf}, + {value: 0x0010, lo: 0xb3, hi: 0xb4}, + // Block 0x97, offset 0x39c + {value: 0x0010, lo: 0x8d, hi: 0x8f}, + {value: 0x0054, lo: 0x92, hi: 0x92}, + {value: 0x0054, lo: 0x95, hi: 0x95}, + {value: 0x0010, lo: 0xb0, hi: 0xb4}, + {value: 0x0010, lo: 0xb6, hi: 0xbf}, + // Block 0x98, offset 0x3a1 + {value: 0x0010, lo: 0x80, hi: 0xbc}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x99, offset 0x3a3 + {value: 0x0054, lo: 0x87, hi: 0x87}, + {value: 0x0054, lo: 0x8e, hi: 0x8e}, + {value: 0x0054, lo: 0x9a, hi: 0x9a}, + {value: 0x5f53, lo: 0xa1, hi: 0xba}, + {value: 0x0004, lo: 0xbe, hi: 0xbe}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x9a, offset 0x3a9 + {value: 0x0004, lo: 0x80, hi: 0x80}, + {value: 0x5f52, lo: 0x81, hi: 0x9a}, + {value: 0x0004, lo: 0xb0, hi: 0xb0}, + // Block 0x9b, offset 0x3ac + {value: 0x0014, lo: 0x9e, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xbe}, + // Block 0x9c, offset 0x3ae + {value: 0x0010, lo: 0x82, hi: 0x87}, + {value: 0x0010, lo: 0x8a, hi: 0x8f}, + {value: 0x0010, lo: 0x92, hi: 0x97}, + {value: 0x0010, lo: 0x9a, hi: 0x9c}, + {value: 0x0004, lo: 0xa3, hi: 0xa3}, + {value: 0x0014, lo: 0xb9, hi: 0xbb}, + // Block 0x9d, offset 0x3b4 + {value: 0x0010, lo: 0x80, hi: 0x8b}, + {value: 0x0010, lo: 0x8d, hi: 0xa6}, + {value: 0x0010, lo: 0xa8, hi: 0xba}, + {value: 0x0010, lo: 0xbc, hi: 0xbd}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x9e, offset 0x3b9 + {value: 0x0010, lo: 0x80, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x9d}, + // Block 0x9f, offset 0x3bb + {value: 0x0010, lo: 0x80, hi: 0xba}, + // Block 0xa0, offset 0x3bc + {value: 0x0010, lo: 0x80, hi: 0xb4}, + // Block 0xa1, offset 0x3bd + {value: 0x0034, lo: 0xbd, hi: 0xbd}, + // Block 0xa2, offset 0x3be + {value: 0x0010, lo: 0x80, hi: 0x9c}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0xa3, offset 0x3c0 + {value: 0x0010, lo: 0x80, hi: 0x90}, + {value: 0x0034, lo: 0xa0, hi: 0xa0}, + // Block 0xa4, offset 0x3c2 + {value: 0x0010, lo: 0x80, hi: 0x9f}, + {value: 0x0010, lo: 0xad, hi: 0xbf}, + // Block 0xa5, offset 0x3c4 + {value: 0x0010, lo: 0x80, hi: 0x8a}, + {value: 0x0010, lo: 0x90, hi: 0xb5}, + {value: 0x0024, lo: 0xb6, hi: 0xba}, + // Block 0xa6, offset 0x3c7 + {value: 0x0010, lo: 0x80, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0xa7, offset 0x3c9 + {value: 0x0010, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x88, hi: 0x8f}, + {value: 0x0010, lo: 0x91, hi: 0x95}, + // Block 0xa8, offset 0x3cc + {value: 0x2813, lo: 0x80, hi: 0x87}, + {value: 0x3813, lo: 0x88, hi: 0x8f}, + {value: 0x2813, lo: 0x90, hi: 0x97}, + {value: 0xb253, lo: 0x98, hi: 0x9f}, + {value: 0xb553, lo: 0xa0, hi: 0xa7}, + {value: 0x2812, lo: 0xa8, hi: 0xaf}, + {value: 0x3812, lo: 0xb0, hi: 0xb7}, + {value: 0x2812, lo: 0xb8, hi: 0xbf}, + // Block 0xa9, offset 0x3d4 + {value: 0xb252, lo: 0x80, hi: 0x87}, + {value: 0xb552, lo: 0x88, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0xbf}, + // Block 0xaa, offset 0x3d7 + {value: 0x0010, lo: 0x80, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0xb553, lo: 0xb0, hi: 0xb7}, + {value: 0xb253, lo: 0xb8, hi: 0xbf}, + // Block 0xab, offset 0x3db + {value: 0x2813, lo: 0x80, hi: 0x87}, + {value: 0x3813, lo: 0x88, hi: 0x8f}, + {value: 0x2813, lo: 0x90, hi: 0x93}, + {value: 0xb552, lo: 0x98, hi: 0x9f}, + {value: 0xb252, lo: 0xa0, hi: 0xa7}, + {value: 0x2812, lo: 0xa8, hi: 0xaf}, + {value: 0x3812, lo: 0xb0, hi: 0xb7}, + {value: 0x2812, lo: 0xb8, hi: 0xbb}, + // Block 0xac, offset 0x3e3 + {value: 0x0010, lo: 0x80, hi: 0xa7}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0xad, offset 0x3e5 + {value: 0x0010, lo: 0x80, hi: 0xa3}, + // Block 0xae, offset 0x3e6 + {value: 0x0010, lo: 0x80, hi: 0xb6}, + // Block 0xaf, offset 0x3e7 + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xa7}, + // Block 0xb0, offset 0x3e9 + {value: 0x0010, lo: 0x80, hi: 0x85}, + {value: 0x0010, lo: 0x88, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0xb5}, + {value: 0x0010, lo: 0xb7, hi: 0xb8}, + {value: 0x0010, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xb1, offset 0x3ef + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xb6}, + // Block 0xb2, offset 0x3f1 + {value: 0x0010, lo: 0x80, hi: 0x9e}, + // Block 0xb3, offset 0x3f2 + {value: 0x0010, lo: 0xa0, hi: 0xb2}, + {value: 0x0010, lo: 0xb4, hi: 0xb5}, + // Block 0xb4, offset 0x3f4 + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xb9}, + // Block 0xb5, offset 0x3f6 + {value: 0x0010, lo: 0x80, hi: 0xb7}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0xb6, offset 0x3f8 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x83}, + {value: 0x0014, lo: 0x85, hi: 0x86}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0014, lo: 0x8e, hi: 0x8e}, + {value: 0x0024, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0x93}, + {value: 0x0010, lo: 0x95, hi: 0x97}, + {value: 0x0010, lo: 0x99, hi: 0xb5}, + {value: 0x0024, lo: 0xb8, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xb7, offset 0x405 + {value: 0x0010, lo: 0xa0, hi: 0xbc}, + // Block 0xb8, offset 0x406 + {value: 0x0010, lo: 0x80, hi: 0x9c}, + // Block 0xb9, offset 0x407 + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0010, lo: 0x89, hi: 0xa4}, + {value: 0x0024, lo: 0xa5, hi: 0xa5}, + {value: 0x0034, lo: 0xa6, hi: 0xa6}, + // Block 0xba, offset 0x40b + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xb2}, + // Block 0xbb, offset 0x40d + {value: 0x0010, lo: 0x80, hi: 0x91}, + // Block 0xbc, offset 0x40e + {value: 0x0010, lo: 0x80, hi: 0x88}, + // Block 0xbd, offset 0x40f + {value: 0x5653, lo: 0x80, hi: 0xb2}, + // Block 0xbe, offset 0x410 + {value: 0x5652, lo: 0x80, hi: 0xb2}, + // Block 0xbf, offset 0x411 + {value: 0x0010, lo: 0x80, hi: 0xa3}, + {value: 0x0024, lo: 0xa4, hi: 0xa7}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0xc0, offset 0x414 + {value: 0x0010, lo: 0x80, hi: 0x9c}, + {value: 0x0010, lo: 0xa7, hi: 0xa7}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0xc1, offset 0x417 + {value: 0x0010, lo: 0x80, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x87}, + {value: 0x0024, lo: 0x88, hi: 0x8a}, + {value: 0x0034, lo: 0x8b, hi: 0x8b}, + {value: 0x0024, lo: 0x8c, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x90}, + // Block 0xc2, offset 0x41d + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbf}, + // Block 0xc3, offset 0x421 + {value: 0x0014, lo: 0x80, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xc4, offset 0x425 + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb6}, + {value: 0x0010, lo: 0xb7, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0014, lo: 0xbd, hi: 0xbd}, + // Block 0xc5, offset 0x42b + {value: 0x0014, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0xa8}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0xc6, offset 0x42e + {value: 0x0024, lo: 0x80, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0xa6}, + {value: 0x0014, lo: 0xa7, hi: 0xab}, + {value: 0x0010, lo: 0xac, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xb2}, + {value: 0x0034, lo: 0xb3, hi: 0xb4}, + {value: 0x0010, lo: 0xb6, hi: 0xbf}, + // Block 0xc7, offset 0x435 + {value: 0x0010, lo: 0x84, hi: 0x86}, + {value: 0x0010, lo: 0x90, hi: 0xb2}, + {value: 0x0034, lo: 0xb3, hi: 0xb3}, + {value: 0x0010, lo: 0xb6, hi: 0xb6}, + // Block 0xc8, offset 0x439 + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xbe}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xc9, offset 0x43d + {value: 0x0030, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x84}, + {value: 0x0014, lo: 0x89, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0014, lo: 0x8b, hi: 0x8c}, + {value: 0x0010, lo: 0x90, hi: 0x9a}, + {value: 0x0010, lo: 0x9c, hi: 0x9c}, + // Block 0xca, offset 0x444 + {value: 0x0010, lo: 0x80, hi: 0x91}, + {value: 0x0010, lo: 0x93, hi: 0xae}, + {value: 0x0014, lo: 0xaf, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0014, lo: 0xb4, hi: 0xb4}, + {value: 0x0030, lo: 0xb5, hi: 0xb5}, + {value: 0x0034, lo: 0xb6, hi: 0xb6}, + {value: 0x0014, lo: 0xb7, hi: 0xb7}, + {value: 0x0014, lo: 0xbe, hi: 0xbe}, + // Block 0xcb, offset 0x44d + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x88, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8d}, + {value: 0x0010, lo: 0x8f, hi: 0x9d}, + {value: 0x0010, lo: 0x9f, hi: 0xa8}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0xcc, offset 0x453 + {value: 0x0010, lo: 0x80, hi: 0x9e}, + {value: 0x0014, lo: 0x9f, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa2}, + {value: 0x0014, lo: 0xa3, hi: 0xa8}, + {value: 0x0034, lo: 0xa9, hi: 0xaa}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0xcd, offset 0x459 + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbb, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0xce, offset 0x463 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0030, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0x9d, hi: 0xa3}, + {value: 0x0024, lo: 0xa6, hi: 0xac}, + {value: 0x0024, lo: 0xb0, hi: 0xb4}, + // Block 0xcf, offset 0x46d + {value: 0x0010, lo: 0x80, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbf}, + // Block 0xd0, offset 0x46f + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x84}, + {value: 0x0010, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x8a}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0024, lo: 0x9e, hi: 0x9e}, + // Block 0xd1, offset 0x477 + {value: 0x0010, lo: 0x80, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb8}, + {value: 0x0010, lo: 0xb9, hi: 0xb9}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbe}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0xd2, offset 0x47d + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0x85}, + {value: 0x0010, lo: 0x87, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0xd3, offset 0x483 + {value: 0x0010, lo: 0x80, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb5}, + {value: 0x0010, lo: 0xb8, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xd4, offset 0x489 + {value: 0x0034, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x98, hi: 0x9b}, + {value: 0x0014, lo: 0x9c, hi: 0x9d}, + // Block 0xd5, offset 0x48c + {value: 0x0010, lo: 0x80, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbc}, + {value: 0x0014, lo: 0xbd, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xd6, offset 0x492 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x84, hi: 0x84}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0xd7, offset 0x495 + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0014, lo: 0xab, hi: 0xab}, + {value: 0x0010, lo: 0xac, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb5}, + {value: 0x0030, lo: 0xb6, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + // Block 0xd8, offset 0x49d + {value: 0x0010, lo: 0x80, hi: 0x89}, + // Block 0xd9, offset 0x49e + {value: 0x0014, lo: 0x9d, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa5}, + {value: 0x0010, lo: 0xa6, hi: 0xa6}, + {value: 0x0014, lo: 0xa7, hi: 0xaa}, + {value: 0x0034, lo: 0xab, hi: 0xab}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0xda, offset 0x4a5 + {value: 0x0010, lo: 0x80, hi: 0xae}, + {value: 0x0014, lo: 0xaf, hi: 0xb7}, + {value: 0x0010, lo: 0xb8, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + // Block 0xdb, offset 0x4a9 + {value: 0x5f53, lo: 0xa0, hi: 0xbf}, + // Block 0xdc, offset 0x4aa + {value: 0x5f52, lo: 0x80, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xdd, offset 0x4ad + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x8a}, + {value: 0x0010, lo: 0x8b, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb8}, + {value: 0x0010, lo: 0xb9, hi: 0xba}, + {value: 0x0014, lo: 0xbb, hi: 0xbe}, + // Block 0xde, offset 0x4b5 + {value: 0x0034, lo: 0x87, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0014, lo: 0x91, hi: 0x96}, + {value: 0x0010, lo: 0x97, hi: 0x98}, + {value: 0x0014, lo: 0x99, hi: 0x9b}, + {value: 0x0010, lo: 0x9c, hi: 0xbf}, + // Block 0xdf, offset 0x4bb + {value: 0x0010, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x86, hi: 0x89}, + {value: 0x0014, lo: 0x8a, hi: 0x96}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0014, lo: 0x98, hi: 0x98}, + {value: 0x0034, lo: 0x99, hi: 0x99}, + {value: 0x0010, lo: 0x9d, hi: 0x9d}, + // Block 0xe0, offset 0x4c2 + {value: 0x0010, lo: 0x80, hi: 0xb8}, + // Block 0xe1, offset 0x4c3 + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb6}, + {value: 0x0014, lo: 0xb8, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xe2, offset 0x4c9 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0010, lo: 0xb2, hi: 0xbf}, + // Block 0xe3, offset 0x4cc + {value: 0x0010, lo: 0x80, hi: 0x8f}, + {value: 0x0014, lo: 0x92, hi: 0xa7}, + {value: 0x0010, lo: 0xa9, hi: 0xa9}, + {value: 0x0014, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb4, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb6}, + // Block 0xe4, offset 0x4d4 + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x88, hi: 0x89}, + {value: 0x0010, lo: 0x8b, hi: 0xb0}, + {value: 0x0014, lo: 0xb1, hi: 0xb6}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + {value: 0x0014, lo: 0xbc, hi: 0xbd}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0xe5, offset 0x4db + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x85}, + {value: 0x0010, lo: 0x86, hi: 0x86}, + {value: 0x0014, lo: 0x87, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0010, lo: 0xa0, hi: 0xa5}, + {value: 0x0010, lo: 0xa7, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xbf}, + // Block 0xe6, offset 0x4e5 + {value: 0x0010, lo: 0x80, hi: 0x8e}, + {value: 0x0014, lo: 0x90, hi: 0x91}, + {value: 0x0010, lo: 0x93, hi: 0x94}, + {value: 0x0014, lo: 0x95, hi: 0x95}, + {value: 0x0010, lo: 0x96, hi: 0x96}, + {value: 0x0034, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0x98, hi: 0x98}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + // Block 0xe7, offset 0x4ed + {value: 0x0010, lo: 0xa0, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb6}, + // Block 0xe8, offset 0x4f0 + {value: 0x0010, lo: 0x80, hi: 0x99}, + // Block 0xe9, offset 0x4f1 + {value: 0x0010, lo: 0x80, hi: 0xae}, + // Block 0xea, offset 0x4f2 + {value: 0x0010, lo: 0x80, hi: 0x83}, + // Block 0xeb, offset 0x4f3 + {value: 0x0010, lo: 0x80, hi: 0x86}, + // Block 0xec, offset 0x4f4 + {value: 0x0010, lo: 0x80, hi: 0x9e}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + // Block 0xed, offset 0x4f6 + {value: 0x0010, lo: 0x90, hi: 0xad}, + {value: 0x0034, lo: 0xb0, hi: 0xb4}, + // Block 0xee, offset 0x4f8 + {value: 0x0010, lo: 0x80, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb6}, + // Block 0xef, offset 0x4fa + {value: 0x0014, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0010, lo: 0xa3, hi: 0xb7}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0xf0, offset 0x4fe + {value: 0x0010, lo: 0x80, hi: 0x8f}, + // Block 0xf1, offset 0x4ff + {value: 0x2013, lo: 0x80, hi: 0x9f}, + {value: 0x2012, lo: 0xa0, hi: 0xbf}, + // Block 0xf2, offset 0x501 + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0010, lo: 0x90, hi: 0xbe}, + // Block 0xf3, offset 0x503 + {value: 0x0014, lo: 0x8f, hi: 0x9f}, + // Block 0xf4, offset 0x504 + {value: 0x0014, lo: 0xa0, hi: 0xa1}, + // Block 0xf5, offset 0x505 + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0010, lo: 0xb0, hi: 0xbc}, + // Block 0xf6, offset 0x507 + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0014, lo: 0x9d, hi: 0x9d}, + {value: 0x0034, lo: 0x9e, hi: 0x9e}, + {value: 0x0014, lo: 0xa0, hi: 0xa3}, + // Block 0xf7, offset 0x50c + {value: 0x0030, lo: 0xa5, hi: 0xa6}, + {value: 0x0034, lo: 0xa7, hi: 0xa9}, + {value: 0x0030, lo: 0xad, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbf}, + // Block 0xf8, offset 0x511 + {value: 0x0034, lo: 0x80, hi: 0x82}, + {value: 0x0024, lo: 0x85, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8b}, + {value: 0x0024, lo: 0xaa, hi: 0xad}, + // Block 0xf9, offset 0x515 + {value: 0x0024, lo: 0x82, hi: 0x84}, + // Block 0xfa, offset 0x516 + {value: 0x0013, lo: 0x80, hi: 0x99}, + {value: 0x0012, lo: 0x9a, hi: 0xb3}, + {value: 0x0013, lo: 0xb4, hi: 0xbf}, + // Block 0xfb, offset 0x519 + {value: 0x0013, lo: 0x80, hi: 0x8d}, + {value: 0x0012, lo: 0x8e, hi: 0x94}, + {value: 0x0012, lo: 0x96, hi: 0xa7}, + {value: 0x0013, lo: 0xa8, hi: 0xbf}, + // Block 0xfc, offset 0x51d + {value: 0x0013, lo: 0x80, hi: 0x81}, + {value: 0x0012, lo: 0x82, hi: 0x9b}, + {value: 0x0013, lo: 0x9c, hi: 0x9c}, + {value: 0x0013, lo: 0x9e, hi: 0x9f}, + {value: 0x0013, lo: 0xa2, hi: 0xa2}, + {value: 0x0013, lo: 0xa5, hi: 0xa6}, + {value: 0x0013, lo: 0xa9, hi: 0xac}, + {value: 0x0013, lo: 0xae, hi: 0xb5}, + {value: 0x0012, lo: 0xb6, hi: 0xb9}, + {value: 0x0012, lo: 0xbb, hi: 0xbb}, + {value: 0x0012, lo: 0xbd, hi: 0xbf}, + // Block 0xfd, offset 0x528 + {value: 0x0012, lo: 0x80, hi: 0x83}, + {value: 0x0012, lo: 0x85, hi: 0x8f}, + {value: 0x0013, lo: 0x90, hi: 0xa9}, + {value: 0x0012, lo: 0xaa, hi: 0xbf}, + // Block 0xfe, offset 0x52c + {value: 0x0012, lo: 0x80, hi: 0x83}, + {value: 0x0013, lo: 0x84, hi: 0x85}, + {value: 0x0013, lo: 0x87, hi: 0x8a}, + {value: 0x0013, lo: 0x8d, hi: 0x94}, + {value: 0x0013, lo: 0x96, hi: 0x9c}, + {value: 0x0012, lo: 0x9e, hi: 0xb7}, + {value: 0x0013, lo: 0xb8, hi: 0xb9}, + {value: 0x0013, lo: 0xbb, hi: 0xbe}, + // Block 0xff, offset 0x534 + {value: 0x0013, lo: 0x80, hi: 0x84}, + {value: 0x0013, lo: 0x86, hi: 0x86}, + {value: 0x0013, lo: 0x8a, hi: 0x90}, + {value: 0x0012, lo: 0x92, hi: 0xab}, + {value: 0x0013, lo: 0xac, hi: 0xbf}, + // Block 0x100, offset 0x539 + {value: 0x0013, lo: 0x80, hi: 0x85}, + {value: 0x0012, lo: 0x86, hi: 0x9f}, + {value: 0x0013, lo: 0xa0, hi: 0xb9}, + {value: 0x0012, lo: 0xba, hi: 0xbf}, + // Block 0x101, offset 0x53d + {value: 0x0012, lo: 0x80, hi: 0x93}, + {value: 0x0013, lo: 0x94, hi: 0xad}, + {value: 0x0012, lo: 0xae, hi: 0xbf}, + // Block 0x102, offset 0x540 + {value: 0x0012, lo: 0x80, hi: 0x87}, + {value: 0x0013, lo: 0x88, hi: 0xa1}, + {value: 0x0012, lo: 0xa2, hi: 0xbb}, + {value: 0x0013, lo: 0xbc, hi: 0xbf}, + // Block 0x103, offset 0x544 + {value: 0x0013, lo: 0x80, hi: 0x95}, + {value: 0x0012, lo: 0x96, hi: 0xaf}, + {value: 0x0013, lo: 0xb0, hi: 0xbf}, + // Block 0x104, offset 0x547 + {value: 0x0013, lo: 0x80, hi: 0x89}, + {value: 0x0012, lo: 0x8a, hi: 0xa5}, + {value: 0x0013, lo: 0xa8, hi: 0xbf}, + // Block 0x105, offset 0x54a + {value: 0x0013, lo: 0x80, hi: 0x80}, + {value: 0x0012, lo: 0x82, hi: 0x9a}, + {value: 0x0012, lo: 0x9c, hi: 0xa1}, + {value: 0x0013, lo: 0xa2, hi: 0xba}, + {value: 0x0012, lo: 0xbc, hi: 0xbf}, + // Block 0x106, offset 0x54f + {value: 0x0012, lo: 0x80, hi: 0x94}, + {value: 0x0012, lo: 0x96, hi: 0x9b}, + {value: 0x0013, lo: 0x9c, hi: 0xb4}, + {value: 0x0012, lo: 0xb6, hi: 0xbf}, + // Block 0x107, offset 0x553 + {value: 0x0012, lo: 0x80, hi: 0x8e}, + {value: 0x0012, lo: 0x90, hi: 0x95}, + {value: 0x0013, lo: 0x96, hi: 0xae}, + {value: 0x0012, lo: 0xb0, hi: 0xbf}, + // Block 0x108, offset 0x557 + {value: 0x0012, lo: 0x80, hi: 0x88}, + {value: 0x0012, lo: 0x8a, hi: 0x8f}, + {value: 0x0013, lo: 0x90, hi: 0xa8}, + {value: 0x0012, lo: 0xaa, hi: 0xbf}, + // Block 0x109, offset 0x55b + {value: 0x0012, lo: 0x80, hi: 0x82}, + {value: 0x0012, lo: 0x84, hi: 0x89}, + {value: 0x0017, lo: 0x8a, hi: 0x8b}, + {value: 0x0010, lo: 0x8e, hi: 0xbf}, + // Block 0x10a, offset 0x55f + {value: 0x0014, lo: 0x80, hi: 0xb6}, + {value: 0x0014, lo: 0xbb, hi: 0xbf}, + // Block 0x10b, offset 0x561 + {value: 0x0014, lo: 0x80, hi: 0xac}, + {value: 0x0014, lo: 0xb5, hi: 0xb5}, + // Block 0x10c, offset 0x563 + {value: 0x0014, lo: 0x84, hi: 0x84}, + {value: 0x0014, lo: 0x9b, hi: 0x9f}, + {value: 0x0014, lo: 0xa1, hi: 0xaf}, + // Block 0x10d, offset 0x566 + {value: 0x0024, lo: 0x80, hi: 0x86}, + {value: 0x0024, lo: 0x88, hi: 0x98}, + {value: 0x0024, lo: 0x9b, hi: 0xa1}, + {value: 0x0024, lo: 0xa3, hi: 0xa4}, + {value: 0x0024, lo: 0xa6, hi: 0xaa}, + // Block 0x10e, offset 0x56b + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0034, lo: 0x90, hi: 0x96}, + // Block 0x10f, offset 0x56d + {value: 0xb852, lo: 0x80, hi: 0x81}, + {value: 0xbb52, lo: 0x82, hi: 0x83}, + {value: 0x0024, lo: 0x84, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x110, offset 0x572 + {value: 0x0010, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x9f}, + {value: 0x0010, lo: 0xa1, hi: 0xa2}, + {value: 0x0010, lo: 0xa4, hi: 0xa4}, + {value: 0x0010, lo: 0xa7, hi: 0xa7}, + {value: 0x0010, lo: 0xa9, hi: 0xb2}, + {value: 0x0010, lo: 0xb4, hi: 0xb7}, + {value: 0x0010, lo: 0xb9, hi: 0xb9}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + // Block 0x111, offset 0x57b + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x8b, hi: 0x9b}, + {value: 0x0010, lo: 0xa1, hi: 0xa3}, + {value: 0x0010, lo: 0xa5, hi: 0xa9}, + {value: 0x0010, lo: 0xab, hi: 0xbb}, + // Block 0x112, offset 0x580 + {value: 0x0013, lo: 0xb0, hi: 0xbf}, + // Block 0x113, offset 0x581 + {value: 0x0013, lo: 0x80, hi: 0x89}, + {value: 0x0013, lo: 0x90, hi: 0xa9}, + {value: 0x0013, lo: 0xb0, hi: 0xbf}, + // Block 0x114, offset 0x584 + {value: 0x0013, lo: 0x80, hi: 0x89}, + // Block 0x115, offset 0x585 + {value: 0x0014, lo: 0xbb, hi: 0xbf}, + // Block 0x116, offset 0x586 + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0014, lo: 0xa0, hi: 0xbf}, + // Block 0x117, offset 0x588 + {value: 0x0014, lo: 0x80, hi: 0xbf}, + // Block 0x118, offset 0x589 + {value: 0x0014, lo: 0x80, hi: 0xaf}, +} + +// Total table size 14906 bytes (14KiB); checksum: 362795C7 diff --git a/vendor/golang.org/x/text/cases/tables12.0.0.go b/vendor/golang.org/x/text/cases/tables12.0.0.go new file mode 100644 index 00000000..ae7dc240 --- /dev/null +++ b/vendor/golang.org/x/text/cases/tables12.0.0.go @@ -0,0 +1,2360 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +//go:build go1.14 && !go1.16 +// +build go1.14,!go1.16 + +package cases + +// UnicodeVersion is the Unicode version from which the tables in this package are derived. +const UnicodeVersion = "12.0.0" + +var xorData string = "" + // Size: 192 bytes + "\x00\x06\x07\x00\x01?\x00\x0f\x03\x00\x0f\x12\x00\x0f\x1f\x00\x0f\x1d" + + "\x00\x01\x13\x00\x0f\x16\x00\x0f\x0b\x00\x0f3\x00\x0f7\x00\x01#\x00\x0f?" + + "\x00\x0e'\x00\x0f/\x00\x0e>\x00\x0f*\x00\x0c&\x00\x0c*\x00\x0c;\x00\x0c9" + + "\x00\x0c%\x00\x01\x08\x00\x03\x0d\x00\x03\x09\x00\x02\x06\x00\x02\x02" + + "\x00\x02\x0c\x00\x01\x00\x00\x01\x03\x00\x01\x01\x00\x01 \x00\x01\x0c" + + "\x00\x01\x10\x00\x03\x10\x00\x036 \x00\x037 \x00\x0b#\x10\x00\x0b 0\x00" + + "\x0b!\x10\x00\x0b!0\x001\x00\x00\x0b(\x04\x00\x03\x04\x1e\x00\x0b)\x08" + + "\x00\x03\x0a\x00\x02:\x00\x02>\x00\x02,\x00\x02\x00\x00\x02\x10\x00\x01<" + + "\x00\x01&\x00\x01*\x00\x01.\x00\x010\x003 \x00\x01\x18\x00\x01(\x00\x01" + + "\x1e\x00\x01\x22" + +var exceptions string = "" + // Size: 2450 bytes + "\x00\x12\x12μΜΜ\x12\x12ssSSSs\x13\x18i̇i̇\x10\x09II\x13\x1bʼnʼNʼN\x11" + + "\x09sSS\x12\x12dždžDž\x12\x12dždžDŽ\x10\x12DŽDž\x12\x12ljljLj\x12\x12ljljLJ\x10\x12LJLj" + + "\x12\x12njnjNj\x12\x12njnjNJ\x10\x12NJNj\x13\x1bǰJ̌J̌\x12\x12dzdzDz\x12\x12dzdzDZ\x10" + + "\x12DZDz\x13\x18ⱥⱥ\x13\x18ⱦⱦ\x10\x1bⱾⱾ\x10\x1bⱿⱿ\x10\x1bⱯⱯ\x10\x1bⱭⱭ\x10" + + "\x1bⱰⱰ\x10\x1bꞫꞫ\x10\x1bꞬꞬ\x10\x1bꞍꞍ\x10\x1bꞪꞪ\x10\x1bꞮꞮ\x10\x1bⱢⱢ\x10" + + "\x1bꞭꞭ\x10\x1bⱮⱮ\x10\x1bⱤⱤ\x10\x1bꟅꟅ\x10\x1bꞱꞱ\x10\x1bꞲꞲ\x10\x1bꞰꞰ2\x12ι" + + "ΙΙ\x166ΐΪ́Ϊ́\x166ΰΫ́Ϋ́\x12\x12σΣΣ\x12\x12βΒΒ\x12\x12θΘΘ\x12\x12" + + "φΦΦ\x12\x12πΠΠ\x12\x12κΚΚ\x12\x12ρΡΡ\x12\x12εΕΕ\x14$եւԵՒԵւ\x10\x1bᲐა" + + "\x10\x1bᲑბ\x10\x1bᲒგ\x10\x1bᲓდ\x10\x1bᲔე\x10\x1bᲕვ\x10\x1bᲖზ\x10\x1bᲗთ" + + "\x10\x1bᲘი\x10\x1bᲙკ\x10\x1bᲚლ\x10\x1bᲛმ\x10\x1bᲜნ\x10\x1bᲝო\x10\x1bᲞპ" + + "\x10\x1bᲟჟ\x10\x1bᲠრ\x10\x1bᲡს\x10\x1bᲢტ\x10\x1bᲣუ\x10\x1bᲤფ\x10\x1bᲥქ" + + "\x10\x1bᲦღ\x10\x1bᲧყ\x10\x1bᲨშ\x10\x1bᲩჩ\x10\x1bᲪც\x10\x1bᲫძ\x10\x1bᲬწ" + + "\x10\x1bᲭჭ\x10\x1bᲮხ\x10\x1bᲯჯ\x10\x1bᲰჰ\x10\x1bᲱჱ\x10\x1bᲲჲ\x10\x1bᲳჳ" + + "\x10\x1bᲴჴ\x10\x1bᲵჵ\x10\x1bᲶჶ\x10\x1bᲷჷ\x10\x1bᲸჸ\x10\x1bᲹჹ\x10\x1bᲺჺ" + + "\x10\x1bᲽჽ\x10\x1bᲾჾ\x10\x1bᲿჿ\x12\x12вВВ\x12\x12дДД\x12\x12оОО\x12\x12с" + + "СС\x12\x12тТТ\x12\x12тТТ\x12\x12ъЪЪ\x12\x12ѣѢѢ\x13\x1bꙋꙊꙊ\x13\x1bẖH̱H̱" + + "\x13\x1bẗT̈T̈\x13\x1bẘW̊W̊\x13\x1bẙY̊Y̊\x13\x1baʾAʾAʾ\x13\x1bṡṠṠ\x12" + + "\x10ssß\x14$ὐΥ̓Υ̓\x166ὒΥ̓̀Υ̓̀\x166ὔΥ̓́Υ̓́\x166ὖΥ̓͂Υ̓͂\x15+ἀιἈΙᾈ" + + "\x15+ἁιἉΙᾉ\x15+ἂιἊΙᾊ\x15+ἃιἋΙᾋ\x15+ἄιἌΙᾌ\x15+ἅιἍΙᾍ\x15+ἆιἎΙᾎ\x15+ἇιἏΙᾏ" + + "\x15\x1dἀιᾀἈΙ\x15\x1dἁιᾁἉΙ\x15\x1dἂιᾂἊΙ\x15\x1dἃιᾃἋΙ\x15\x1dἄιᾄἌΙ\x15" + + "\x1dἅιᾅἍΙ\x15\x1dἆιᾆἎΙ\x15\x1dἇιᾇἏΙ\x15+ἠιἨΙᾘ\x15+ἡιἩΙᾙ\x15+ἢιἪΙᾚ\x15+ἣι" + + "ἫΙᾛ\x15+ἤιἬΙᾜ\x15+ἥιἭΙᾝ\x15+ἦιἮΙᾞ\x15+ἧιἯΙᾟ\x15\x1dἠιᾐἨΙ\x15\x1dἡιᾑἩΙ" + + "\x15\x1dἢιᾒἪΙ\x15\x1dἣιᾓἫΙ\x15\x1dἤιᾔἬΙ\x15\x1dἥιᾕἭΙ\x15\x1dἦιᾖἮΙ\x15" + + "\x1dἧιᾗἯΙ\x15+ὠιὨΙᾨ\x15+ὡιὩΙᾩ\x15+ὢιὪΙᾪ\x15+ὣιὫΙᾫ\x15+ὤιὬΙᾬ\x15+ὥιὭΙᾭ" + + "\x15+ὦιὮΙᾮ\x15+ὧιὯΙᾯ\x15\x1dὠιᾠὨΙ\x15\x1dὡιᾡὩΙ\x15\x1dὢιᾢὪΙ\x15\x1dὣιᾣὫΙ" + + "\x15\x1dὤιᾤὬΙ\x15\x1dὥιᾥὭΙ\x15\x1dὦιᾦὮΙ\x15\x1dὧιᾧὯΙ\x15-ὰιᾺΙᾺͅ\x14#αιΑΙ" + + "ᾼ\x14$άιΆΙΆͅ\x14$ᾶΑ͂Α͂\x166ᾶιΑ͂Ιᾼ͂\x14\x1cαιᾳΑΙ\x12\x12ιΙΙ\x15-ὴιῊΙ" + + "Ὴͅ\x14#ηιΗΙῌ\x14$ήιΉΙΉͅ\x14$ῆΗ͂Η͂\x166ῆιΗ͂Ιῌ͂\x14\x1cηιῃΗΙ\x166ῒΙ" + + "̈̀Ϊ̀\x166ΐΪ́Ϊ́\x14$ῖΙ͂Ι͂\x166ῗΪ͂Ϊ͂\x166ῢΫ̀Ϋ̀\x166ΰΫ́Ϋ" + + "́\x14$ῤΡ̓Ρ̓\x14$ῦΥ͂Υ͂\x166ῧΫ͂Ϋ͂\x15-ὼιῺΙῺͅ\x14#ωιΩΙῼ\x14$ώιΏΙΏͅ" + + "\x14$ῶΩ͂Ω͂\x166ῶιΩ͂Ιῼ͂\x14\x1cωιῳΩΙ\x12\x10ωω\x11\x08kk\x12\x10åå\x12" + + "\x10ɫɫ\x12\x10ɽɽ\x10\x12ȺȺ\x10\x12ȾȾ\x12\x10ɑɑ\x12\x10ɱɱ\x12\x10ɐɐ\x12" + + "\x10ɒɒ\x12\x10ȿȿ\x12\x10ɀɀ\x12\x10ɥɥ\x12\x10ɦɦ\x12\x10ɜɜ\x12\x10ɡɡ\x12" + + "\x10ɬɬ\x12\x10ɪɪ\x12\x10ʞʞ\x12\x10ʇʇ\x12\x10ʝʝ\x12\x10ʂʂ\x12\x12ffFFFf" + + "\x12\x12fiFIFi\x12\x12flFLFl\x13\x1bffiFFIFfi\x13\x1bfflFFLFfl\x12\x12st" + + "STSt\x12\x12stSTSt\x14$մնՄՆՄն\x14$մեՄԵՄե\x14$միՄԻՄի\x14$վնՎՆՎն\x14$մխՄԽՄ" + + "խ" + +// lookup returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *caseTrie) lookup(s []byte) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return caseValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = caseIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *caseTrie) lookupUnsafe(s []byte) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return caseValues[c0] + } + i := caseIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = caseIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = caseIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// lookupString returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *caseTrie) lookupString(s string) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return caseValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = caseIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *caseTrie) lookupStringUnsafe(s string) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return caseValues[c0] + } + i := caseIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = caseIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = caseIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// caseTrie. Total size: 12396 bytes (12.11 KiB). Checksum: c0656238384c3da1. +type caseTrie struct{} + +func newCaseTrie(i int) *caseTrie { + return &caseTrie{} +} + +// lookupValue determines the type of block n and looks up the value for b. +func (t *caseTrie) lookupValue(n uint32, b byte) uint16 { + switch { + case n < 20: + return uint16(caseValues[n<<6+uint32(b)]) + default: + n -= 20 + return uint16(sparse.lookup(n, b)) + } +} + +// caseValues: 22 blocks, 1408 entries, 2816 bytes +// The third block is the zero block. +var caseValues = [1408]uint16{ + // Block 0x0, offset 0x0 + 0x27: 0x0054, + 0x2e: 0x0054, + 0x30: 0x0010, 0x31: 0x0010, 0x32: 0x0010, 0x33: 0x0010, 0x34: 0x0010, 0x35: 0x0010, + 0x36: 0x0010, 0x37: 0x0010, 0x38: 0x0010, 0x39: 0x0010, 0x3a: 0x0054, + // Block 0x1, offset 0x40 + 0x41: 0x2013, 0x42: 0x2013, 0x43: 0x2013, 0x44: 0x2013, 0x45: 0x2013, + 0x46: 0x2013, 0x47: 0x2013, 0x48: 0x2013, 0x49: 0x2013, 0x4a: 0x2013, 0x4b: 0x2013, + 0x4c: 0x2013, 0x4d: 0x2013, 0x4e: 0x2013, 0x4f: 0x2013, 0x50: 0x2013, 0x51: 0x2013, + 0x52: 0x2013, 0x53: 0x2013, 0x54: 0x2013, 0x55: 0x2013, 0x56: 0x2013, 0x57: 0x2013, + 0x58: 0x2013, 0x59: 0x2013, 0x5a: 0x2013, + 0x5e: 0x0004, 0x5f: 0x0010, 0x60: 0x0004, 0x61: 0x2012, 0x62: 0x2012, 0x63: 0x2012, + 0x64: 0x2012, 0x65: 0x2012, 0x66: 0x2012, 0x67: 0x2012, 0x68: 0x2012, 0x69: 0x2012, + 0x6a: 0x2012, 0x6b: 0x2012, 0x6c: 0x2012, 0x6d: 0x2012, 0x6e: 0x2012, 0x6f: 0x2012, + 0x70: 0x2012, 0x71: 0x2012, 0x72: 0x2012, 0x73: 0x2012, 0x74: 0x2012, 0x75: 0x2012, + 0x76: 0x2012, 0x77: 0x2012, 0x78: 0x2012, 0x79: 0x2012, 0x7a: 0x2012, + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc0: 0x0852, 0xc1: 0x0b53, 0xc2: 0x0113, 0xc3: 0x0112, 0xc4: 0x0113, 0xc5: 0x0112, + 0xc6: 0x0b53, 0xc7: 0x0f13, 0xc8: 0x0f12, 0xc9: 0x0e53, 0xca: 0x1153, 0xcb: 0x0713, + 0xcc: 0x0712, 0xcd: 0x0012, 0xce: 0x1453, 0xcf: 0x1753, 0xd0: 0x1a53, 0xd1: 0x0313, + 0xd2: 0x0312, 0xd3: 0x1d53, 0xd4: 0x2053, 0xd5: 0x2352, 0xd6: 0x2653, 0xd7: 0x2653, + 0xd8: 0x0113, 0xd9: 0x0112, 0xda: 0x2952, 0xdb: 0x0012, 0xdc: 0x1d53, 0xdd: 0x2c53, + 0xde: 0x2f52, 0xdf: 0x3253, 0xe0: 0x0113, 0xe1: 0x0112, 0xe2: 0x0113, 0xe3: 0x0112, + 0xe4: 0x0113, 0xe5: 0x0112, 0xe6: 0x3553, 0xe7: 0x0f13, 0xe8: 0x0f12, 0xe9: 0x3853, + 0xea: 0x0012, 0xeb: 0x0012, 0xec: 0x0113, 0xed: 0x0112, 0xee: 0x3553, 0xef: 0x1f13, + 0xf0: 0x1f12, 0xf1: 0x3b53, 0xf2: 0x3e53, 0xf3: 0x0713, 0xf4: 0x0712, 0xf5: 0x0313, + 0xf6: 0x0312, 0xf7: 0x4153, 0xf8: 0x0113, 0xf9: 0x0112, 0xfa: 0x0012, 0xfb: 0x0010, + 0xfc: 0x0113, 0xfd: 0x0112, 0xfe: 0x0012, 0xff: 0x4452, + // Block 0x4, offset 0x100 + 0x100: 0x0010, 0x101: 0x0010, 0x102: 0x0010, 0x103: 0x0010, 0x104: 0x02db, 0x105: 0x0359, + 0x106: 0x03da, 0x107: 0x043b, 0x108: 0x04b9, 0x109: 0x053a, 0x10a: 0x059b, 0x10b: 0x0619, + 0x10c: 0x069a, 0x10d: 0x0313, 0x10e: 0x0312, 0x10f: 0x1f13, 0x110: 0x1f12, 0x111: 0x0313, + 0x112: 0x0312, 0x113: 0x0713, 0x114: 0x0712, 0x115: 0x0313, 0x116: 0x0312, 0x117: 0x0f13, + 0x118: 0x0f12, 0x119: 0x0313, 0x11a: 0x0312, 0x11b: 0x0713, 0x11c: 0x0712, 0x11d: 0x1452, + 0x11e: 0x0113, 0x11f: 0x0112, 0x120: 0x0113, 0x121: 0x0112, 0x122: 0x0113, 0x123: 0x0112, + 0x124: 0x0113, 0x125: 0x0112, 0x126: 0x0113, 0x127: 0x0112, 0x128: 0x0113, 0x129: 0x0112, + 0x12a: 0x0113, 0x12b: 0x0112, 0x12c: 0x0113, 0x12d: 0x0112, 0x12e: 0x0113, 0x12f: 0x0112, + 0x130: 0x06fa, 0x131: 0x07ab, 0x132: 0x0829, 0x133: 0x08aa, 0x134: 0x0113, 0x135: 0x0112, + 0x136: 0x2353, 0x137: 0x4453, 0x138: 0x0113, 0x139: 0x0112, 0x13a: 0x0113, 0x13b: 0x0112, + 0x13c: 0x0113, 0x13d: 0x0112, 0x13e: 0x0113, 0x13f: 0x0112, + // Block 0x5, offset 0x140 + 0x140: 0x0a8a, 0x141: 0x0313, 0x142: 0x0312, 0x143: 0x0853, 0x144: 0x4753, 0x145: 0x4a53, + 0x146: 0x0113, 0x147: 0x0112, 0x148: 0x0113, 0x149: 0x0112, 0x14a: 0x0113, 0x14b: 0x0112, + 0x14c: 0x0113, 0x14d: 0x0112, 0x14e: 0x0113, 0x14f: 0x0112, 0x150: 0x0b0a, 0x151: 0x0b8a, + 0x152: 0x0c0a, 0x153: 0x0b52, 0x154: 0x0b52, 0x155: 0x0012, 0x156: 0x0e52, 0x157: 0x1152, + 0x158: 0x0012, 0x159: 0x1752, 0x15a: 0x0012, 0x15b: 0x1a52, 0x15c: 0x0c8a, 0x15d: 0x0012, + 0x15e: 0x0012, 0x15f: 0x0012, 0x160: 0x1d52, 0x161: 0x0d0a, 0x162: 0x0012, 0x163: 0x2052, + 0x164: 0x0012, 0x165: 0x0d8a, 0x166: 0x0e0a, 0x167: 0x0012, 0x168: 0x2652, 0x169: 0x2652, + 0x16a: 0x0e8a, 0x16b: 0x0f0a, 0x16c: 0x0f8a, 0x16d: 0x0012, 0x16e: 0x0012, 0x16f: 0x1d52, + 0x170: 0x0012, 0x171: 0x100a, 0x172: 0x2c52, 0x173: 0x0012, 0x174: 0x0012, 0x175: 0x3252, + 0x176: 0x0012, 0x177: 0x0012, 0x178: 0x0012, 0x179: 0x0012, 0x17a: 0x0012, 0x17b: 0x0012, + 0x17c: 0x0012, 0x17d: 0x108a, 0x17e: 0x0012, 0x17f: 0x0012, + // Block 0x6, offset 0x180 + 0x180: 0x3552, 0x181: 0x0012, 0x182: 0x110a, 0x183: 0x3852, 0x184: 0x0012, 0x185: 0x0012, + 0x186: 0x0012, 0x187: 0x118a, 0x188: 0x3552, 0x189: 0x4752, 0x18a: 0x3b52, 0x18b: 0x3e52, + 0x18c: 0x4a52, 0x18d: 0x0012, 0x18e: 0x0012, 0x18f: 0x0012, 0x190: 0x0012, 0x191: 0x0012, + 0x192: 0x4152, 0x193: 0x0012, 0x194: 0x0010, 0x195: 0x0012, 0x196: 0x0012, 0x197: 0x0012, + 0x198: 0x0012, 0x199: 0x0012, 0x19a: 0x0012, 0x19b: 0x0012, 0x19c: 0x0012, 0x19d: 0x120a, + 0x19e: 0x128a, 0x19f: 0x0012, 0x1a0: 0x0012, 0x1a1: 0x0012, 0x1a2: 0x0012, 0x1a3: 0x0012, + 0x1a4: 0x0012, 0x1a5: 0x0012, 0x1a6: 0x0012, 0x1a7: 0x0012, 0x1a8: 0x0012, 0x1a9: 0x0012, + 0x1aa: 0x0012, 0x1ab: 0x0012, 0x1ac: 0x0012, 0x1ad: 0x0012, 0x1ae: 0x0012, 0x1af: 0x0012, + 0x1b0: 0x0015, 0x1b1: 0x0015, 0x1b2: 0x0015, 0x1b3: 0x0015, 0x1b4: 0x0015, 0x1b5: 0x0015, + 0x1b6: 0x0015, 0x1b7: 0x0015, 0x1b8: 0x0015, 0x1b9: 0x0014, 0x1ba: 0x0014, 0x1bb: 0x0014, + 0x1bc: 0x0014, 0x1bd: 0x0014, 0x1be: 0x0014, 0x1bf: 0x0014, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x0024, 0x1c1: 0x0024, 0x1c2: 0x0024, 0x1c3: 0x0024, 0x1c4: 0x0024, 0x1c5: 0x130d, + 0x1c6: 0x0024, 0x1c7: 0x0034, 0x1c8: 0x0034, 0x1c9: 0x0034, 0x1ca: 0x0024, 0x1cb: 0x0024, + 0x1cc: 0x0024, 0x1cd: 0x0034, 0x1ce: 0x0034, 0x1cf: 0x0014, 0x1d0: 0x0024, 0x1d1: 0x0024, + 0x1d2: 0x0024, 0x1d3: 0x0034, 0x1d4: 0x0034, 0x1d5: 0x0034, 0x1d6: 0x0034, 0x1d7: 0x0024, + 0x1d8: 0x0034, 0x1d9: 0x0034, 0x1da: 0x0034, 0x1db: 0x0024, 0x1dc: 0x0034, 0x1dd: 0x0034, + 0x1de: 0x0034, 0x1df: 0x0034, 0x1e0: 0x0034, 0x1e1: 0x0034, 0x1e2: 0x0034, 0x1e3: 0x0024, + 0x1e4: 0x0024, 0x1e5: 0x0024, 0x1e6: 0x0024, 0x1e7: 0x0024, 0x1e8: 0x0024, 0x1e9: 0x0024, + 0x1ea: 0x0024, 0x1eb: 0x0024, 0x1ec: 0x0024, 0x1ed: 0x0024, 0x1ee: 0x0024, 0x1ef: 0x0024, + 0x1f0: 0x0113, 0x1f1: 0x0112, 0x1f2: 0x0113, 0x1f3: 0x0112, 0x1f4: 0x0014, 0x1f5: 0x0004, + 0x1f6: 0x0113, 0x1f7: 0x0112, 0x1fa: 0x0015, 0x1fb: 0x4d52, + 0x1fc: 0x5052, 0x1fd: 0x5052, 0x1ff: 0x5353, + // Block 0x8, offset 0x200 + 0x204: 0x0004, 0x205: 0x0004, + 0x206: 0x2a13, 0x207: 0x0054, 0x208: 0x2513, 0x209: 0x2713, 0x20a: 0x2513, + 0x20c: 0x5653, 0x20e: 0x5953, 0x20f: 0x5c53, 0x210: 0x138a, 0x211: 0x2013, + 0x212: 0x2013, 0x213: 0x2013, 0x214: 0x2013, 0x215: 0x2013, 0x216: 0x2013, 0x217: 0x2013, + 0x218: 0x2013, 0x219: 0x2013, 0x21a: 0x2013, 0x21b: 0x2013, 0x21c: 0x2013, 0x21d: 0x2013, + 0x21e: 0x2013, 0x21f: 0x2013, 0x220: 0x5f53, 0x221: 0x5f53, 0x223: 0x5f53, + 0x224: 0x5f53, 0x225: 0x5f53, 0x226: 0x5f53, 0x227: 0x5f53, 0x228: 0x5f53, 0x229: 0x5f53, + 0x22a: 0x5f53, 0x22b: 0x5f53, 0x22c: 0x2a12, 0x22d: 0x2512, 0x22e: 0x2712, 0x22f: 0x2512, + 0x230: 0x14ca, 0x231: 0x2012, 0x232: 0x2012, 0x233: 0x2012, 0x234: 0x2012, 0x235: 0x2012, + 0x236: 0x2012, 0x237: 0x2012, 0x238: 0x2012, 0x239: 0x2012, 0x23a: 0x2012, 0x23b: 0x2012, + 0x23c: 0x2012, 0x23d: 0x2012, 0x23e: 0x2012, 0x23f: 0x2012, + // Block 0x9, offset 0x240 + 0x240: 0x5f52, 0x241: 0x5f52, 0x242: 0x160a, 0x243: 0x5f52, 0x244: 0x5f52, 0x245: 0x5f52, + 0x246: 0x5f52, 0x247: 0x5f52, 0x248: 0x5f52, 0x249: 0x5f52, 0x24a: 0x5f52, 0x24b: 0x5f52, + 0x24c: 0x5652, 0x24d: 0x5952, 0x24e: 0x5c52, 0x24f: 0x1813, 0x250: 0x168a, 0x251: 0x170a, + 0x252: 0x0013, 0x253: 0x0013, 0x254: 0x0013, 0x255: 0x178a, 0x256: 0x180a, 0x257: 0x1812, + 0x258: 0x0113, 0x259: 0x0112, 0x25a: 0x0113, 0x25b: 0x0112, 0x25c: 0x0113, 0x25d: 0x0112, + 0x25e: 0x0113, 0x25f: 0x0112, 0x260: 0x0113, 0x261: 0x0112, 0x262: 0x0113, 0x263: 0x0112, + 0x264: 0x0113, 0x265: 0x0112, 0x266: 0x0113, 0x267: 0x0112, 0x268: 0x0113, 0x269: 0x0112, + 0x26a: 0x0113, 0x26b: 0x0112, 0x26c: 0x0113, 0x26d: 0x0112, 0x26e: 0x0113, 0x26f: 0x0112, + 0x270: 0x188a, 0x271: 0x190a, 0x272: 0x0b12, 0x273: 0x5352, 0x274: 0x6253, 0x275: 0x198a, + 0x277: 0x0f13, 0x278: 0x0f12, 0x279: 0x0b13, 0x27a: 0x0113, 0x27b: 0x0112, + 0x27c: 0x0012, 0x27d: 0x4d53, 0x27e: 0x5053, 0x27f: 0x5053, + // Block 0xa, offset 0x280 + 0x280: 0x6852, 0x281: 0x6852, 0x282: 0x6852, 0x283: 0x6852, 0x284: 0x6852, 0x285: 0x6852, + 0x286: 0x6852, 0x287: 0x1a0a, 0x288: 0x0012, + 0x291: 0x0034, + 0x292: 0x0024, 0x293: 0x0024, 0x294: 0x0024, 0x295: 0x0024, 0x296: 0x0034, 0x297: 0x0024, + 0x298: 0x0024, 0x299: 0x0024, 0x29a: 0x0034, 0x29b: 0x0034, 0x29c: 0x0024, 0x29d: 0x0024, + 0x29e: 0x0024, 0x29f: 0x0024, 0x2a0: 0x0024, 0x2a1: 0x0024, 0x2a2: 0x0034, 0x2a3: 0x0034, + 0x2a4: 0x0034, 0x2a5: 0x0034, 0x2a6: 0x0034, 0x2a7: 0x0034, 0x2a8: 0x0024, 0x2a9: 0x0024, + 0x2aa: 0x0034, 0x2ab: 0x0024, 0x2ac: 0x0024, 0x2ad: 0x0034, 0x2ae: 0x0034, 0x2af: 0x0024, + 0x2b0: 0x0034, 0x2b1: 0x0034, 0x2b2: 0x0034, 0x2b3: 0x0034, 0x2b4: 0x0034, 0x2b5: 0x0034, + 0x2b6: 0x0034, 0x2b7: 0x0034, 0x2b8: 0x0034, 0x2b9: 0x0034, 0x2ba: 0x0034, 0x2bb: 0x0034, + 0x2bc: 0x0034, 0x2bd: 0x0034, 0x2bf: 0x0034, + // Block 0xb, offset 0x2c0 + 0x2c0: 0x7053, 0x2c1: 0x7053, 0x2c2: 0x7053, 0x2c3: 0x7053, 0x2c4: 0x7053, 0x2c5: 0x7053, + 0x2c7: 0x7053, + 0x2cd: 0x7053, 0x2d0: 0x1aea, 0x2d1: 0x1b6a, + 0x2d2: 0x1bea, 0x2d3: 0x1c6a, 0x2d4: 0x1cea, 0x2d5: 0x1d6a, 0x2d6: 0x1dea, 0x2d7: 0x1e6a, + 0x2d8: 0x1eea, 0x2d9: 0x1f6a, 0x2da: 0x1fea, 0x2db: 0x206a, 0x2dc: 0x20ea, 0x2dd: 0x216a, + 0x2de: 0x21ea, 0x2df: 0x226a, 0x2e0: 0x22ea, 0x2e1: 0x236a, 0x2e2: 0x23ea, 0x2e3: 0x246a, + 0x2e4: 0x24ea, 0x2e5: 0x256a, 0x2e6: 0x25ea, 0x2e7: 0x266a, 0x2e8: 0x26ea, 0x2e9: 0x276a, + 0x2ea: 0x27ea, 0x2eb: 0x286a, 0x2ec: 0x28ea, 0x2ed: 0x296a, 0x2ee: 0x29ea, 0x2ef: 0x2a6a, + 0x2f0: 0x2aea, 0x2f1: 0x2b6a, 0x2f2: 0x2bea, 0x2f3: 0x2c6a, 0x2f4: 0x2cea, 0x2f5: 0x2d6a, + 0x2f6: 0x2dea, 0x2f7: 0x2e6a, 0x2f8: 0x2eea, 0x2f9: 0x2f6a, 0x2fa: 0x2fea, + 0x2fc: 0x0014, 0x2fd: 0x306a, 0x2fe: 0x30ea, 0x2ff: 0x316a, + // Block 0xc, offset 0x300 + 0x300: 0x0812, 0x301: 0x0812, 0x302: 0x0812, 0x303: 0x0812, 0x304: 0x0812, 0x305: 0x0812, + 0x308: 0x0813, 0x309: 0x0813, 0x30a: 0x0813, 0x30b: 0x0813, + 0x30c: 0x0813, 0x30d: 0x0813, 0x310: 0x3b1a, 0x311: 0x0812, + 0x312: 0x3bfa, 0x313: 0x0812, 0x314: 0x3d3a, 0x315: 0x0812, 0x316: 0x3e7a, 0x317: 0x0812, + 0x319: 0x0813, 0x31b: 0x0813, 0x31d: 0x0813, + 0x31f: 0x0813, 0x320: 0x0812, 0x321: 0x0812, 0x322: 0x0812, 0x323: 0x0812, + 0x324: 0x0812, 0x325: 0x0812, 0x326: 0x0812, 0x327: 0x0812, 0x328: 0x0813, 0x329: 0x0813, + 0x32a: 0x0813, 0x32b: 0x0813, 0x32c: 0x0813, 0x32d: 0x0813, 0x32e: 0x0813, 0x32f: 0x0813, + 0x330: 0x9252, 0x331: 0x9252, 0x332: 0x9552, 0x333: 0x9552, 0x334: 0x9852, 0x335: 0x9852, + 0x336: 0x9b52, 0x337: 0x9b52, 0x338: 0x9e52, 0x339: 0x9e52, 0x33a: 0xa152, 0x33b: 0xa152, + 0x33c: 0x4d52, 0x33d: 0x4d52, + // Block 0xd, offset 0x340 + 0x340: 0x3fba, 0x341: 0x40aa, 0x342: 0x419a, 0x343: 0x428a, 0x344: 0x437a, 0x345: 0x446a, + 0x346: 0x455a, 0x347: 0x464a, 0x348: 0x4739, 0x349: 0x4829, 0x34a: 0x4919, 0x34b: 0x4a09, + 0x34c: 0x4af9, 0x34d: 0x4be9, 0x34e: 0x4cd9, 0x34f: 0x4dc9, 0x350: 0x4eba, 0x351: 0x4faa, + 0x352: 0x509a, 0x353: 0x518a, 0x354: 0x527a, 0x355: 0x536a, 0x356: 0x545a, 0x357: 0x554a, + 0x358: 0x5639, 0x359: 0x5729, 0x35a: 0x5819, 0x35b: 0x5909, 0x35c: 0x59f9, 0x35d: 0x5ae9, + 0x35e: 0x5bd9, 0x35f: 0x5cc9, 0x360: 0x5dba, 0x361: 0x5eaa, 0x362: 0x5f9a, 0x363: 0x608a, + 0x364: 0x617a, 0x365: 0x626a, 0x366: 0x635a, 0x367: 0x644a, 0x368: 0x6539, 0x369: 0x6629, + 0x36a: 0x6719, 0x36b: 0x6809, 0x36c: 0x68f9, 0x36d: 0x69e9, 0x36e: 0x6ad9, 0x36f: 0x6bc9, + 0x370: 0x0812, 0x371: 0x0812, 0x372: 0x6cba, 0x373: 0x6dca, 0x374: 0x6e9a, + 0x376: 0x6f7a, 0x377: 0x705a, 0x378: 0x0813, 0x379: 0x0813, 0x37a: 0x9253, 0x37b: 0x9253, + 0x37c: 0x7199, 0x37d: 0x0004, 0x37e: 0x726a, 0x37f: 0x0004, + // Block 0xe, offset 0x380 + 0x380: 0x0004, 0x381: 0x0004, 0x382: 0x72ea, 0x383: 0x73fa, 0x384: 0x74ca, + 0x386: 0x75aa, 0x387: 0x768a, 0x388: 0x9553, 0x389: 0x9553, 0x38a: 0x9853, 0x38b: 0x9853, + 0x38c: 0x77c9, 0x38d: 0x0004, 0x38e: 0x0004, 0x38f: 0x0004, 0x390: 0x0812, 0x391: 0x0812, + 0x392: 0x789a, 0x393: 0x79da, 0x396: 0x7b1a, 0x397: 0x7bfa, + 0x398: 0x0813, 0x399: 0x0813, 0x39a: 0x9b53, 0x39b: 0x9b53, 0x39d: 0x0004, + 0x39e: 0x0004, 0x39f: 0x0004, 0x3a0: 0x0812, 0x3a1: 0x0812, 0x3a2: 0x7d3a, 0x3a3: 0x7e7a, + 0x3a4: 0x7fba, 0x3a5: 0x0912, 0x3a6: 0x809a, 0x3a7: 0x817a, 0x3a8: 0x0813, 0x3a9: 0x0813, + 0x3aa: 0xa153, 0x3ab: 0xa153, 0x3ac: 0x0913, 0x3ad: 0x0004, 0x3ae: 0x0004, 0x3af: 0x0004, + 0x3b2: 0x82ba, 0x3b3: 0x83ca, 0x3b4: 0x849a, + 0x3b6: 0x857a, 0x3b7: 0x865a, 0x3b8: 0x9e53, 0x3b9: 0x9e53, 0x3ba: 0x4d53, 0x3bb: 0x4d53, + 0x3bc: 0x8799, 0x3bd: 0x0004, 0x3be: 0x0004, + // Block 0xf, offset 0x3c0 + 0x3c2: 0x0013, + 0x3c7: 0x0013, 0x3ca: 0x0012, 0x3cb: 0x0013, + 0x3cc: 0x0013, 0x3cd: 0x0013, 0x3ce: 0x0012, 0x3cf: 0x0012, 0x3d0: 0x0013, 0x3d1: 0x0013, + 0x3d2: 0x0013, 0x3d3: 0x0012, 0x3d5: 0x0013, + 0x3d9: 0x0013, 0x3da: 0x0013, 0x3db: 0x0013, 0x3dc: 0x0013, 0x3dd: 0x0013, + 0x3e4: 0x0013, 0x3e6: 0x886b, 0x3e8: 0x0013, + 0x3ea: 0x88cb, 0x3eb: 0x890b, 0x3ec: 0x0013, 0x3ed: 0x0013, 0x3ef: 0x0012, + 0x3f0: 0x0013, 0x3f1: 0x0013, 0x3f2: 0xa453, 0x3f3: 0x0013, 0x3f4: 0x0012, 0x3f5: 0x0010, + 0x3f6: 0x0010, 0x3f7: 0x0010, 0x3f8: 0x0010, 0x3f9: 0x0012, + 0x3fc: 0x0012, 0x3fd: 0x0012, 0x3fe: 0x0013, 0x3ff: 0x0013, + // Block 0x10, offset 0x400 + 0x400: 0x1a13, 0x401: 0x1a13, 0x402: 0x1e13, 0x403: 0x1e13, 0x404: 0x1a13, 0x405: 0x1a13, + 0x406: 0x2613, 0x407: 0x2613, 0x408: 0x2a13, 0x409: 0x2a13, 0x40a: 0x2e13, 0x40b: 0x2e13, + 0x40c: 0x2a13, 0x40d: 0x2a13, 0x40e: 0x2613, 0x40f: 0x2613, 0x410: 0xa752, 0x411: 0xa752, + 0x412: 0xaa52, 0x413: 0xaa52, 0x414: 0xad52, 0x415: 0xad52, 0x416: 0xaa52, 0x417: 0xaa52, + 0x418: 0xa752, 0x419: 0xa752, 0x41a: 0x1a12, 0x41b: 0x1a12, 0x41c: 0x1e12, 0x41d: 0x1e12, + 0x41e: 0x1a12, 0x41f: 0x1a12, 0x420: 0x2612, 0x421: 0x2612, 0x422: 0x2a12, 0x423: 0x2a12, + 0x424: 0x2e12, 0x425: 0x2e12, 0x426: 0x2a12, 0x427: 0x2a12, 0x428: 0x2612, 0x429: 0x2612, + // Block 0x11, offset 0x440 + 0x440: 0x6552, 0x441: 0x6552, 0x442: 0x6552, 0x443: 0x6552, 0x444: 0x6552, 0x445: 0x6552, + 0x446: 0x6552, 0x447: 0x6552, 0x448: 0x6552, 0x449: 0x6552, 0x44a: 0x6552, 0x44b: 0x6552, + 0x44c: 0x6552, 0x44d: 0x6552, 0x44e: 0x6552, 0x44f: 0x6552, 0x450: 0xb052, 0x451: 0xb052, + 0x452: 0xb052, 0x453: 0xb052, 0x454: 0xb052, 0x455: 0xb052, 0x456: 0xb052, 0x457: 0xb052, + 0x458: 0xb052, 0x459: 0xb052, 0x45a: 0xb052, 0x45b: 0xb052, 0x45c: 0xb052, 0x45d: 0xb052, + 0x45e: 0xb052, 0x460: 0x0113, 0x461: 0x0112, 0x462: 0x896b, 0x463: 0x8b53, + 0x464: 0x89cb, 0x465: 0x8a2a, 0x466: 0x8a8a, 0x467: 0x0f13, 0x468: 0x0f12, 0x469: 0x0313, + 0x46a: 0x0312, 0x46b: 0x0713, 0x46c: 0x0712, 0x46d: 0x8aeb, 0x46e: 0x8b4b, 0x46f: 0x8bab, + 0x470: 0x8c0b, 0x471: 0x0012, 0x472: 0x0113, 0x473: 0x0112, 0x474: 0x0012, 0x475: 0x0313, + 0x476: 0x0312, 0x477: 0x0012, 0x478: 0x0012, 0x479: 0x0012, 0x47a: 0x0012, 0x47b: 0x0012, + 0x47c: 0x0015, 0x47d: 0x0015, 0x47e: 0x8c6b, 0x47f: 0x8ccb, + // Block 0x12, offset 0x480 + 0x480: 0x0113, 0x481: 0x0112, 0x482: 0x0113, 0x483: 0x0112, 0x484: 0x0113, 0x485: 0x0112, + 0x486: 0x0113, 0x487: 0x0112, 0x488: 0x0014, 0x489: 0x0014, 0x48a: 0x0014, 0x48b: 0x0713, + 0x48c: 0x0712, 0x48d: 0x8d2b, 0x48e: 0x0012, 0x48f: 0x0010, 0x490: 0x0113, 0x491: 0x0112, + 0x492: 0x0113, 0x493: 0x0112, 0x494: 0x6552, 0x495: 0x0012, 0x496: 0x0113, 0x497: 0x0112, + 0x498: 0x0113, 0x499: 0x0112, 0x49a: 0x0113, 0x49b: 0x0112, 0x49c: 0x0113, 0x49d: 0x0112, + 0x49e: 0x0113, 0x49f: 0x0112, 0x4a0: 0x0113, 0x4a1: 0x0112, 0x4a2: 0x0113, 0x4a3: 0x0112, + 0x4a4: 0x0113, 0x4a5: 0x0112, 0x4a6: 0x0113, 0x4a7: 0x0112, 0x4a8: 0x0113, 0x4a9: 0x0112, + 0x4aa: 0x8d8b, 0x4ab: 0x8deb, 0x4ac: 0x8e4b, 0x4ad: 0x8eab, 0x4ae: 0x8f0b, 0x4af: 0x0012, + 0x4b0: 0x8f6b, 0x4b1: 0x8fcb, 0x4b2: 0x902b, 0x4b3: 0xb353, 0x4b4: 0x0113, 0x4b5: 0x0112, + 0x4b6: 0x0113, 0x4b7: 0x0112, 0x4b8: 0x0113, 0x4b9: 0x0112, 0x4ba: 0x0113, 0x4bb: 0x0112, + 0x4bc: 0x0113, 0x4bd: 0x0112, 0x4be: 0x0113, 0x4bf: 0x0112, + // Block 0x13, offset 0x4c0 + 0x4c0: 0x90ea, 0x4c1: 0x916a, 0x4c2: 0x91ea, 0x4c3: 0x926a, 0x4c4: 0x931a, 0x4c5: 0x93ca, + 0x4c6: 0x944a, + 0x4d3: 0x94ca, 0x4d4: 0x95aa, 0x4d5: 0x968a, 0x4d6: 0x976a, 0x4d7: 0x984a, + 0x4dd: 0x0010, + 0x4de: 0x0034, 0x4df: 0x0010, 0x4e0: 0x0010, 0x4e1: 0x0010, 0x4e2: 0x0010, 0x4e3: 0x0010, + 0x4e4: 0x0010, 0x4e5: 0x0010, 0x4e6: 0x0010, 0x4e7: 0x0010, 0x4e8: 0x0010, + 0x4ea: 0x0010, 0x4eb: 0x0010, 0x4ec: 0x0010, 0x4ed: 0x0010, 0x4ee: 0x0010, 0x4ef: 0x0010, + 0x4f0: 0x0010, 0x4f1: 0x0010, 0x4f2: 0x0010, 0x4f3: 0x0010, 0x4f4: 0x0010, 0x4f5: 0x0010, + 0x4f6: 0x0010, 0x4f8: 0x0010, 0x4f9: 0x0010, 0x4fa: 0x0010, 0x4fb: 0x0010, + 0x4fc: 0x0010, 0x4fe: 0x0010, + // Block 0x14, offset 0x500 + 0x500: 0x2213, 0x501: 0x2213, 0x502: 0x2613, 0x503: 0x2613, 0x504: 0x2213, 0x505: 0x2213, + 0x506: 0x2e13, 0x507: 0x2e13, 0x508: 0x2213, 0x509: 0x2213, 0x50a: 0x2613, 0x50b: 0x2613, + 0x50c: 0x2213, 0x50d: 0x2213, 0x50e: 0x3e13, 0x50f: 0x3e13, 0x510: 0x2213, 0x511: 0x2213, + 0x512: 0x2613, 0x513: 0x2613, 0x514: 0x2213, 0x515: 0x2213, 0x516: 0x2e13, 0x517: 0x2e13, + 0x518: 0x2213, 0x519: 0x2213, 0x51a: 0x2613, 0x51b: 0x2613, 0x51c: 0x2213, 0x51d: 0x2213, + 0x51e: 0xbc53, 0x51f: 0xbc53, 0x520: 0xbf53, 0x521: 0xbf53, 0x522: 0x2212, 0x523: 0x2212, + 0x524: 0x2612, 0x525: 0x2612, 0x526: 0x2212, 0x527: 0x2212, 0x528: 0x2e12, 0x529: 0x2e12, + 0x52a: 0x2212, 0x52b: 0x2212, 0x52c: 0x2612, 0x52d: 0x2612, 0x52e: 0x2212, 0x52f: 0x2212, + 0x530: 0x3e12, 0x531: 0x3e12, 0x532: 0x2212, 0x533: 0x2212, 0x534: 0x2612, 0x535: 0x2612, + 0x536: 0x2212, 0x537: 0x2212, 0x538: 0x2e12, 0x539: 0x2e12, 0x53a: 0x2212, 0x53b: 0x2212, + 0x53c: 0x2612, 0x53d: 0x2612, 0x53e: 0x2212, 0x53f: 0x2212, + // Block 0x15, offset 0x540 + 0x542: 0x0010, + 0x547: 0x0010, 0x549: 0x0010, 0x54b: 0x0010, + 0x54d: 0x0010, 0x54e: 0x0010, 0x54f: 0x0010, 0x551: 0x0010, + 0x552: 0x0010, 0x554: 0x0010, 0x557: 0x0010, + 0x559: 0x0010, 0x55b: 0x0010, 0x55d: 0x0010, + 0x55f: 0x0010, 0x561: 0x0010, 0x562: 0x0010, + 0x564: 0x0010, 0x567: 0x0010, 0x568: 0x0010, 0x569: 0x0010, + 0x56a: 0x0010, 0x56c: 0x0010, 0x56d: 0x0010, 0x56e: 0x0010, 0x56f: 0x0010, + 0x570: 0x0010, 0x571: 0x0010, 0x572: 0x0010, 0x574: 0x0010, 0x575: 0x0010, + 0x576: 0x0010, 0x577: 0x0010, 0x579: 0x0010, 0x57a: 0x0010, 0x57b: 0x0010, + 0x57c: 0x0010, 0x57e: 0x0010, +} + +// caseIndex: 25 blocks, 1600 entries, 3200 bytes +// Block 0 is the zero block. +var caseIndex = [1600]uint16{ + // Block 0x0, offset 0x0 + // Block 0x1, offset 0x40 + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc2: 0x14, 0xc3: 0x15, 0xc4: 0x16, 0xc5: 0x17, 0xc6: 0x01, 0xc7: 0x02, + 0xc8: 0x18, 0xc9: 0x03, 0xca: 0x04, 0xcb: 0x19, 0xcc: 0x1a, 0xcd: 0x05, 0xce: 0x06, 0xcf: 0x07, + 0xd0: 0x1b, 0xd1: 0x1c, 0xd2: 0x1d, 0xd3: 0x1e, 0xd4: 0x1f, 0xd5: 0x20, 0xd6: 0x08, 0xd7: 0x21, + 0xd8: 0x22, 0xd9: 0x23, 0xda: 0x24, 0xdb: 0x25, 0xdc: 0x26, 0xdd: 0x27, 0xde: 0x28, 0xdf: 0x29, + 0xe0: 0x02, 0xe1: 0x03, 0xe2: 0x04, 0xe3: 0x05, + 0xea: 0x06, 0xeb: 0x07, 0xec: 0x07, 0xed: 0x08, 0xef: 0x09, + 0xf0: 0x14, 0xf3: 0x16, + // Block 0x4, offset 0x100 + 0x120: 0x2a, 0x121: 0x2b, 0x122: 0x2c, 0x123: 0x2d, 0x124: 0x2e, 0x125: 0x2f, 0x126: 0x30, 0x127: 0x31, + 0x128: 0x32, 0x129: 0x33, 0x12a: 0x34, 0x12b: 0x35, 0x12c: 0x36, 0x12d: 0x37, 0x12e: 0x38, 0x12f: 0x39, + 0x130: 0x3a, 0x131: 0x3b, 0x132: 0x3c, 0x133: 0x3d, 0x134: 0x3e, 0x135: 0x3f, 0x136: 0x40, 0x137: 0x41, + 0x138: 0x42, 0x139: 0x43, 0x13a: 0x44, 0x13b: 0x45, 0x13c: 0x46, 0x13d: 0x47, 0x13e: 0x48, 0x13f: 0x49, + // Block 0x5, offset 0x140 + 0x140: 0x4a, 0x141: 0x4b, 0x142: 0x4c, 0x143: 0x09, 0x144: 0x24, 0x145: 0x24, 0x146: 0x24, 0x147: 0x24, + 0x148: 0x24, 0x149: 0x4d, 0x14a: 0x4e, 0x14b: 0x4f, 0x14c: 0x50, 0x14d: 0x51, 0x14e: 0x52, 0x14f: 0x53, + 0x150: 0x54, 0x151: 0x24, 0x152: 0x24, 0x153: 0x24, 0x154: 0x24, 0x155: 0x24, 0x156: 0x24, 0x157: 0x24, + 0x158: 0x24, 0x159: 0x55, 0x15a: 0x56, 0x15b: 0x57, 0x15c: 0x58, 0x15d: 0x59, 0x15e: 0x5a, 0x15f: 0x5b, + 0x160: 0x5c, 0x161: 0x5d, 0x162: 0x5e, 0x163: 0x5f, 0x164: 0x60, 0x165: 0x61, 0x167: 0x62, + 0x168: 0x63, 0x169: 0x64, 0x16a: 0x65, 0x16c: 0x66, 0x16d: 0x67, 0x16e: 0x68, 0x16f: 0x69, + 0x170: 0x6a, 0x171: 0x6b, 0x172: 0x6c, 0x173: 0x6d, 0x174: 0x6e, 0x175: 0x6f, 0x176: 0x70, 0x177: 0x71, + 0x178: 0x72, 0x179: 0x72, 0x17a: 0x73, 0x17b: 0x72, 0x17c: 0x74, 0x17d: 0x0a, 0x17e: 0x0b, 0x17f: 0x0c, + // Block 0x6, offset 0x180 + 0x180: 0x75, 0x181: 0x76, 0x182: 0x77, 0x183: 0x78, 0x184: 0x0d, 0x185: 0x79, 0x186: 0x7a, + 0x192: 0x7b, 0x193: 0x0e, + 0x1b0: 0x7c, 0x1b1: 0x0f, 0x1b2: 0x72, 0x1b3: 0x7d, 0x1b4: 0x7e, 0x1b5: 0x7f, 0x1b6: 0x80, 0x1b7: 0x81, + 0x1b8: 0x82, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x83, 0x1c2: 0x84, 0x1c3: 0x85, 0x1c4: 0x86, 0x1c5: 0x24, 0x1c6: 0x87, + // Block 0x8, offset 0x200 + 0x200: 0x88, 0x201: 0x24, 0x202: 0x24, 0x203: 0x24, 0x204: 0x24, 0x205: 0x24, 0x206: 0x24, 0x207: 0x24, + 0x208: 0x24, 0x209: 0x24, 0x20a: 0x24, 0x20b: 0x24, 0x20c: 0x24, 0x20d: 0x24, 0x20e: 0x24, 0x20f: 0x24, + 0x210: 0x24, 0x211: 0x24, 0x212: 0x89, 0x213: 0x8a, 0x214: 0x24, 0x215: 0x24, 0x216: 0x24, 0x217: 0x24, + 0x218: 0x8b, 0x219: 0x8c, 0x21a: 0x8d, 0x21b: 0x8e, 0x21c: 0x8f, 0x21d: 0x90, 0x21e: 0x10, 0x21f: 0x91, + 0x220: 0x92, 0x221: 0x93, 0x222: 0x24, 0x223: 0x94, 0x224: 0x95, 0x225: 0x96, 0x226: 0x97, 0x227: 0x98, + 0x228: 0x99, 0x229: 0x9a, 0x22a: 0x9b, 0x22b: 0x9c, 0x22c: 0x9d, 0x22d: 0x9e, 0x22e: 0x9f, 0x22f: 0xa0, + 0x230: 0x24, 0x231: 0x24, 0x232: 0x24, 0x233: 0x24, 0x234: 0x24, 0x235: 0x24, 0x236: 0x24, 0x237: 0x24, + 0x238: 0x24, 0x239: 0x24, 0x23a: 0x24, 0x23b: 0x24, 0x23c: 0x24, 0x23d: 0x24, 0x23e: 0x24, 0x23f: 0x24, + // Block 0x9, offset 0x240 + 0x240: 0x24, 0x241: 0x24, 0x242: 0x24, 0x243: 0x24, 0x244: 0x24, 0x245: 0x24, 0x246: 0x24, 0x247: 0x24, + 0x248: 0x24, 0x249: 0x24, 0x24a: 0x24, 0x24b: 0x24, 0x24c: 0x24, 0x24d: 0x24, 0x24e: 0x24, 0x24f: 0x24, + 0x250: 0x24, 0x251: 0x24, 0x252: 0x24, 0x253: 0x24, 0x254: 0x24, 0x255: 0x24, 0x256: 0x24, 0x257: 0x24, + 0x258: 0x24, 0x259: 0x24, 0x25a: 0x24, 0x25b: 0x24, 0x25c: 0x24, 0x25d: 0x24, 0x25e: 0x24, 0x25f: 0x24, + 0x260: 0x24, 0x261: 0x24, 0x262: 0x24, 0x263: 0x24, 0x264: 0x24, 0x265: 0x24, 0x266: 0x24, 0x267: 0x24, + 0x268: 0x24, 0x269: 0x24, 0x26a: 0x24, 0x26b: 0x24, 0x26c: 0x24, 0x26d: 0x24, 0x26e: 0x24, 0x26f: 0x24, + 0x270: 0x24, 0x271: 0x24, 0x272: 0x24, 0x273: 0x24, 0x274: 0x24, 0x275: 0x24, 0x276: 0x24, 0x277: 0x24, + 0x278: 0x24, 0x279: 0x24, 0x27a: 0x24, 0x27b: 0x24, 0x27c: 0x24, 0x27d: 0x24, 0x27e: 0x24, 0x27f: 0x24, + // Block 0xa, offset 0x280 + 0x280: 0x24, 0x281: 0x24, 0x282: 0x24, 0x283: 0x24, 0x284: 0x24, 0x285: 0x24, 0x286: 0x24, 0x287: 0x24, + 0x288: 0x24, 0x289: 0x24, 0x28a: 0x24, 0x28b: 0x24, 0x28c: 0x24, 0x28d: 0x24, 0x28e: 0x24, 0x28f: 0x24, + 0x290: 0x24, 0x291: 0x24, 0x292: 0x24, 0x293: 0x24, 0x294: 0x24, 0x295: 0x24, 0x296: 0x24, 0x297: 0x24, + 0x298: 0x24, 0x299: 0x24, 0x29a: 0x24, 0x29b: 0x24, 0x29c: 0x24, 0x29d: 0x24, 0x29e: 0xa1, 0x29f: 0xa2, + // Block 0xb, offset 0x2c0 + 0x2ec: 0x11, 0x2ed: 0xa3, 0x2ee: 0xa4, 0x2ef: 0xa5, + 0x2f0: 0x24, 0x2f1: 0x24, 0x2f2: 0x24, 0x2f3: 0x24, 0x2f4: 0xa6, 0x2f5: 0xa7, 0x2f6: 0xa8, 0x2f7: 0xa9, + 0x2f8: 0xaa, 0x2f9: 0xab, 0x2fa: 0x24, 0x2fb: 0xac, 0x2fc: 0xad, 0x2fd: 0xae, 0x2fe: 0xaf, 0x2ff: 0xb0, + // Block 0xc, offset 0x300 + 0x300: 0xb1, 0x301: 0xb2, 0x302: 0x24, 0x303: 0xb3, 0x305: 0xb4, 0x307: 0xb5, + 0x30a: 0xb6, 0x30b: 0xb7, 0x30c: 0xb8, 0x30d: 0xb9, 0x30e: 0xba, 0x30f: 0xbb, + 0x310: 0xbc, 0x311: 0xbd, 0x312: 0xbe, 0x313: 0xbf, 0x314: 0xc0, 0x315: 0xc1, + 0x318: 0x24, 0x319: 0x24, 0x31a: 0x24, 0x31b: 0x24, 0x31c: 0xc2, 0x31d: 0xc3, + 0x320: 0xc4, 0x321: 0xc5, 0x322: 0xc6, 0x323: 0xc7, 0x324: 0xc8, 0x326: 0xc9, + 0x328: 0xca, 0x329: 0xcb, 0x32a: 0xcc, 0x32b: 0xcd, 0x32c: 0x5f, 0x32d: 0xce, 0x32e: 0xcf, + 0x330: 0x24, 0x331: 0xd0, 0x332: 0xd1, 0x333: 0xd2, 0x334: 0xd3, + 0x33c: 0xd4, 0x33d: 0xd5, 0x33f: 0xd6, + // Block 0xd, offset 0x340 + 0x340: 0xd7, 0x341: 0xd8, 0x342: 0xd9, 0x343: 0xda, 0x344: 0xdb, 0x345: 0xdc, 0x346: 0xdd, 0x347: 0xde, + 0x348: 0xdf, 0x34a: 0xe0, 0x34b: 0xe1, 0x34c: 0xe2, 0x34d: 0xe3, + 0x350: 0xe4, 0x351: 0xe5, 0x352: 0xe6, 0x353: 0xe7, 0x356: 0xe8, 0x357: 0xe9, + 0x358: 0xea, 0x359: 0xeb, 0x35a: 0xec, 0x35b: 0xed, 0x35c: 0xee, + 0x360: 0xef, 0x362: 0xf0, 0x363: 0xf1, 0x366: 0xf2, 0x367: 0xf3, + 0x368: 0xf4, 0x369: 0xf5, 0x36a: 0xf6, 0x36b: 0xf7, + 0x370: 0xf8, 0x371: 0xf9, 0x372: 0xfa, 0x374: 0xfb, 0x375: 0xfc, 0x376: 0xfd, + 0x37b: 0xfe, + // Block 0xe, offset 0x380 + 0x380: 0x24, 0x381: 0x24, 0x382: 0x24, 0x383: 0x24, 0x384: 0x24, 0x385: 0x24, 0x386: 0x24, 0x387: 0x24, + 0x388: 0x24, 0x389: 0x24, 0x38a: 0x24, 0x38b: 0x24, 0x38c: 0x24, 0x38d: 0x24, 0x38e: 0xff, + 0x390: 0x24, 0x391: 0x100, 0x392: 0x24, 0x393: 0x24, 0x394: 0x24, 0x395: 0x101, + // Block 0xf, offset 0x3c0 + 0x3c0: 0x24, 0x3c1: 0x24, 0x3c2: 0x24, 0x3c3: 0x24, 0x3c4: 0x24, 0x3c5: 0x24, 0x3c6: 0x24, 0x3c7: 0x24, + 0x3c8: 0x24, 0x3c9: 0x24, 0x3ca: 0x24, 0x3cb: 0x24, 0x3cc: 0x24, 0x3cd: 0x24, 0x3ce: 0x24, 0x3cf: 0x24, + 0x3d0: 0x102, + // Block 0x10, offset 0x400 + 0x410: 0x24, 0x411: 0x24, 0x412: 0x24, 0x413: 0x24, 0x414: 0x24, 0x415: 0x24, 0x416: 0x24, 0x417: 0x24, + 0x418: 0x24, 0x419: 0x103, + // Block 0x11, offset 0x440 + 0x460: 0x24, 0x461: 0x24, 0x462: 0x24, 0x463: 0x24, 0x464: 0x24, 0x465: 0x24, 0x466: 0x24, 0x467: 0x24, + 0x468: 0xf7, 0x469: 0x104, 0x46b: 0x105, 0x46c: 0x106, 0x46d: 0x107, 0x46e: 0x108, + 0x479: 0x109, 0x47c: 0x24, 0x47d: 0x10a, 0x47e: 0x10b, 0x47f: 0x10c, + // Block 0x12, offset 0x480 + 0x4b0: 0x24, 0x4b1: 0x10d, 0x4b2: 0x10e, + // Block 0x13, offset 0x4c0 + 0x4c5: 0x10f, 0x4c6: 0x110, + 0x4c9: 0x111, + 0x4d0: 0x112, 0x4d1: 0x113, 0x4d2: 0x114, 0x4d3: 0x115, 0x4d4: 0x116, 0x4d5: 0x117, 0x4d6: 0x118, 0x4d7: 0x119, + 0x4d8: 0x11a, 0x4d9: 0x11b, 0x4da: 0x11c, 0x4db: 0x11d, 0x4dc: 0x11e, 0x4dd: 0x11f, 0x4de: 0x120, 0x4df: 0x121, + 0x4e8: 0x122, 0x4e9: 0x123, 0x4ea: 0x124, + // Block 0x14, offset 0x500 + 0x500: 0x125, 0x504: 0x126, 0x505: 0x127, + 0x50b: 0x128, + 0x520: 0x24, 0x521: 0x24, 0x522: 0x24, 0x523: 0x129, 0x524: 0x12, 0x525: 0x12a, + 0x538: 0x12b, 0x539: 0x13, 0x53a: 0x12c, + // Block 0x15, offset 0x540 + 0x544: 0x12d, 0x545: 0x12e, 0x546: 0x12f, + 0x54f: 0x130, + // Block 0x16, offset 0x580 + 0x590: 0x0a, 0x591: 0x0b, 0x592: 0x0c, 0x593: 0x0d, 0x594: 0x0e, 0x596: 0x0f, + 0x59b: 0x10, 0x59d: 0x11, 0x59e: 0x12, 0x59f: 0x13, + // Block 0x17, offset 0x5c0 + 0x5c0: 0x131, 0x5c1: 0x132, 0x5c4: 0x132, 0x5c5: 0x132, 0x5c6: 0x132, 0x5c7: 0x133, + // Block 0x18, offset 0x600 + 0x620: 0x15, +} + +// sparseOffsets: 289 entries, 578 bytes +var sparseOffsets = []uint16{0x0, 0x9, 0xf, 0x18, 0x24, 0x2e, 0x35, 0x38, 0x3c, 0x3f, 0x43, 0x4d, 0x4f, 0x57, 0x5e, 0x63, 0x71, 0x72, 0x80, 0x8f, 0x99, 0x9c, 0xa3, 0xab, 0xae, 0xb0, 0xbf, 0xc5, 0xd3, 0xde, 0xeb, 0xf6, 0x102, 0x10c, 0x118, 0x123, 0x12f, 0x13b, 0x143, 0x14c, 0x156, 0x161, 0x16d, 0x174, 0x17f, 0x184, 0x18c, 0x18f, 0x194, 0x198, 0x19c, 0x1a3, 0x1ac, 0x1b4, 0x1b5, 0x1be, 0x1c5, 0x1cd, 0x1d3, 0x1d8, 0x1dc, 0x1df, 0x1e1, 0x1e4, 0x1e9, 0x1ea, 0x1ec, 0x1ee, 0x1f0, 0x1f7, 0x1fc, 0x200, 0x209, 0x20c, 0x20f, 0x215, 0x216, 0x221, 0x222, 0x223, 0x228, 0x235, 0x23d, 0x245, 0x24e, 0x257, 0x260, 0x265, 0x268, 0x273, 0x281, 0x283, 0x28a, 0x28e, 0x29a, 0x29b, 0x2a6, 0x2ae, 0x2b6, 0x2bc, 0x2bd, 0x2cb, 0x2d0, 0x2d3, 0x2d8, 0x2dc, 0x2e2, 0x2e7, 0x2ea, 0x2ef, 0x2f4, 0x2f5, 0x2fb, 0x2fd, 0x2fe, 0x300, 0x302, 0x305, 0x306, 0x308, 0x30b, 0x311, 0x315, 0x317, 0x31c, 0x323, 0x32b, 0x334, 0x335, 0x33e, 0x342, 0x347, 0x34f, 0x355, 0x35b, 0x365, 0x36a, 0x373, 0x379, 0x380, 0x384, 0x38c, 0x38e, 0x390, 0x393, 0x395, 0x397, 0x398, 0x399, 0x39b, 0x39d, 0x3a3, 0x3a8, 0x3aa, 0x3b1, 0x3b4, 0x3b6, 0x3bc, 0x3c1, 0x3c3, 0x3c4, 0x3c5, 0x3c6, 0x3c8, 0x3ca, 0x3cc, 0x3cf, 0x3d1, 0x3d4, 0x3dc, 0x3df, 0x3e3, 0x3eb, 0x3ed, 0x3ee, 0x3ef, 0x3f1, 0x3f7, 0x3f9, 0x3fa, 0x3fc, 0x3fe, 0x400, 0x40d, 0x40e, 0x40f, 0x413, 0x415, 0x416, 0x417, 0x418, 0x419, 0x41c, 0x41f, 0x425, 0x426, 0x42a, 0x42e, 0x434, 0x437, 0x43e, 0x442, 0x446, 0x44d, 0x456, 0x45c, 0x462, 0x46c, 0x476, 0x478, 0x481, 0x487, 0x48d, 0x493, 0x496, 0x49c, 0x49f, 0x4a8, 0x4a9, 0x4b0, 0x4b4, 0x4b5, 0x4b8, 0x4ba, 0x4c1, 0x4c9, 0x4cf, 0x4d5, 0x4d6, 0x4dc, 0x4df, 0x4e7, 0x4ee, 0x4f8, 0x500, 0x503, 0x504, 0x505, 0x506, 0x508, 0x509, 0x50b, 0x50d, 0x50f, 0x513, 0x514, 0x516, 0x519, 0x51b, 0x51d, 0x51f, 0x524, 0x529, 0x52d, 0x52e, 0x531, 0x535, 0x540, 0x544, 0x54c, 0x551, 0x555, 0x558, 0x55c, 0x55f, 0x562, 0x567, 0x56b, 0x56f, 0x573, 0x577, 0x579, 0x57b, 0x57e, 0x583, 0x586, 0x588, 0x58b, 0x58d, 0x593, 0x59c, 0x5a1, 0x5a2, 0x5a5, 0x5a6, 0x5a7, 0x5a9, 0x5aa, 0x5ab} + +// sparseValues: 1451 entries, 5804 bytes +var sparseValues = [1451]valueRange{ + // Block 0x0, offset 0x0 + {value: 0x0004, lo: 0xa8, hi: 0xa8}, + {value: 0x0012, lo: 0xaa, hi: 0xaa}, + {value: 0x0014, lo: 0xad, hi: 0xad}, + {value: 0x0004, lo: 0xaf, hi: 0xaf}, + {value: 0x0004, lo: 0xb4, hi: 0xb4}, + {value: 0x001a, lo: 0xb5, hi: 0xb5}, + {value: 0x0054, lo: 0xb7, hi: 0xb7}, + {value: 0x0004, lo: 0xb8, hi: 0xb8}, + {value: 0x0012, lo: 0xba, hi: 0xba}, + // Block 0x1, offset 0x9 + {value: 0x2013, lo: 0x80, hi: 0x96}, + {value: 0x2013, lo: 0x98, hi: 0x9e}, + {value: 0x009a, lo: 0x9f, hi: 0x9f}, + {value: 0x2012, lo: 0xa0, hi: 0xb6}, + {value: 0x2012, lo: 0xb8, hi: 0xbe}, + {value: 0x0252, lo: 0xbf, hi: 0xbf}, + // Block 0x2, offset 0xf + {value: 0x0117, lo: 0x80, hi: 0xaf}, + {value: 0x011b, lo: 0xb0, hi: 0xb0}, + {value: 0x019a, lo: 0xb1, hi: 0xb1}, + {value: 0x0117, lo: 0xb2, hi: 0xb7}, + {value: 0x0012, lo: 0xb8, hi: 0xb8}, + {value: 0x0316, lo: 0xb9, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x0316, lo: 0xbd, hi: 0xbe}, + {value: 0x0553, lo: 0xbf, hi: 0xbf}, + // Block 0x3, offset 0x18 + {value: 0x0552, lo: 0x80, hi: 0x80}, + {value: 0x0316, lo: 0x81, hi: 0x82}, + {value: 0x0716, lo: 0x83, hi: 0x84}, + {value: 0x0316, lo: 0x85, hi: 0x86}, + {value: 0x0f16, lo: 0x87, hi: 0x88}, + {value: 0x01da, lo: 0x89, hi: 0x89}, + {value: 0x0117, lo: 0x8a, hi: 0xb7}, + {value: 0x0253, lo: 0xb8, hi: 0xb8}, + {value: 0x0316, lo: 0xb9, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x0316, lo: 0xbd, hi: 0xbe}, + {value: 0x028a, lo: 0xbf, hi: 0xbf}, + // Block 0x4, offset 0x24 + {value: 0x0117, lo: 0x80, hi: 0x9f}, + {value: 0x2f53, lo: 0xa0, hi: 0xa0}, + {value: 0x0012, lo: 0xa1, hi: 0xa1}, + {value: 0x0117, lo: 0xa2, hi: 0xb3}, + {value: 0x0012, lo: 0xb4, hi: 0xb9}, + {value: 0x090b, lo: 0xba, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x2953, lo: 0xbd, hi: 0xbd}, + {value: 0x098b, lo: 0xbe, hi: 0xbe}, + {value: 0x0a0a, lo: 0xbf, hi: 0xbf}, + // Block 0x5, offset 0x2e + {value: 0x0015, lo: 0x80, hi: 0x81}, + {value: 0x0014, lo: 0x82, hi: 0x97}, + {value: 0x0004, lo: 0x98, hi: 0x9d}, + {value: 0x0014, lo: 0x9e, hi: 0x9f}, + {value: 0x0015, lo: 0xa0, hi: 0xa4}, + {value: 0x0004, lo: 0xa5, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xbf}, + // Block 0x6, offset 0x35 + {value: 0x0024, lo: 0x80, hi: 0x94}, + {value: 0x0034, lo: 0x95, hi: 0xbc}, + {value: 0x0024, lo: 0xbd, hi: 0xbf}, + // Block 0x7, offset 0x38 + {value: 0x6553, lo: 0x80, hi: 0x8f}, + {value: 0x2013, lo: 0x90, hi: 0x9f}, + {value: 0x5f53, lo: 0xa0, hi: 0xaf}, + {value: 0x2012, lo: 0xb0, hi: 0xbf}, + // Block 0x8, offset 0x3c + {value: 0x5f52, lo: 0x80, hi: 0x8f}, + {value: 0x6552, lo: 0x90, hi: 0x9f}, + {value: 0x0117, lo: 0xa0, hi: 0xbf}, + // Block 0x9, offset 0x3f + {value: 0x0117, lo: 0x80, hi: 0x81}, + {value: 0x0024, lo: 0x83, hi: 0x87}, + {value: 0x0014, lo: 0x88, hi: 0x89}, + {value: 0x0117, lo: 0x8a, hi: 0xbf}, + // Block 0xa, offset 0x43 + {value: 0x0f13, lo: 0x80, hi: 0x80}, + {value: 0x0316, lo: 0x81, hi: 0x82}, + {value: 0x0716, lo: 0x83, hi: 0x84}, + {value: 0x0316, lo: 0x85, hi: 0x86}, + {value: 0x0f16, lo: 0x87, hi: 0x88}, + {value: 0x0316, lo: 0x89, hi: 0x8a}, + {value: 0x0716, lo: 0x8b, hi: 0x8c}, + {value: 0x0316, lo: 0x8d, hi: 0x8e}, + {value: 0x0f12, lo: 0x8f, hi: 0x8f}, + {value: 0x0117, lo: 0x90, hi: 0xbf}, + // Block 0xb, offset 0x4d + {value: 0x0117, lo: 0x80, hi: 0xaf}, + {value: 0x6553, lo: 0xb1, hi: 0xbf}, + // Block 0xc, offset 0x4f + {value: 0x3013, lo: 0x80, hi: 0x8f}, + {value: 0x6853, lo: 0x90, hi: 0x96}, + {value: 0x0014, lo: 0x99, hi: 0x99}, + {value: 0x0010, lo: 0x9b, hi: 0x9c}, + {value: 0x0010, lo: 0x9e, hi: 0x9e}, + {value: 0x0012, lo: 0xa0, hi: 0xa0}, + {value: 0x6552, lo: 0xa1, hi: 0xaf}, + {value: 0x3012, lo: 0xb0, hi: 0xbf}, + // Block 0xd, offset 0x57 + {value: 0x0034, lo: 0x81, hi: 0x82}, + {value: 0x0024, lo: 0x84, hi: 0x84}, + {value: 0x0034, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0x87, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0xaa}, + {value: 0x0010, lo: 0xaf, hi: 0xb3}, + {value: 0x0054, lo: 0xb4, hi: 0xb4}, + // Block 0xe, offset 0x5e + {value: 0x0014, lo: 0x80, hi: 0x85}, + {value: 0x0024, lo: 0x90, hi: 0x97}, + {value: 0x0034, lo: 0x98, hi: 0x9a}, + {value: 0x0014, lo: 0x9c, hi: 0x9c}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0xf, offset 0x63 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x8a}, + {value: 0x0034, lo: 0x8b, hi: 0x92}, + {value: 0x0024, lo: 0x93, hi: 0x94}, + {value: 0x0034, lo: 0x95, hi: 0x96}, + {value: 0x0024, lo: 0x97, hi: 0x9b}, + {value: 0x0034, lo: 0x9c, hi: 0x9c}, + {value: 0x0024, lo: 0x9d, hi: 0x9e}, + {value: 0x0034, lo: 0x9f, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0x0010, lo: 0xab, hi: 0xab}, + {value: 0x0010, lo: 0xae, hi: 0xaf}, + {value: 0x0034, lo: 0xb0, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xbf}, + // Block 0x10, offset 0x71 + {value: 0x0010, lo: 0x80, hi: 0xbf}, + // Block 0x11, offset 0x72 + {value: 0x0010, lo: 0x80, hi: 0x93}, + {value: 0x0010, lo: 0x95, hi: 0x95}, + {value: 0x0024, lo: 0x96, hi: 0x9c}, + {value: 0x0014, lo: 0x9d, hi: 0x9d}, + {value: 0x0024, lo: 0x9f, hi: 0xa2}, + {value: 0x0034, lo: 0xa3, hi: 0xa3}, + {value: 0x0024, lo: 0xa4, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xa6}, + {value: 0x0024, lo: 0xa7, hi: 0xa8}, + {value: 0x0034, lo: 0xaa, hi: 0xaa}, + {value: 0x0024, lo: 0xab, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xbc}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x12, offset 0x80 + {value: 0x0014, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0034, lo: 0x91, hi: 0x91}, + {value: 0x0010, lo: 0x92, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb0}, + {value: 0x0034, lo: 0xb1, hi: 0xb1}, + {value: 0x0024, lo: 0xb2, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0024, lo: 0xb5, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb9}, + {value: 0x0024, lo: 0xba, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbc}, + {value: 0x0024, lo: 0xbd, hi: 0xbd}, + {value: 0x0034, lo: 0xbe, hi: 0xbe}, + {value: 0x0024, lo: 0xbf, hi: 0xbf}, + // Block 0x13, offset 0x8f + {value: 0x0024, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0024, lo: 0x83, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x84}, + {value: 0x0024, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0024, lo: 0x87, hi: 0x87}, + {value: 0x0034, lo: 0x88, hi: 0x88}, + {value: 0x0024, lo: 0x89, hi: 0x8a}, + {value: 0x0010, lo: 0x8d, hi: 0xbf}, + // Block 0x14, offset 0x99 + {value: 0x0010, lo: 0x80, hi: 0xa5}, + {value: 0x0014, lo: 0xa6, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + // Block 0x15, offset 0x9c + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0024, lo: 0xab, hi: 0xb1}, + {value: 0x0034, lo: 0xb2, hi: 0xb2}, + {value: 0x0024, lo: 0xb3, hi: 0xb3}, + {value: 0x0014, lo: 0xb4, hi: 0xb5}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + {value: 0x0034, lo: 0xbd, hi: 0xbd}, + // Block 0x16, offset 0xa3 + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0024, lo: 0x96, hi: 0x99}, + {value: 0x0014, lo: 0x9a, hi: 0x9a}, + {value: 0x0024, lo: 0x9b, hi: 0xa3}, + {value: 0x0014, lo: 0xa4, hi: 0xa4}, + {value: 0x0024, lo: 0xa5, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa8}, + {value: 0x0024, lo: 0xa9, hi: 0xad}, + // Block 0x17, offset 0xab + {value: 0x0010, lo: 0x80, hi: 0x98}, + {value: 0x0034, lo: 0x99, hi: 0x9b}, + {value: 0x0010, lo: 0xa0, hi: 0xaa}, + // Block 0x18, offset 0xae + {value: 0x0010, lo: 0xa0, hi: 0xb4}, + {value: 0x0010, lo: 0xb6, hi: 0xbd}, + // Block 0x19, offset 0xb0 + {value: 0x0034, lo: 0x93, hi: 0x93}, + {value: 0x0024, lo: 0x94, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa2}, + {value: 0x0034, lo: 0xa3, hi: 0xa3}, + {value: 0x0024, lo: 0xa4, hi: 0xa5}, + {value: 0x0034, lo: 0xa6, hi: 0xa6}, + {value: 0x0024, lo: 0xa7, hi: 0xa8}, + {value: 0x0034, lo: 0xa9, hi: 0xa9}, + {value: 0x0024, lo: 0xaa, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xb2}, + {value: 0x0024, lo: 0xb3, hi: 0xb5}, + {value: 0x0034, lo: 0xb6, hi: 0xb6}, + {value: 0x0024, lo: 0xb7, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0024, lo: 0xbb, hi: 0xbf}, + // Block 0x1a, offset 0xbf + {value: 0x0014, lo: 0x80, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0xb9}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x1b, offset 0xc5 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x88}, + {value: 0x0010, lo: 0x89, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0024, lo: 0x91, hi: 0x91}, + {value: 0x0034, lo: 0x92, hi: 0x92}, + {value: 0x0024, lo: 0x93, hi: 0x94}, + {value: 0x0014, lo: 0x95, hi: 0x97}, + {value: 0x0010, lo: 0x98, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0014, lo: 0xb1, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xbf}, + // Block 0x1c, offset 0xd3 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb2}, + {value: 0x0010, lo: 0xb6, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x1d, offset 0xde + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8e, hi: 0x8e}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0x9c, hi: 0x9d}, + {value: 0x0010, lo: 0x9f, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xb1}, + {value: 0x0010, lo: 0xbc, hi: 0xbc}, + {value: 0x0024, lo: 0xbe, hi: 0xbe}, + // Block 0x1e, offset 0xeb + {value: 0x0014, lo: 0x81, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8a}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb6}, + {value: 0x0010, lo: 0xb8, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x1f, offset 0xf6 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x82}, + {value: 0x0014, lo: 0x87, hi: 0x88}, + {value: 0x0014, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0014, lo: 0x91, hi: 0x91}, + {value: 0x0010, lo: 0x99, hi: 0x9c}, + {value: 0x0010, lo: 0x9e, hi: 0x9e}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb5}, + // Block 0x20, offset 0x102 + {value: 0x0014, lo: 0x81, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8d}, + {value: 0x0010, lo: 0x8f, hi: 0x91}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x21, offset 0x10c + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x85}, + {value: 0x0014, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x89, hi: 0x89}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb9, hi: 0xb9}, + {value: 0x0014, lo: 0xba, hi: 0xbf}, + // Block 0x22, offset 0x118 + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbe}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x23, offset 0x123 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0014, lo: 0x96, hi: 0x96}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0x9c, hi: 0x9d}, + {value: 0x0010, lo: 0x9f, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + // Block 0x24, offset 0x12f + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8a}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0x95}, + {value: 0x0010, lo: 0x99, hi: 0x9a}, + {value: 0x0010, lo: 0x9c, hi: 0x9c}, + {value: 0x0010, lo: 0x9e, hi: 0x9f}, + {value: 0x0010, lo: 0xa3, hi: 0xa4}, + {value: 0x0010, lo: 0xa8, hi: 0xaa}, + {value: 0x0010, lo: 0xae, hi: 0xb9}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x25, offset 0x13b + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x82}, + {value: 0x0010, lo: 0x86, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + // Block 0x26, offset 0x143 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x83}, + {value: 0x0014, lo: 0x84, hi: 0x84}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb9}, + {value: 0x0010, lo: 0xbd, hi: 0xbd}, + {value: 0x0014, lo: 0xbe, hi: 0xbf}, + // Block 0x27, offset 0x14c + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x84}, + {value: 0x0014, lo: 0x86, hi: 0x88}, + {value: 0x0014, lo: 0x8a, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0034, lo: 0x95, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x9a}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + // Block 0x28, offset 0x156 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbe}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x29, offset 0x161 + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0014, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x95, hi: 0x96}, + {value: 0x0010, lo: 0x9e, hi: 0x9e}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb1, hi: 0xb2}, + // Block 0x2a, offset 0x16d + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x2b, offset 0x174 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x86, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8e, hi: 0x8e}, + {value: 0x0010, lo: 0x94, hi: 0x97}, + {value: 0x0010, lo: 0x9f, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xba, hi: 0xbf}, + // Block 0x2c, offset 0x17f + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x96}, + {value: 0x0010, lo: 0x9a, hi: 0xb1}, + {value: 0x0010, lo: 0xb3, hi: 0xbb}, + {value: 0x0010, lo: 0xbd, hi: 0xbd}, + // Block 0x2d, offset 0x184 + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0010, lo: 0x8f, hi: 0x91}, + {value: 0x0014, lo: 0x92, hi: 0x94}, + {value: 0x0014, lo: 0x96, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x9f}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + // Block 0x2e, offset 0x18c + {value: 0x0014, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb4, hi: 0xb7}, + {value: 0x0034, lo: 0xb8, hi: 0xba}, + // Block 0x2f, offset 0x18f + {value: 0x0004, lo: 0x86, hi: 0x86}, + {value: 0x0014, lo: 0x87, hi: 0x87}, + {value: 0x0034, lo: 0x88, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8e}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x30, offset 0x194 + {value: 0x0014, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb4, hi: 0xb7}, + {value: 0x0034, lo: 0xb8, hi: 0xba}, + {value: 0x0014, lo: 0xbb, hi: 0xbc}, + // Block 0x31, offset 0x198 + {value: 0x0004, lo: 0x86, hi: 0x86}, + {value: 0x0034, lo: 0x88, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x32, offset 0x19c + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0034, lo: 0x98, hi: 0x99}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0x0034, lo: 0xb5, hi: 0xb5}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + {value: 0x0034, lo: 0xb9, hi: 0xb9}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x33, offset 0x1a3 + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0010, lo: 0x89, hi: 0xac}, + {value: 0x0034, lo: 0xb1, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xba, hi: 0xbd}, + {value: 0x0014, lo: 0xbe, hi: 0xbe}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x34, offset 0x1ac + {value: 0x0034, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0024, lo: 0x82, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x84}, + {value: 0x0024, lo: 0x86, hi: 0x87}, + {value: 0x0010, lo: 0x88, hi: 0x8c}, + {value: 0x0014, lo: 0x8d, hi: 0x97}, + {value: 0x0014, lo: 0x99, hi: 0xbc}, + // Block 0x35, offset 0x1b4 + {value: 0x0034, lo: 0x86, hi: 0x86}, + // Block 0x36, offset 0x1b5 + {value: 0x0010, lo: 0xab, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + {value: 0x0010, lo: 0xb8, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbc}, + {value: 0x0014, lo: 0xbd, hi: 0xbe}, + // Block 0x37, offset 0x1be + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x96, hi: 0x97}, + {value: 0x0014, lo: 0x98, hi: 0x99}, + {value: 0x0014, lo: 0x9e, hi: 0xa0}, + {value: 0x0010, lo: 0xa2, hi: 0xa4}, + {value: 0x0010, lo: 0xa7, hi: 0xad}, + {value: 0x0014, lo: 0xb1, hi: 0xb4}, + // Block 0x38, offset 0x1c5 + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x84}, + {value: 0x0014, lo: 0x85, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8f, hi: 0x9c}, + {value: 0x0014, lo: 0x9d, hi: 0x9d}, + {value: 0x6c53, lo: 0xa0, hi: 0xbf}, + // Block 0x39, offset 0x1cd + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x98}, + {value: 0x0010, lo: 0x9a, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x3a, offset 0x1d3 + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb5}, + {value: 0x0010, lo: 0xb8, hi: 0xbe}, + // Block 0x3b, offset 0x1d8 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x82, hi: 0x85}, + {value: 0x0010, lo: 0x88, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0xbf}, + // Block 0x3c, offset 0x1dc + {value: 0x0010, lo: 0x80, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0x95}, + {value: 0x0010, lo: 0x98, hi: 0xbf}, + // Block 0x3d, offset 0x1df + {value: 0x0010, lo: 0x80, hi: 0x9a}, + {value: 0x0024, lo: 0x9d, hi: 0x9f}, + // Block 0x3e, offset 0x1e1 + {value: 0x0010, lo: 0x80, hi: 0x8f}, + {value: 0x7453, lo: 0xa0, hi: 0xaf}, + {value: 0x7853, lo: 0xb0, hi: 0xbf}, + // Block 0x3f, offset 0x1e4 + {value: 0x7c53, lo: 0x80, hi: 0x8f}, + {value: 0x8053, lo: 0x90, hi: 0x9f}, + {value: 0x7c53, lo: 0xa0, hi: 0xaf}, + {value: 0x0813, lo: 0xb0, hi: 0xb5}, + {value: 0x0892, lo: 0xb8, hi: 0xbd}, + // Block 0x40, offset 0x1e9 + {value: 0x0010, lo: 0x81, hi: 0xbf}, + // Block 0x41, offset 0x1ea + {value: 0x0010, lo: 0x80, hi: 0xac}, + {value: 0x0010, lo: 0xaf, hi: 0xbf}, + // Block 0x42, offset 0x1ec + {value: 0x0010, lo: 0x81, hi: 0x9a}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x43, offset 0x1ee + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0010, lo: 0xae, hi: 0xb8}, + // Block 0x44, offset 0x1f0 + {value: 0x0010, lo: 0x80, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x91}, + {value: 0x0014, lo: 0x92, hi: 0x93}, + {value: 0x0034, lo: 0x94, hi: 0x94}, + {value: 0x0010, lo: 0xa0, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + // Block 0x45, offset 0x1f7 + {value: 0x0010, lo: 0x80, hi: 0x91}, + {value: 0x0014, lo: 0x92, hi: 0x93}, + {value: 0x0010, lo: 0xa0, hi: 0xac}, + {value: 0x0010, lo: 0xae, hi: 0xb0}, + {value: 0x0014, lo: 0xb2, hi: 0xb3}, + // Block 0x46, offset 0x1fc + {value: 0x0014, lo: 0xb4, hi: 0xb5}, + {value: 0x0010, lo: 0xb6, hi: 0xb6}, + {value: 0x0014, lo: 0xb7, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x47, offset 0x200 + {value: 0x0010, lo: 0x80, hi: 0x85}, + {value: 0x0014, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0014, lo: 0x89, hi: 0x91}, + {value: 0x0034, lo: 0x92, hi: 0x92}, + {value: 0x0014, lo: 0x93, hi: 0x93}, + {value: 0x0004, lo: 0x97, hi: 0x97}, + {value: 0x0024, lo: 0x9d, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + // Block 0x48, offset 0x209 + {value: 0x0014, lo: 0x8b, hi: 0x8e}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x49, offset 0x20c + {value: 0x0010, lo: 0x80, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0xb8}, + // Block 0x4a, offset 0x20f + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0014, lo: 0x85, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0xa8}, + {value: 0x0034, lo: 0xa9, hi: 0xa9}, + {value: 0x0010, lo: 0xaa, hi: 0xaa}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x4b, offset 0x215 + {value: 0x0010, lo: 0x80, hi: 0xb5}, + // Block 0x4c, offset 0x216 + {value: 0x0010, lo: 0x80, hi: 0x9e}, + {value: 0x0014, lo: 0xa0, hi: 0xa2}, + {value: 0x0010, lo: 0xa3, hi: 0xa6}, + {value: 0x0014, lo: 0xa7, hi: 0xa8}, + {value: 0x0010, lo: 0xa9, hi: 0xab}, + {value: 0x0010, lo: 0xb0, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb2}, + {value: 0x0010, lo: 0xb3, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xb9}, + {value: 0x0024, lo: 0xba, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbb}, + // Block 0x4d, offset 0x221 + {value: 0x0010, lo: 0x86, hi: 0x8f}, + // Block 0x4e, offset 0x222 + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x4f, offset 0x223 + {value: 0x0010, lo: 0x80, hi: 0x96}, + {value: 0x0024, lo: 0x97, hi: 0x97}, + {value: 0x0034, lo: 0x98, hi: 0x98}, + {value: 0x0010, lo: 0x99, hi: 0x9a}, + {value: 0x0014, lo: 0x9b, hi: 0x9b}, + // Block 0x50, offset 0x228 + {value: 0x0010, lo: 0x95, hi: 0x95}, + {value: 0x0014, lo: 0x96, hi: 0x96}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0014, lo: 0x98, hi: 0x9e}, + {value: 0x0034, lo: 0xa0, hi: 0xa0}, + {value: 0x0010, lo: 0xa1, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa2}, + {value: 0x0010, lo: 0xa3, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xac}, + {value: 0x0010, lo: 0xad, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb4}, + {value: 0x0024, lo: 0xb5, hi: 0xbc}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0x51, offset 0x235 + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0004, lo: 0xa7, hi: 0xa7}, + {value: 0x0024, lo: 0xb0, hi: 0xb4}, + {value: 0x0034, lo: 0xb5, hi: 0xba}, + {value: 0x0024, lo: 0xbb, hi: 0xbc}, + {value: 0x0034, lo: 0xbd, hi: 0xbd}, + {value: 0x0014, lo: 0xbe, hi: 0xbe}, + // Block 0x52, offset 0x23d + {value: 0x0014, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x53, offset 0x245 + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0030, lo: 0x84, hi: 0x84}, + {value: 0x0010, lo: 0x85, hi: 0x8b}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0024, lo: 0xab, hi: 0xab}, + {value: 0x0034, lo: 0xac, hi: 0xac}, + {value: 0x0024, lo: 0xad, hi: 0xb3}, + // Block 0x54, offset 0x24e + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa5}, + {value: 0x0010, lo: 0xa6, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa9}, + {value: 0x0030, lo: 0xaa, hi: 0xaa}, + {value: 0x0034, lo: 0xab, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xbf}, + // Block 0x55, offset 0x257 + {value: 0x0010, lo: 0x80, hi: 0xa5}, + {value: 0x0034, lo: 0xa6, hi: 0xa6}, + {value: 0x0010, lo: 0xa7, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa9}, + {value: 0x0010, lo: 0xaa, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xae}, + {value: 0x0014, lo: 0xaf, hi: 0xb1}, + {value: 0x0030, lo: 0xb2, hi: 0xb3}, + // Block 0x56, offset 0x260 + {value: 0x0010, lo: 0x80, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xb3}, + {value: 0x0010, lo: 0xb4, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + // Block 0x57, offset 0x265 + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x8d, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbd}, + // Block 0x58, offset 0x268 + {value: 0x31ea, lo: 0x80, hi: 0x80}, + {value: 0x326a, lo: 0x81, hi: 0x81}, + {value: 0x32ea, lo: 0x82, hi: 0x82}, + {value: 0x336a, lo: 0x83, hi: 0x83}, + {value: 0x33ea, lo: 0x84, hi: 0x84}, + {value: 0x346a, lo: 0x85, hi: 0x85}, + {value: 0x34ea, lo: 0x86, hi: 0x86}, + {value: 0x356a, lo: 0x87, hi: 0x87}, + {value: 0x35ea, lo: 0x88, hi: 0x88}, + {value: 0x8353, lo: 0x90, hi: 0xba}, + {value: 0x8353, lo: 0xbd, hi: 0xbf}, + // Block 0x59, offset 0x273 + {value: 0x0024, lo: 0x90, hi: 0x92}, + {value: 0x0034, lo: 0x94, hi: 0x99}, + {value: 0x0024, lo: 0x9a, hi: 0x9b}, + {value: 0x0034, lo: 0x9c, hi: 0x9f}, + {value: 0x0024, lo: 0xa0, hi: 0xa0}, + {value: 0x0010, lo: 0xa1, hi: 0xa1}, + {value: 0x0034, lo: 0xa2, hi: 0xa8}, + {value: 0x0010, lo: 0xa9, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xb3}, + {value: 0x0024, lo: 0xb4, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb7}, + {value: 0x0024, lo: 0xb8, hi: 0xb9}, + {value: 0x0010, lo: 0xba, hi: 0xba}, + // Block 0x5a, offset 0x281 + {value: 0x0012, lo: 0x80, hi: 0xab}, + {value: 0x0015, lo: 0xac, hi: 0xbf}, + // Block 0x5b, offset 0x283 + {value: 0x0015, lo: 0x80, hi: 0xaa}, + {value: 0x0012, lo: 0xab, hi: 0xb7}, + {value: 0x0015, lo: 0xb8, hi: 0xb8}, + {value: 0x8752, lo: 0xb9, hi: 0xb9}, + {value: 0x0012, lo: 0xba, hi: 0xbc}, + {value: 0x8b52, lo: 0xbd, hi: 0xbd}, + {value: 0x0012, lo: 0xbe, hi: 0xbf}, + // Block 0x5c, offset 0x28a + {value: 0x0012, lo: 0x80, hi: 0x8d}, + {value: 0x8f52, lo: 0x8e, hi: 0x8e}, + {value: 0x0012, lo: 0x8f, hi: 0x9a}, + {value: 0x0015, lo: 0x9b, hi: 0xbf}, + // Block 0x5d, offset 0x28e + {value: 0x0024, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0024, lo: 0x83, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0024, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x90}, + {value: 0x0024, lo: 0x91, hi: 0xb5}, + {value: 0x0034, lo: 0xb6, hi: 0xb9}, + {value: 0x0024, lo: 0xbb, hi: 0xbb}, + {value: 0x0034, lo: 0xbc, hi: 0xbd}, + {value: 0x0024, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0x5e, offset 0x29a + {value: 0x0117, lo: 0x80, hi: 0xbf}, + // Block 0x5f, offset 0x29b + {value: 0x0117, lo: 0x80, hi: 0x95}, + {value: 0x369a, lo: 0x96, hi: 0x96}, + {value: 0x374a, lo: 0x97, hi: 0x97}, + {value: 0x37fa, lo: 0x98, hi: 0x98}, + {value: 0x38aa, lo: 0x99, hi: 0x99}, + {value: 0x395a, lo: 0x9a, hi: 0x9a}, + {value: 0x3a0a, lo: 0x9b, hi: 0x9b}, + {value: 0x0012, lo: 0x9c, hi: 0x9d}, + {value: 0x3abb, lo: 0x9e, hi: 0x9e}, + {value: 0x0012, lo: 0x9f, hi: 0x9f}, + {value: 0x0117, lo: 0xa0, hi: 0xbf}, + // Block 0x60, offset 0x2a6 + {value: 0x0812, lo: 0x80, hi: 0x87}, + {value: 0x0813, lo: 0x88, hi: 0x8f}, + {value: 0x0812, lo: 0x90, hi: 0x95}, + {value: 0x0813, lo: 0x98, hi: 0x9d}, + {value: 0x0812, lo: 0xa0, hi: 0xa7}, + {value: 0x0813, lo: 0xa8, hi: 0xaf}, + {value: 0x0812, lo: 0xb0, hi: 0xb7}, + {value: 0x0813, lo: 0xb8, hi: 0xbf}, + // Block 0x61, offset 0x2ae + {value: 0x0004, lo: 0x8b, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8f}, + {value: 0x0054, lo: 0x98, hi: 0x99}, + {value: 0x0054, lo: 0xa4, hi: 0xa4}, + {value: 0x0054, lo: 0xa7, hi: 0xa7}, + {value: 0x0014, lo: 0xaa, hi: 0xae}, + {value: 0x0010, lo: 0xaf, hi: 0xaf}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x62, offset 0x2b6 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x94, hi: 0x94}, + {value: 0x0014, lo: 0xa0, hi: 0xa4}, + {value: 0x0014, lo: 0xa6, hi: 0xaf}, + {value: 0x0015, lo: 0xb1, hi: 0xb1}, + {value: 0x0015, lo: 0xbf, hi: 0xbf}, + // Block 0x63, offset 0x2bc + {value: 0x0015, lo: 0x90, hi: 0x9c}, + // Block 0x64, offset 0x2bd + {value: 0x0024, lo: 0x90, hi: 0x91}, + {value: 0x0034, lo: 0x92, hi: 0x93}, + {value: 0x0024, lo: 0x94, hi: 0x97}, + {value: 0x0034, lo: 0x98, hi: 0x9a}, + {value: 0x0024, lo: 0x9b, hi: 0x9c}, + {value: 0x0014, lo: 0x9d, hi: 0xa0}, + {value: 0x0024, lo: 0xa1, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa4}, + {value: 0x0034, lo: 0xa5, hi: 0xa6}, + {value: 0x0024, lo: 0xa7, hi: 0xa7}, + {value: 0x0034, lo: 0xa8, hi: 0xa8}, + {value: 0x0024, lo: 0xa9, hi: 0xa9}, + {value: 0x0034, lo: 0xaa, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb0}, + // Block 0x65, offset 0x2cb + {value: 0x0016, lo: 0x85, hi: 0x86}, + {value: 0x0012, lo: 0x87, hi: 0x89}, + {value: 0xa452, lo: 0x8e, hi: 0x8e}, + {value: 0x1013, lo: 0xa0, hi: 0xaf}, + {value: 0x1012, lo: 0xb0, hi: 0xbf}, + // Block 0x66, offset 0x2d0 + {value: 0x0010, lo: 0x80, hi: 0x82}, + {value: 0x0716, lo: 0x83, hi: 0x84}, + {value: 0x0010, lo: 0x85, hi: 0x88}, + // Block 0x67, offset 0x2d3 + {value: 0xa753, lo: 0xb6, hi: 0xb7}, + {value: 0xaa53, lo: 0xb8, hi: 0xb9}, + {value: 0xad53, lo: 0xba, hi: 0xbb}, + {value: 0xaa53, lo: 0xbc, hi: 0xbd}, + {value: 0xa753, lo: 0xbe, hi: 0xbf}, + // Block 0x68, offset 0x2d8 + {value: 0x3013, lo: 0x80, hi: 0x8f}, + {value: 0x6553, lo: 0x90, hi: 0x9f}, + {value: 0xb053, lo: 0xa0, hi: 0xae}, + {value: 0x3012, lo: 0xb0, hi: 0xbf}, + // Block 0x69, offset 0x2dc + {value: 0x0117, lo: 0x80, hi: 0xa3}, + {value: 0x0012, lo: 0xa4, hi: 0xa4}, + {value: 0x0716, lo: 0xab, hi: 0xac}, + {value: 0x0316, lo: 0xad, hi: 0xae}, + {value: 0x0024, lo: 0xaf, hi: 0xb1}, + {value: 0x0117, lo: 0xb2, hi: 0xb3}, + // Block 0x6a, offset 0x2e2 + {value: 0x6c52, lo: 0x80, hi: 0x9f}, + {value: 0x7052, lo: 0xa0, hi: 0xa5}, + {value: 0x7052, lo: 0xa7, hi: 0xa7}, + {value: 0x7052, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x6b, offset 0x2e7 + {value: 0x0010, lo: 0x80, hi: 0xa7}, + {value: 0x0014, lo: 0xaf, hi: 0xaf}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0x6c, offset 0x2ea + {value: 0x0010, lo: 0x80, hi: 0x96}, + {value: 0x0010, lo: 0xa0, hi: 0xa6}, + {value: 0x0010, lo: 0xa8, hi: 0xae}, + {value: 0x0010, lo: 0xb0, hi: 0xb6}, + {value: 0x0010, lo: 0xb8, hi: 0xbe}, + // Block 0x6d, offset 0x2ef + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x88, hi: 0x8e}, + {value: 0x0010, lo: 0x90, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x9e}, + {value: 0x0024, lo: 0xa0, hi: 0xbf}, + // Block 0x6e, offset 0x2f4 + {value: 0x0014, lo: 0xaf, hi: 0xaf}, + // Block 0x6f, offset 0x2f5 + {value: 0x0014, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0xaa, hi: 0xad}, + {value: 0x0030, lo: 0xae, hi: 0xaf}, + {value: 0x0004, lo: 0xb1, hi: 0xb5}, + {value: 0x0014, lo: 0xbb, hi: 0xbb}, + {value: 0x0010, lo: 0xbc, hi: 0xbc}, + // Block 0x70, offset 0x2fb + {value: 0x0034, lo: 0x99, hi: 0x9a}, + {value: 0x0004, lo: 0x9b, hi: 0x9e}, + // Block 0x71, offset 0x2fd + {value: 0x0004, lo: 0xbc, hi: 0xbe}, + // Block 0x72, offset 0x2fe + {value: 0x0010, lo: 0x85, hi: 0xaf}, + {value: 0x0010, lo: 0xb1, hi: 0xbf}, + // Block 0x73, offset 0x300 + {value: 0x0010, lo: 0x80, hi: 0x8e}, + {value: 0x0010, lo: 0xa0, hi: 0xba}, + // Block 0x74, offset 0x302 + {value: 0x0010, lo: 0x80, hi: 0x94}, + {value: 0x0014, lo: 0x95, hi: 0x95}, + {value: 0x0010, lo: 0x96, hi: 0xbf}, + // Block 0x75, offset 0x305 + {value: 0x0010, lo: 0x80, hi: 0x8c}, + // Block 0x76, offset 0x306 + {value: 0x0010, lo: 0x90, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbd}, + // Block 0x77, offset 0x308 + {value: 0x0010, lo: 0x80, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0010, lo: 0x90, hi: 0xab}, + // Block 0x78, offset 0x30b + {value: 0x0117, lo: 0x80, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xae}, + {value: 0x0024, lo: 0xaf, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb2}, + {value: 0x0024, lo: 0xb4, hi: 0xbd}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x79, offset 0x311 + {value: 0x0117, lo: 0x80, hi: 0x9b}, + {value: 0x0015, lo: 0x9c, hi: 0x9d}, + {value: 0x0024, lo: 0x9e, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x7a, offset 0x315 + {value: 0x0010, lo: 0x80, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb1}, + // Block 0x7b, offset 0x317 + {value: 0x0004, lo: 0x80, hi: 0x96}, + {value: 0x0014, lo: 0x97, hi: 0xa1}, + {value: 0x0117, lo: 0xa2, hi: 0xaf}, + {value: 0x0012, lo: 0xb0, hi: 0xb1}, + {value: 0x0117, lo: 0xb2, hi: 0xbf}, + // Block 0x7c, offset 0x31c + {value: 0x0117, lo: 0x80, hi: 0xaf}, + {value: 0x0015, lo: 0xb0, hi: 0xb0}, + {value: 0x0012, lo: 0xb1, hi: 0xb8}, + {value: 0x0316, lo: 0xb9, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x8753, lo: 0xbd, hi: 0xbd}, + {value: 0x0117, lo: 0xbe, hi: 0xbf}, + // Block 0x7d, offset 0x323 + {value: 0x0117, lo: 0x82, hi: 0x83}, + {value: 0x6553, lo: 0x84, hi: 0x84}, + {value: 0x908b, lo: 0x85, hi: 0x85}, + {value: 0x8f53, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0xb7, hi: 0xb7}, + {value: 0x0015, lo: 0xb8, hi: 0xb9}, + {value: 0x0012, lo: 0xba, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbf}, + // Block 0x7e, offset 0x32b + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x8a}, + {value: 0x0014, lo: 0x8b, hi: 0x8b}, + {value: 0x0010, lo: 0x8c, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xa6}, + {value: 0x0010, lo: 0xa7, hi: 0xa7}, + // Block 0x7f, offset 0x334 + {value: 0x0010, lo: 0x80, hi: 0xb3}, + // Block 0x80, offset 0x335 + {value: 0x0010, lo: 0x80, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x84}, + {value: 0x0014, lo: 0x85, hi: 0x85}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0024, lo: 0xa0, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xb7}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0010, lo: 0xbd, hi: 0xbe}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x81, offset 0x33e + {value: 0x0010, lo: 0x80, hi: 0xa5}, + {value: 0x0014, lo: 0xa6, hi: 0xaa}, + {value: 0x0034, lo: 0xab, hi: 0xad}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x82, offset 0x342 + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0014, lo: 0x87, hi: 0x91}, + {value: 0x0010, lo: 0x92, hi: 0x92}, + {value: 0x0030, lo: 0x93, hi: 0x93}, + {value: 0x0010, lo: 0xa0, hi: 0xbc}, + // Block 0x83, offset 0x347 + {value: 0x0014, lo: 0x80, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0xb2}, + {value: 0x0034, lo: 0xb3, hi: 0xb3}, + {value: 0x0010, lo: 0xb4, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xb9}, + {value: 0x0010, lo: 0xba, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x84, offset 0x34f + {value: 0x0030, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0014, lo: 0xa5, hi: 0xa5}, + {value: 0x0004, lo: 0xa6, hi: 0xa6}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0x85, offset 0x355 + {value: 0x0010, lo: 0x80, hi: 0xa8}, + {value: 0x0014, lo: 0xa9, hi: 0xae}, + {value: 0x0010, lo: 0xaf, hi: 0xb0}, + {value: 0x0014, lo: 0xb1, hi: 0xb2}, + {value: 0x0010, lo: 0xb3, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb6}, + // Block 0x86, offset 0x35b + {value: 0x0010, lo: 0x80, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0010, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0004, lo: 0xb0, hi: 0xb0}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbd}, + // Block 0x87, offset 0x365 + {value: 0x0024, lo: 0xb0, hi: 0xb0}, + {value: 0x0024, lo: 0xb2, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0024, lo: 0xb7, hi: 0xb8}, + {value: 0x0024, lo: 0xbe, hi: 0xbf}, + // Block 0x88, offset 0x36a + {value: 0x0024, lo: 0x81, hi: 0x81}, + {value: 0x0004, lo: 0x9d, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xaf}, + {value: 0x0010, lo: 0xb2, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb5}, + {value: 0x0034, lo: 0xb6, hi: 0xb6}, + // Block 0x89, offset 0x373 + {value: 0x0010, lo: 0x81, hi: 0x86}, + {value: 0x0010, lo: 0x89, hi: 0x8e}, + {value: 0x0010, lo: 0x91, hi: 0x96}, + {value: 0x0010, lo: 0xa0, hi: 0xa6}, + {value: 0x0010, lo: 0xa8, hi: 0xae}, + {value: 0x0012, lo: 0xb0, hi: 0xbf}, + // Block 0x8a, offset 0x379 + {value: 0x0012, lo: 0x80, hi: 0x92}, + {value: 0xb352, lo: 0x93, hi: 0x93}, + {value: 0x0012, lo: 0x94, hi: 0x9a}, + {value: 0x0014, lo: 0x9b, hi: 0x9b}, + {value: 0x0015, lo: 0x9c, hi: 0x9f}, + {value: 0x0012, lo: 0xa0, hi: 0xa7}, + {value: 0x74d2, lo: 0xb0, hi: 0xbf}, + // Block 0x8b, offset 0x380 + {value: 0x78d2, lo: 0x80, hi: 0x8f}, + {value: 0x7cd2, lo: 0x90, hi: 0x9f}, + {value: 0x80d2, lo: 0xa0, hi: 0xaf}, + {value: 0x7cd2, lo: 0xb0, hi: 0xbf}, + // Block 0x8c, offset 0x384 + {value: 0x0010, lo: 0x80, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xa5}, + {value: 0x0010, lo: 0xa6, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa8}, + {value: 0x0010, lo: 0xa9, hi: 0xaa}, + {value: 0x0010, lo: 0xac, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0x8d, offset 0x38c + {value: 0x0010, lo: 0x80, hi: 0xa3}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x8e, offset 0x38e + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x8b, hi: 0xbb}, + // Block 0x8f, offset 0x390 + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x83, hi: 0x84}, + {value: 0x0010, lo: 0x86, hi: 0xbf}, + // Block 0x90, offset 0x393 + {value: 0x0010, lo: 0x80, hi: 0xb1}, + {value: 0x0004, lo: 0xb2, hi: 0xbf}, + // Block 0x91, offset 0x395 + {value: 0x0004, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x93, hi: 0xbf}, + // Block 0x92, offset 0x397 + {value: 0x0010, lo: 0x80, hi: 0xbd}, + // Block 0x93, offset 0x398 + {value: 0x0010, lo: 0x90, hi: 0xbf}, + // Block 0x94, offset 0x399 + {value: 0x0010, lo: 0x80, hi: 0x8f}, + {value: 0x0010, lo: 0x92, hi: 0xbf}, + // Block 0x95, offset 0x39b + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0010, lo: 0xb0, hi: 0xbb}, + // Block 0x96, offset 0x39d + {value: 0x0014, lo: 0x80, hi: 0x8f}, + {value: 0x0054, lo: 0x93, hi: 0x93}, + {value: 0x0024, lo: 0xa0, hi: 0xa6}, + {value: 0x0034, lo: 0xa7, hi: 0xad}, + {value: 0x0024, lo: 0xae, hi: 0xaf}, + {value: 0x0010, lo: 0xb3, hi: 0xb4}, + // Block 0x97, offset 0x3a3 + {value: 0x0010, lo: 0x8d, hi: 0x8f}, + {value: 0x0054, lo: 0x92, hi: 0x92}, + {value: 0x0054, lo: 0x95, hi: 0x95}, + {value: 0x0010, lo: 0xb0, hi: 0xb4}, + {value: 0x0010, lo: 0xb6, hi: 0xbf}, + // Block 0x98, offset 0x3a8 + {value: 0x0010, lo: 0x80, hi: 0xbc}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x99, offset 0x3aa + {value: 0x0054, lo: 0x87, hi: 0x87}, + {value: 0x0054, lo: 0x8e, hi: 0x8e}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0054, lo: 0x9a, hi: 0x9a}, + {value: 0x5f53, lo: 0xa1, hi: 0xba}, + {value: 0x0004, lo: 0xbe, hi: 0xbe}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x9a, offset 0x3b1 + {value: 0x0004, lo: 0x80, hi: 0x80}, + {value: 0x5f52, lo: 0x81, hi: 0x9a}, + {value: 0x0004, lo: 0xb0, hi: 0xb0}, + // Block 0x9b, offset 0x3b4 + {value: 0x0014, lo: 0x9e, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xbe}, + // Block 0x9c, offset 0x3b6 + {value: 0x0010, lo: 0x82, hi: 0x87}, + {value: 0x0010, lo: 0x8a, hi: 0x8f}, + {value: 0x0010, lo: 0x92, hi: 0x97}, + {value: 0x0010, lo: 0x9a, hi: 0x9c}, + {value: 0x0004, lo: 0xa3, hi: 0xa3}, + {value: 0x0014, lo: 0xb9, hi: 0xbb}, + // Block 0x9d, offset 0x3bc + {value: 0x0010, lo: 0x80, hi: 0x8b}, + {value: 0x0010, lo: 0x8d, hi: 0xa6}, + {value: 0x0010, lo: 0xa8, hi: 0xba}, + {value: 0x0010, lo: 0xbc, hi: 0xbd}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x9e, offset 0x3c1 + {value: 0x0010, lo: 0x80, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x9d}, + // Block 0x9f, offset 0x3c3 + {value: 0x0010, lo: 0x80, hi: 0xba}, + // Block 0xa0, offset 0x3c4 + {value: 0x0010, lo: 0x80, hi: 0xb4}, + // Block 0xa1, offset 0x3c5 + {value: 0x0034, lo: 0xbd, hi: 0xbd}, + // Block 0xa2, offset 0x3c6 + {value: 0x0010, lo: 0x80, hi: 0x9c}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0xa3, offset 0x3c8 + {value: 0x0010, lo: 0x80, hi: 0x90}, + {value: 0x0034, lo: 0xa0, hi: 0xa0}, + // Block 0xa4, offset 0x3ca + {value: 0x0010, lo: 0x80, hi: 0x9f}, + {value: 0x0010, lo: 0xad, hi: 0xbf}, + // Block 0xa5, offset 0x3cc + {value: 0x0010, lo: 0x80, hi: 0x8a}, + {value: 0x0010, lo: 0x90, hi: 0xb5}, + {value: 0x0024, lo: 0xb6, hi: 0xba}, + // Block 0xa6, offset 0x3cf + {value: 0x0010, lo: 0x80, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0xa7, offset 0x3d1 + {value: 0x0010, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x88, hi: 0x8f}, + {value: 0x0010, lo: 0x91, hi: 0x95}, + // Block 0xa8, offset 0x3d4 + {value: 0x2813, lo: 0x80, hi: 0x87}, + {value: 0x3813, lo: 0x88, hi: 0x8f}, + {value: 0x2813, lo: 0x90, hi: 0x97}, + {value: 0xb653, lo: 0x98, hi: 0x9f}, + {value: 0xb953, lo: 0xa0, hi: 0xa7}, + {value: 0x2812, lo: 0xa8, hi: 0xaf}, + {value: 0x3812, lo: 0xb0, hi: 0xb7}, + {value: 0x2812, lo: 0xb8, hi: 0xbf}, + // Block 0xa9, offset 0x3dc + {value: 0xb652, lo: 0x80, hi: 0x87}, + {value: 0xb952, lo: 0x88, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0xbf}, + // Block 0xaa, offset 0x3df + {value: 0x0010, lo: 0x80, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0xb953, lo: 0xb0, hi: 0xb7}, + {value: 0xb653, lo: 0xb8, hi: 0xbf}, + // Block 0xab, offset 0x3e3 + {value: 0x2813, lo: 0x80, hi: 0x87}, + {value: 0x3813, lo: 0x88, hi: 0x8f}, + {value: 0x2813, lo: 0x90, hi: 0x93}, + {value: 0xb952, lo: 0x98, hi: 0x9f}, + {value: 0xb652, lo: 0xa0, hi: 0xa7}, + {value: 0x2812, lo: 0xa8, hi: 0xaf}, + {value: 0x3812, lo: 0xb0, hi: 0xb7}, + {value: 0x2812, lo: 0xb8, hi: 0xbb}, + // Block 0xac, offset 0x3eb + {value: 0x0010, lo: 0x80, hi: 0xa7}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0xad, offset 0x3ed + {value: 0x0010, lo: 0x80, hi: 0xa3}, + // Block 0xae, offset 0x3ee + {value: 0x0010, lo: 0x80, hi: 0xb6}, + // Block 0xaf, offset 0x3ef + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xa7}, + // Block 0xb0, offset 0x3f1 + {value: 0x0010, lo: 0x80, hi: 0x85}, + {value: 0x0010, lo: 0x88, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0xb5}, + {value: 0x0010, lo: 0xb7, hi: 0xb8}, + {value: 0x0010, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xb1, offset 0x3f7 + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xb6}, + // Block 0xb2, offset 0x3f9 + {value: 0x0010, lo: 0x80, hi: 0x9e}, + // Block 0xb3, offset 0x3fa + {value: 0x0010, lo: 0xa0, hi: 0xb2}, + {value: 0x0010, lo: 0xb4, hi: 0xb5}, + // Block 0xb4, offset 0x3fc + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xb9}, + // Block 0xb5, offset 0x3fe + {value: 0x0010, lo: 0x80, hi: 0xb7}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0xb6, offset 0x400 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x83}, + {value: 0x0014, lo: 0x85, hi: 0x86}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0014, lo: 0x8e, hi: 0x8e}, + {value: 0x0024, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0x93}, + {value: 0x0010, lo: 0x95, hi: 0x97}, + {value: 0x0010, lo: 0x99, hi: 0xb5}, + {value: 0x0024, lo: 0xb8, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xb7, offset 0x40d + {value: 0x0010, lo: 0xa0, hi: 0xbc}, + // Block 0xb8, offset 0x40e + {value: 0x0010, lo: 0x80, hi: 0x9c}, + // Block 0xb9, offset 0x40f + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0010, lo: 0x89, hi: 0xa4}, + {value: 0x0024, lo: 0xa5, hi: 0xa5}, + {value: 0x0034, lo: 0xa6, hi: 0xa6}, + // Block 0xba, offset 0x413 + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xb2}, + // Block 0xbb, offset 0x415 + {value: 0x0010, lo: 0x80, hi: 0x91}, + // Block 0xbc, offset 0x416 + {value: 0x0010, lo: 0x80, hi: 0x88}, + // Block 0xbd, offset 0x417 + {value: 0x5653, lo: 0x80, hi: 0xb2}, + // Block 0xbe, offset 0x418 + {value: 0x5652, lo: 0x80, hi: 0xb2}, + // Block 0xbf, offset 0x419 + {value: 0x0010, lo: 0x80, hi: 0xa3}, + {value: 0x0024, lo: 0xa4, hi: 0xa7}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0xc0, offset 0x41c + {value: 0x0010, lo: 0x80, hi: 0x9c}, + {value: 0x0010, lo: 0xa7, hi: 0xa7}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0xc1, offset 0x41f + {value: 0x0010, lo: 0x80, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x87}, + {value: 0x0024, lo: 0x88, hi: 0x8a}, + {value: 0x0034, lo: 0x8b, hi: 0x8b}, + {value: 0x0024, lo: 0x8c, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x90}, + // Block 0xc2, offset 0x425 + {value: 0x0010, lo: 0xa0, hi: 0xb6}, + // Block 0xc3, offset 0x426 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbf}, + // Block 0xc4, offset 0x42a + {value: 0x0014, lo: 0x80, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xc5, offset 0x42e + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb6}, + {value: 0x0010, lo: 0xb7, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0014, lo: 0xbd, hi: 0xbd}, + // Block 0xc6, offset 0x434 + {value: 0x0014, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0xa8}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0xc7, offset 0x437 + {value: 0x0024, lo: 0x80, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0xa6}, + {value: 0x0014, lo: 0xa7, hi: 0xab}, + {value: 0x0010, lo: 0xac, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xb2}, + {value: 0x0034, lo: 0xb3, hi: 0xb4}, + {value: 0x0010, lo: 0xb6, hi: 0xbf}, + // Block 0xc8, offset 0x43e + {value: 0x0010, lo: 0x84, hi: 0x86}, + {value: 0x0010, lo: 0x90, hi: 0xb2}, + {value: 0x0034, lo: 0xb3, hi: 0xb3}, + {value: 0x0010, lo: 0xb6, hi: 0xb6}, + // Block 0xc9, offset 0x442 + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xbe}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xca, offset 0x446 + {value: 0x0030, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x84}, + {value: 0x0014, lo: 0x89, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0014, lo: 0x8b, hi: 0x8c}, + {value: 0x0010, lo: 0x90, hi: 0x9a}, + {value: 0x0010, lo: 0x9c, hi: 0x9c}, + // Block 0xcb, offset 0x44d + {value: 0x0010, lo: 0x80, hi: 0x91}, + {value: 0x0010, lo: 0x93, hi: 0xae}, + {value: 0x0014, lo: 0xaf, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0014, lo: 0xb4, hi: 0xb4}, + {value: 0x0030, lo: 0xb5, hi: 0xb5}, + {value: 0x0034, lo: 0xb6, hi: 0xb6}, + {value: 0x0014, lo: 0xb7, hi: 0xb7}, + {value: 0x0014, lo: 0xbe, hi: 0xbe}, + // Block 0xcc, offset 0x456 + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x88, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8d}, + {value: 0x0010, lo: 0x8f, hi: 0x9d}, + {value: 0x0010, lo: 0x9f, hi: 0xa8}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0xcd, offset 0x45c + {value: 0x0010, lo: 0x80, hi: 0x9e}, + {value: 0x0014, lo: 0x9f, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa2}, + {value: 0x0014, lo: 0xa3, hi: 0xa8}, + {value: 0x0034, lo: 0xa9, hi: 0xaa}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0xce, offset 0x462 + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbb, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0xcf, offset 0x46c + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0030, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0x9d, hi: 0xa3}, + {value: 0x0024, lo: 0xa6, hi: 0xac}, + {value: 0x0024, lo: 0xb0, hi: 0xb4}, + // Block 0xd0, offset 0x476 + {value: 0x0010, lo: 0x80, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbf}, + // Block 0xd1, offset 0x478 + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x84}, + {value: 0x0010, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x8a}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0024, lo: 0x9e, hi: 0x9e}, + {value: 0x0010, lo: 0x9f, hi: 0x9f}, + // Block 0xd2, offset 0x481 + {value: 0x0010, lo: 0x80, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb8}, + {value: 0x0010, lo: 0xb9, hi: 0xb9}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbe}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0xd3, offset 0x487 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0x85}, + {value: 0x0010, lo: 0x87, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0xd4, offset 0x48d + {value: 0x0010, lo: 0x80, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb5}, + {value: 0x0010, lo: 0xb8, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xd5, offset 0x493 + {value: 0x0034, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x98, hi: 0x9b}, + {value: 0x0014, lo: 0x9c, hi: 0x9d}, + // Block 0xd6, offset 0x496 + {value: 0x0010, lo: 0x80, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbc}, + {value: 0x0014, lo: 0xbd, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xd7, offset 0x49c + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x84, hi: 0x84}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0xd8, offset 0x49f + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0014, lo: 0xab, hi: 0xab}, + {value: 0x0010, lo: 0xac, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb5}, + {value: 0x0030, lo: 0xb6, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + {value: 0x0010, lo: 0xb8, hi: 0xb8}, + // Block 0xd9, offset 0x4a8 + {value: 0x0010, lo: 0x80, hi: 0x89}, + // Block 0xda, offset 0x4a9 + {value: 0x0014, lo: 0x9d, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa5}, + {value: 0x0010, lo: 0xa6, hi: 0xa6}, + {value: 0x0014, lo: 0xa7, hi: 0xaa}, + {value: 0x0034, lo: 0xab, hi: 0xab}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0xdb, offset 0x4b0 + {value: 0x0010, lo: 0x80, hi: 0xae}, + {value: 0x0014, lo: 0xaf, hi: 0xb7}, + {value: 0x0010, lo: 0xb8, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + // Block 0xdc, offset 0x4b4 + {value: 0x5f53, lo: 0xa0, hi: 0xbf}, + // Block 0xdd, offset 0x4b5 + {value: 0x5f52, lo: 0x80, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xde, offset 0x4b8 + {value: 0x0010, lo: 0xa0, hi: 0xa7}, + {value: 0x0010, lo: 0xaa, hi: 0xbf}, + // Block 0xdf, offset 0x4ba + {value: 0x0010, lo: 0x80, hi: 0x93}, + {value: 0x0014, lo: 0x94, hi: 0x97}, + {value: 0x0014, lo: 0x9a, hi: 0x9b}, + {value: 0x0010, lo: 0x9c, hi: 0x9f}, + {value: 0x0034, lo: 0xa0, hi: 0xa0}, + {value: 0x0010, lo: 0xa1, hi: 0xa1}, + {value: 0x0010, lo: 0xa3, hi: 0xa4}, + // Block 0xe0, offset 0x4c1 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x8a}, + {value: 0x0010, lo: 0x8b, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb8}, + {value: 0x0010, lo: 0xb9, hi: 0xba}, + {value: 0x0014, lo: 0xbb, hi: 0xbe}, + // Block 0xe1, offset 0x4c9 + {value: 0x0034, lo: 0x87, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0014, lo: 0x91, hi: 0x96}, + {value: 0x0010, lo: 0x97, hi: 0x98}, + {value: 0x0014, lo: 0x99, hi: 0x9b}, + {value: 0x0010, lo: 0x9c, hi: 0xbf}, + // Block 0xe2, offset 0x4cf + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0014, lo: 0x8a, hi: 0x96}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0014, lo: 0x98, hi: 0x98}, + {value: 0x0034, lo: 0x99, hi: 0x99}, + {value: 0x0010, lo: 0x9d, hi: 0x9d}, + // Block 0xe3, offset 0x4d5 + {value: 0x0010, lo: 0x80, hi: 0xb8}, + // Block 0xe4, offset 0x4d6 + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb6}, + {value: 0x0014, lo: 0xb8, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xe5, offset 0x4dc + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0010, lo: 0xb2, hi: 0xbf}, + // Block 0xe6, offset 0x4df + {value: 0x0010, lo: 0x80, hi: 0x8f}, + {value: 0x0014, lo: 0x92, hi: 0xa7}, + {value: 0x0010, lo: 0xa9, hi: 0xa9}, + {value: 0x0014, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb4, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb6}, + // Block 0xe7, offset 0x4e7 + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x88, hi: 0x89}, + {value: 0x0010, lo: 0x8b, hi: 0xb0}, + {value: 0x0014, lo: 0xb1, hi: 0xb6}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + {value: 0x0014, lo: 0xbc, hi: 0xbd}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0xe8, offset 0x4ee + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x85}, + {value: 0x0010, lo: 0x86, hi: 0x86}, + {value: 0x0014, lo: 0x87, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0010, lo: 0xa0, hi: 0xa5}, + {value: 0x0010, lo: 0xa7, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xbf}, + // Block 0xe9, offset 0x4f8 + {value: 0x0010, lo: 0x80, hi: 0x8e}, + {value: 0x0014, lo: 0x90, hi: 0x91}, + {value: 0x0010, lo: 0x93, hi: 0x94}, + {value: 0x0014, lo: 0x95, hi: 0x95}, + {value: 0x0010, lo: 0x96, hi: 0x96}, + {value: 0x0034, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0x98, hi: 0x98}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + // Block 0xea, offset 0x500 + {value: 0x0010, lo: 0xa0, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb6}, + // Block 0xeb, offset 0x503 + {value: 0x0010, lo: 0x80, hi: 0x99}, + // Block 0xec, offset 0x504 + {value: 0x0010, lo: 0x80, hi: 0xae}, + // Block 0xed, offset 0x505 + {value: 0x0010, lo: 0x80, hi: 0x83}, + // Block 0xee, offset 0x506 + {value: 0x0010, lo: 0x80, hi: 0xae}, + {value: 0x0014, lo: 0xb0, hi: 0xb8}, + // Block 0xef, offset 0x508 + {value: 0x0010, lo: 0x80, hi: 0x86}, + // Block 0xf0, offset 0x509 + {value: 0x0010, lo: 0x80, hi: 0x9e}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + // Block 0xf1, offset 0x50b + {value: 0x0010, lo: 0x90, hi: 0xad}, + {value: 0x0034, lo: 0xb0, hi: 0xb4}, + // Block 0xf2, offset 0x50d + {value: 0x0010, lo: 0x80, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb6}, + // Block 0xf3, offset 0x50f + {value: 0x0014, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0010, lo: 0xa3, hi: 0xb7}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0xf4, offset 0x513 + {value: 0x0010, lo: 0x80, hi: 0x8f}, + // Block 0xf5, offset 0x514 + {value: 0x2013, lo: 0x80, hi: 0x9f}, + {value: 0x2012, lo: 0xa0, hi: 0xbf}, + // Block 0xf6, offset 0x516 + {value: 0x0010, lo: 0x80, hi: 0x8a}, + {value: 0x0014, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0xbf}, + // Block 0xf7, offset 0x519 + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0014, lo: 0x8f, hi: 0x9f}, + // Block 0xf8, offset 0x51b + {value: 0x0014, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa3, hi: 0xa3}, + // Block 0xf9, offset 0x51d + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0010, lo: 0xb0, hi: 0xbc}, + // Block 0xfa, offset 0x51f + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0014, lo: 0x9d, hi: 0x9d}, + {value: 0x0034, lo: 0x9e, hi: 0x9e}, + {value: 0x0014, lo: 0xa0, hi: 0xa3}, + // Block 0xfb, offset 0x524 + {value: 0x0030, lo: 0xa5, hi: 0xa6}, + {value: 0x0034, lo: 0xa7, hi: 0xa9}, + {value: 0x0030, lo: 0xad, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbf}, + // Block 0xfc, offset 0x529 + {value: 0x0034, lo: 0x80, hi: 0x82}, + {value: 0x0024, lo: 0x85, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8b}, + {value: 0x0024, lo: 0xaa, hi: 0xad}, + // Block 0xfd, offset 0x52d + {value: 0x0024, lo: 0x82, hi: 0x84}, + // Block 0xfe, offset 0x52e + {value: 0x0013, lo: 0x80, hi: 0x99}, + {value: 0x0012, lo: 0x9a, hi: 0xb3}, + {value: 0x0013, lo: 0xb4, hi: 0xbf}, + // Block 0xff, offset 0x531 + {value: 0x0013, lo: 0x80, hi: 0x8d}, + {value: 0x0012, lo: 0x8e, hi: 0x94}, + {value: 0x0012, lo: 0x96, hi: 0xa7}, + {value: 0x0013, lo: 0xa8, hi: 0xbf}, + // Block 0x100, offset 0x535 + {value: 0x0013, lo: 0x80, hi: 0x81}, + {value: 0x0012, lo: 0x82, hi: 0x9b}, + {value: 0x0013, lo: 0x9c, hi: 0x9c}, + {value: 0x0013, lo: 0x9e, hi: 0x9f}, + {value: 0x0013, lo: 0xa2, hi: 0xa2}, + {value: 0x0013, lo: 0xa5, hi: 0xa6}, + {value: 0x0013, lo: 0xa9, hi: 0xac}, + {value: 0x0013, lo: 0xae, hi: 0xb5}, + {value: 0x0012, lo: 0xb6, hi: 0xb9}, + {value: 0x0012, lo: 0xbb, hi: 0xbb}, + {value: 0x0012, lo: 0xbd, hi: 0xbf}, + // Block 0x101, offset 0x540 + {value: 0x0012, lo: 0x80, hi: 0x83}, + {value: 0x0012, lo: 0x85, hi: 0x8f}, + {value: 0x0013, lo: 0x90, hi: 0xa9}, + {value: 0x0012, lo: 0xaa, hi: 0xbf}, + // Block 0x102, offset 0x544 + {value: 0x0012, lo: 0x80, hi: 0x83}, + {value: 0x0013, lo: 0x84, hi: 0x85}, + {value: 0x0013, lo: 0x87, hi: 0x8a}, + {value: 0x0013, lo: 0x8d, hi: 0x94}, + {value: 0x0013, lo: 0x96, hi: 0x9c}, + {value: 0x0012, lo: 0x9e, hi: 0xb7}, + {value: 0x0013, lo: 0xb8, hi: 0xb9}, + {value: 0x0013, lo: 0xbb, hi: 0xbe}, + // Block 0x103, offset 0x54c + {value: 0x0013, lo: 0x80, hi: 0x84}, + {value: 0x0013, lo: 0x86, hi: 0x86}, + {value: 0x0013, lo: 0x8a, hi: 0x90}, + {value: 0x0012, lo: 0x92, hi: 0xab}, + {value: 0x0013, lo: 0xac, hi: 0xbf}, + // Block 0x104, offset 0x551 + {value: 0x0013, lo: 0x80, hi: 0x85}, + {value: 0x0012, lo: 0x86, hi: 0x9f}, + {value: 0x0013, lo: 0xa0, hi: 0xb9}, + {value: 0x0012, lo: 0xba, hi: 0xbf}, + // Block 0x105, offset 0x555 + {value: 0x0012, lo: 0x80, hi: 0x93}, + {value: 0x0013, lo: 0x94, hi: 0xad}, + {value: 0x0012, lo: 0xae, hi: 0xbf}, + // Block 0x106, offset 0x558 + {value: 0x0012, lo: 0x80, hi: 0x87}, + {value: 0x0013, lo: 0x88, hi: 0xa1}, + {value: 0x0012, lo: 0xa2, hi: 0xbb}, + {value: 0x0013, lo: 0xbc, hi: 0xbf}, + // Block 0x107, offset 0x55c + {value: 0x0013, lo: 0x80, hi: 0x95}, + {value: 0x0012, lo: 0x96, hi: 0xaf}, + {value: 0x0013, lo: 0xb0, hi: 0xbf}, + // Block 0x108, offset 0x55f + {value: 0x0013, lo: 0x80, hi: 0x89}, + {value: 0x0012, lo: 0x8a, hi: 0xa5}, + {value: 0x0013, lo: 0xa8, hi: 0xbf}, + // Block 0x109, offset 0x562 + {value: 0x0013, lo: 0x80, hi: 0x80}, + {value: 0x0012, lo: 0x82, hi: 0x9a}, + {value: 0x0012, lo: 0x9c, hi: 0xa1}, + {value: 0x0013, lo: 0xa2, hi: 0xba}, + {value: 0x0012, lo: 0xbc, hi: 0xbf}, + // Block 0x10a, offset 0x567 + {value: 0x0012, lo: 0x80, hi: 0x94}, + {value: 0x0012, lo: 0x96, hi: 0x9b}, + {value: 0x0013, lo: 0x9c, hi: 0xb4}, + {value: 0x0012, lo: 0xb6, hi: 0xbf}, + // Block 0x10b, offset 0x56b + {value: 0x0012, lo: 0x80, hi: 0x8e}, + {value: 0x0012, lo: 0x90, hi: 0x95}, + {value: 0x0013, lo: 0x96, hi: 0xae}, + {value: 0x0012, lo: 0xb0, hi: 0xbf}, + // Block 0x10c, offset 0x56f + {value: 0x0012, lo: 0x80, hi: 0x88}, + {value: 0x0012, lo: 0x8a, hi: 0x8f}, + {value: 0x0013, lo: 0x90, hi: 0xa8}, + {value: 0x0012, lo: 0xaa, hi: 0xbf}, + // Block 0x10d, offset 0x573 + {value: 0x0012, lo: 0x80, hi: 0x82}, + {value: 0x0012, lo: 0x84, hi: 0x89}, + {value: 0x0017, lo: 0x8a, hi: 0x8b}, + {value: 0x0010, lo: 0x8e, hi: 0xbf}, + // Block 0x10e, offset 0x577 + {value: 0x0014, lo: 0x80, hi: 0xb6}, + {value: 0x0014, lo: 0xbb, hi: 0xbf}, + // Block 0x10f, offset 0x579 + {value: 0x0014, lo: 0x80, hi: 0xac}, + {value: 0x0014, lo: 0xb5, hi: 0xb5}, + // Block 0x110, offset 0x57b + {value: 0x0014, lo: 0x84, hi: 0x84}, + {value: 0x0014, lo: 0x9b, hi: 0x9f}, + {value: 0x0014, lo: 0xa1, hi: 0xaf}, + // Block 0x111, offset 0x57e + {value: 0x0024, lo: 0x80, hi: 0x86}, + {value: 0x0024, lo: 0x88, hi: 0x98}, + {value: 0x0024, lo: 0x9b, hi: 0xa1}, + {value: 0x0024, lo: 0xa3, hi: 0xa4}, + {value: 0x0024, lo: 0xa6, hi: 0xaa}, + // Block 0x112, offset 0x583 + {value: 0x0010, lo: 0x80, hi: 0xac}, + {value: 0x0024, lo: 0xb0, hi: 0xb6}, + {value: 0x0014, lo: 0xb7, hi: 0xbd}, + // Block 0x113, offset 0x586 + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x8e, hi: 0x8e}, + // Block 0x114, offset 0x588 + {value: 0x0010, lo: 0x80, hi: 0xab}, + {value: 0x0024, lo: 0xac, hi: 0xaf}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0x115, offset 0x58b + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0034, lo: 0x90, hi: 0x96}, + // Block 0x116, offset 0x58d + {value: 0xbc52, lo: 0x80, hi: 0x81}, + {value: 0xbf52, lo: 0x82, hi: 0x83}, + {value: 0x0024, lo: 0x84, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0014, lo: 0x8b, hi: 0x8b}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x117, offset 0x593 + {value: 0x0010, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x9f}, + {value: 0x0010, lo: 0xa1, hi: 0xa2}, + {value: 0x0010, lo: 0xa4, hi: 0xa4}, + {value: 0x0010, lo: 0xa7, hi: 0xa7}, + {value: 0x0010, lo: 0xa9, hi: 0xb2}, + {value: 0x0010, lo: 0xb4, hi: 0xb7}, + {value: 0x0010, lo: 0xb9, hi: 0xb9}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + // Block 0x118, offset 0x59c + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x8b, hi: 0x9b}, + {value: 0x0010, lo: 0xa1, hi: 0xa3}, + {value: 0x0010, lo: 0xa5, hi: 0xa9}, + {value: 0x0010, lo: 0xab, hi: 0xbb}, + // Block 0x119, offset 0x5a1 + {value: 0x0013, lo: 0xb0, hi: 0xbf}, + // Block 0x11a, offset 0x5a2 + {value: 0x0013, lo: 0x80, hi: 0x89}, + {value: 0x0013, lo: 0x90, hi: 0xa9}, + {value: 0x0013, lo: 0xb0, hi: 0xbf}, + // Block 0x11b, offset 0x5a5 + {value: 0x0013, lo: 0x80, hi: 0x89}, + // Block 0x11c, offset 0x5a6 + {value: 0x0014, lo: 0xbb, hi: 0xbf}, + // Block 0x11d, offset 0x5a7 + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0014, lo: 0xa0, hi: 0xbf}, + // Block 0x11e, offset 0x5a9 + {value: 0x0014, lo: 0x80, hi: 0xbf}, + // Block 0x11f, offset 0x5aa + {value: 0x0014, lo: 0x80, hi: 0xaf}, +} + +// Total table size 15070 bytes (14KiB); checksum: 1EB13752 diff --git a/vendor/golang.org/x/text/cases/tables13.0.0.go b/vendor/golang.org/x/text/cases/tables13.0.0.go new file mode 100644 index 00000000..cd874775 --- /dev/null +++ b/vendor/golang.org/x/text/cases/tables13.0.0.go @@ -0,0 +1,2400 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +//go:build go1.16 +// +build go1.16 + +package cases + +// UnicodeVersion is the Unicode version from which the tables in this package are derived. +const UnicodeVersion = "13.0.0" + +var xorData string = "" + // Size: 192 bytes + "\x00\x06\x07\x00\x01?\x00\x0f\x03\x00\x0f\x12\x00\x0f\x1f\x00\x0f\x1d" + + "\x00\x01\x13\x00\x0f\x16\x00\x0f\x0b\x00\x0f3\x00\x0f7\x00\x01#\x00\x0f?" + + "\x00\x0e'\x00\x0f/\x00\x0e>\x00\x0f*\x00\x0c&\x00\x0c*\x00\x0c;\x00\x0c9" + + "\x00\x0c%\x00\x01\x08\x00\x03\x0d\x00\x03\x09\x00\x02\x06\x00\x02\x02" + + "\x00\x02\x0c\x00\x01\x00\x00\x01\x03\x00\x01\x01\x00\x01 \x00\x01\x0c" + + "\x00\x01\x10\x00\x03\x10\x00\x036 \x00\x037 \x00\x0b#\x10\x00\x0b 0\x00" + + "\x0b!\x10\x00\x0b!0\x001\x00\x00\x0b(\x04\x00\x03\x04\x1e\x00\x0b)\x08" + + "\x00\x03\x0a\x00\x02:\x00\x02>\x00\x02,\x00\x02\x00\x00\x02\x10\x00\x01<" + + "\x00\x01&\x00\x01*\x00\x01.\x00\x010\x003 \x00\x01\x18\x00\x01(\x00\x01" + + "\x1e\x00\x01\x22" + +var exceptions string = "" + // Size: 2450 bytes + "\x00\x12\x12μΜΜ\x12\x12ssSSSs\x13\x18i̇i̇\x10\x09II\x13\x1bʼnʼNʼN\x11" + + "\x09sSS\x12\x12dždžDž\x12\x12dždžDŽ\x10\x12DŽDž\x12\x12ljljLj\x12\x12ljljLJ\x10\x12LJLj" + + "\x12\x12njnjNj\x12\x12njnjNJ\x10\x12NJNj\x13\x1bǰJ̌J̌\x12\x12dzdzDz\x12\x12dzdzDZ\x10" + + "\x12DZDz\x13\x18ⱥⱥ\x13\x18ⱦⱦ\x10\x1bⱾⱾ\x10\x1bⱿⱿ\x10\x1bⱯⱯ\x10\x1bⱭⱭ\x10" + + "\x1bⱰⱰ\x10\x1bꞫꞫ\x10\x1bꞬꞬ\x10\x1bꞍꞍ\x10\x1bꞪꞪ\x10\x1bꞮꞮ\x10\x1bⱢⱢ\x10" + + "\x1bꞭꞭ\x10\x1bⱮⱮ\x10\x1bⱤⱤ\x10\x1bꟅꟅ\x10\x1bꞱꞱ\x10\x1bꞲꞲ\x10\x1bꞰꞰ2\x12ι" + + "ΙΙ\x166ΐΪ́Ϊ́\x166ΰΫ́Ϋ́\x12\x12σΣΣ\x12\x12βΒΒ\x12\x12θΘΘ\x12\x12" + + "φΦΦ\x12\x12πΠΠ\x12\x12κΚΚ\x12\x12ρΡΡ\x12\x12εΕΕ\x14$եւԵՒԵւ\x10\x1bᲐა" + + "\x10\x1bᲑბ\x10\x1bᲒგ\x10\x1bᲓდ\x10\x1bᲔე\x10\x1bᲕვ\x10\x1bᲖზ\x10\x1bᲗთ" + + "\x10\x1bᲘი\x10\x1bᲙკ\x10\x1bᲚლ\x10\x1bᲛმ\x10\x1bᲜნ\x10\x1bᲝო\x10\x1bᲞპ" + + "\x10\x1bᲟჟ\x10\x1bᲠრ\x10\x1bᲡს\x10\x1bᲢტ\x10\x1bᲣუ\x10\x1bᲤფ\x10\x1bᲥქ" + + "\x10\x1bᲦღ\x10\x1bᲧყ\x10\x1bᲨშ\x10\x1bᲩჩ\x10\x1bᲪც\x10\x1bᲫძ\x10\x1bᲬწ" + + "\x10\x1bᲭჭ\x10\x1bᲮხ\x10\x1bᲯჯ\x10\x1bᲰჰ\x10\x1bᲱჱ\x10\x1bᲲჲ\x10\x1bᲳჳ" + + "\x10\x1bᲴჴ\x10\x1bᲵჵ\x10\x1bᲶჶ\x10\x1bᲷჷ\x10\x1bᲸჸ\x10\x1bᲹჹ\x10\x1bᲺჺ" + + "\x10\x1bᲽჽ\x10\x1bᲾჾ\x10\x1bᲿჿ\x12\x12вВВ\x12\x12дДД\x12\x12оОО\x12\x12с" + + "СС\x12\x12тТТ\x12\x12тТТ\x12\x12ъЪЪ\x12\x12ѣѢѢ\x13\x1bꙋꙊꙊ\x13\x1bẖH̱H̱" + + "\x13\x1bẗT̈T̈\x13\x1bẘW̊W̊\x13\x1bẙY̊Y̊\x13\x1baʾAʾAʾ\x13\x1bṡṠṠ\x12" + + "\x10ssß\x14$ὐΥ̓Υ̓\x166ὒΥ̓̀Υ̓̀\x166ὔΥ̓́Υ̓́\x166ὖΥ̓͂Υ̓͂\x15+ἀιἈΙᾈ" + + "\x15+ἁιἉΙᾉ\x15+ἂιἊΙᾊ\x15+ἃιἋΙᾋ\x15+ἄιἌΙᾌ\x15+ἅιἍΙᾍ\x15+ἆιἎΙᾎ\x15+ἇιἏΙᾏ" + + "\x15\x1dἀιᾀἈΙ\x15\x1dἁιᾁἉΙ\x15\x1dἂιᾂἊΙ\x15\x1dἃιᾃἋΙ\x15\x1dἄιᾄἌΙ\x15" + + "\x1dἅιᾅἍΙ\x15\x1dἆιᾆἎΙ\x15\x1dἇιᾇἏΙ\x15+ἠιἨΙᾘ\x15+ἡιἩΙᾙ\x15+ἢιἪΙᾚ\x15+ἣι" + + "ἫΙᾛ\x15+ἤιἬΙᾜ\x15+ἥιἭΙᾝ\x15+ἦιἮΙᾞ\x15+ἧιἯΙᾟ\x15\x1dἠιᾐἨΙ\x15\x1dἡιᾑἩΙ" + + "\x15\x1dἢιᾒἪΙ\x15\x1dἣιᾓἫΙ\x15\x1dἤιᾔἬΙ\x15\x1dἥιᾕἭΙ\x15\x1dἦιᾖἮΙ\x15" + + "\x1dἧιᾗἯΙ\x15+ὠιὨΙᾨ\x15+ὡιὩΙᾩ\x15+ὢιὪΙᾪ\x15+ὣιὫΙᾫ\x15+ὤιὬΙᾬ\x15+ὥιὭΙᾭ" + + "\x15+ὦιὮΙᾮ\x15+ὧιὯΙᾯ\x15\x1dὠιᾠὨΙ\x15\x1dὡιᾡὩΙ\x15\x1dὢιᾢὪΙ\x15\x1dὣιᾣὫΙ" + + "\x15\x1dὤιᾤὬΙ\x15\x1dὥιᾥὭΙ\x15\x1dὦιᾦὮΙ\x15\x1dὧιᾧὯΙ\x15-ὰιᾺΙᾺͅ\x14#αιΑΙ" + + "ᾼ\x14$άιΆΙΆͅ\x14$ᾶΑ͂Α͂\x166ᾶιΑ͂Ιᾼ͂\x14\x1cαιᾳΑΙ\x12\x12ιΙΙ\x15-ὴιῊΙ" + + "Ὴͅ\x14#ηιΗΙῌ\x14$ήιΉΙΉͅ\x14$ῆΗ͂Η͂\x166ῆιΗ͂Ιῌ͂\x14\x1cηιῃΗΙ\x166ῒΙ" + + "̈̀Ϊ̀\x166ΐΪ́Ϊ́\x14$ῖΙ͂Ι͂\x166ῗΪ͂Ϊ͂\x166ῢΫ̀Ϋ̀\x166ΰΫ́Ϋ" + + "́\x14$ῤΡ̓Ρ̓\x14$ῦΥ͂Υ͂\x166ῧΫ͂Ϋ͂\x15-ὼιῺΙῺͅ\x14#ωιΩΙῼ\x14$ώιΏΙΏͅ" + + "\x14$ῶΩ͂Ω͂\x166ῶιΩ͂Ιῼ͂\x14\x1cωιῳΩΙ\x12\x10ωω\x11\x08kk\x12\x10åå\x12" + + "\x10ɫɫ\x12\x10ɽɽ\x10\x12ȺȺ\x10\x12ȾȾ\x12\x10ɑɑ\x12\x10ɱɱ\x12\x10ɐɐ\x12" + + "\x10ɒɒ\x12\x10ȿȿ\x12\x10ɀɀ\x12\x10ɥɥ\x12\x10ɦɦ\x12\x10ɜɜ\x12\x10ɡɡ\x12" + + "\x10ɬɬ\x12\x10ɪɪ\x12\x10ʞʞ\x12\x10ʇʇ\x12\x10ʝʝ\x12\x10ʂʂ\x12\x12ffFFFf" + + "\x12\x12fiFIFi\x12\x12flFLFl\x13\x1bffiFFIFfi\x13\x1bfflFFLFfl\x12\x12st" + + "STSt\x12\x12stSTSt\x14$մնՄՆՄն\x14$մեՄԵՄե\x14$միՄԻՄի\x14$վնՎՆՎն\x14$մխՄԽՄ" + + "խ" + +// lookup returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *caseTrie) lookup(s []byte) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return caseValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = caseIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *caseTrie) lookupUnsafe(s []byte) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return caseValues[c0] + } + i := caseIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = caseIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = caseIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// lookupString returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *caseTrie) lookupString(s string) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return caseValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = caseIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *caseTrie) lookupStringUnsafe(s string) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return caseValues[c0] + } + i := caseIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = caseIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = caseIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// caseTrie. Total size: 12538 bytes (12.24 KiB). Checksum: af4dfa7d60c71d4c. +type caseTrie struct{} + +func newCaseTrie(i int) *caseTrie { + return &caseTrie{} +} + +// lookupValue determines the type of block n and looks up the value for b. +func (t *caseTrie) lookupValue(n uint32, b byte) uint16 { + switch { + case n < 20: + return uint16(caseValues[n<<6+uint32(b)]) + default: + n -= 20 + return uint16(sparse.lookup(n, b)) + } +} + +// caseValues: 22 blocks, 1408 entries, 2816 bytes +// The third block is the zero block. +var caseValues = [1408]uint16{ + // Block 0x0, offset 0x0 + 0x27: 0x0054, + 0x2e: 0x0054, + 0x30: 0x0010, 0x31: 0x0010, 0x32: 0x0010, 0x33: 0x0010, 0x34: 0x0010, 0x35: 0x0010, + 0x36: 0x0010, 0x37: 0x0010, 0x38: 0x0010, 0x39: 0x0010, 0x3a: 0x0054, + // Block 0x1, offset 0x40 + 0x41: 0x2013, 0x42: 0x2013, 0x43: 0x2013, 0x44: 0x2013, 0x45: 0x2013, + 0x46: 0x2013, 0x47: 0x2013, 0x48: 0x2013, 0x49: 0x2013, 0x4a: 0x2013, 0x4b: 0x2013, + 0x4c: 0x2013, 0x4d: 0x2013, 0x4e: 0x2013, 0x4f: 0x2013, 0x50: 0x2013, 0x51: 0x2013, + 0x52: 0x2013, 0x53: 0x2013, 0x54: 0x2013, 0x55: 0x2013, 0x56: 0x2013, 0x57: 0x2013, + 0x58: 0x2013, 0x59: 0x2013, 0x5a: 0x2013, + 0x5e: 0x0004, 0x5f: 0x0010, 0x60: 0x0004, 0x61: 0x2012, 0x62: 0x2012, 0x63: 0x2012, + 0x64: 0x2012, 0x65: 0x2012, 0x66: 0x2012, 0x67: 0x2012, 0x68: 0x2012, 0x69: 0x2012, + 0x6a: 0x2012, 0x6b: 0x2012, 0x6c: 0x2012, 0x6d: 0x2012, 0x6e: 0x2012, 0x6f: 0x2012, + 0x70: 0x2012, 0x71: 0x2012, 0x72: 0x2012, 0x73: 0x2012, 0x74: 0x2012, 0x75: 0x2012, + 0x76: 0x2012, 0x77: 0x2012, 0x78: 0x2012, 0x79: 0x2012, 0x7a: 0x2012, + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc0: 0x0852, 0xc1: 0x0b53, 0xc2: 0x0113, 0xc3: 0x0112, 0xc4: 0x0113, 0xc5: 0x0112, + 0xc6: 0x0b53, 0xc7: 0x0f13, 0xc8: 0x0f12, 0xc9: 0x0e53, 0xca: 0x1153, 0xcb: 0x0713, + 0xcc: 0x0712, 0xcd: 0x0012, 0xce: 0x1453, 0xcf: 0x1753, 0xd0: 0x1a53, 0xd1: 0x0313, + 0xd2: 0x0312, 0xd3: 0x1d53, 0xd4: 0x2053, 0xd5: 0x2352, 0xd6: 0x2653, 0xd7: 0x2653, + 0xd8: 0x0113, 0xd9: 0x0112, 0xda: 0x2952, 0xdb: 0x0012, 0xdc: 0x1d53, 0xdd: 0x2c53, + 0xde: 0x2f52, 0xdf: 0x3253, 0xe0: 0x0113, 0xe1: 0x0112, 0xe2: 0x0113, 0xe3: 0x0112, + 0xe4: 0x0113, 0xe5: 0x0112, 0xe6: 0x3553, 0xe7: 0x0f13, 0xe8: 0x0f12, 0xe9: 0x3853, + 0xea: 0x0012, 0xeb: 0x0012, 0xec: 0x0113, 0xed: 0x0112, 0xee: 0x3553, 0xef: 0x1f13, + 0xf0: 0x1f12, 0xf1: 0x3b53, 0xf2: 0x3e53, 0xf3: 0x0713, 0xf4: 0x0712, 0xf5: 0x0313, + 0xf6: 0x0312, 0xf7: 0x4153, 0xf8: 0x0113, 0xf9: 0x0112, 0xfa: 0x0012, 0xfb: 0x0010, + 0xfc: 0x0113, 0xfd: 0x0112, 0xfe: 0x0012, 0xff: 0x4452, + // Block 0x4, offset 0x100 + 0x100: 0x0010, 0x101: 0x0010, 0x102: 0x0010, 0x103: 0x0010, 0x104: 0x02db, 0x105: 0x0359, + 0x106: 0x03da, 0x107: 0x043b, 0x108: 0x04b9, 0x109: 0x053a, 0x10a: 0x059b, 0x10b: 0x0619, + 0x10c: 0x069a, 0x10d: 0x0313, 0x10e: 0x0312, 0x10f: 0x1f13, 0x110: 0x1f12, 0x111: 0x0313, + 0x112: 0x0312, 0x113: 0x0713, 0x114: 0x0712, 0x115: 0x0313, 0x116: 0x0312, 0x117: 0x0f13, + 0x118: 0x0f12, 0x119: 0x0313, 0x11a: 0x0312, 0x11b: 0x0713, 0x11c: 0x0712, 0x11d: 0x1452, + 0x11e: 0x0113, 0x11f: 0x0112, 0x120: 0x0113, 0x121: 0x0112, 0x122: 0x0113, 0x123: 0x0112, + 0x124: 0x0113, 0x125: 0x0112, 0x126: 0x0113, 0x127: 0x0112, 0x128: 0x0113, 0x129: 0x0112, + 0x12a: 0x0113, 0x12b: 0x0112, 0x12c: 0x0113, 0x12d: 0x0112, 0x12e: 0x0113, 0x12f: 0x0112, + 0x130: 0x06fa, 0x131: 0x07ab, 0x132: 0x0829, 0x133: 0x08aa, 0x134: 0x0113, 0x135: 0x0112, + 0x136: 0x2353, 0x137: 0x4453, 0x138: 0x0113, 0x139: 0x0112, 0x13a: 0x0113, 0x13b: 0x0112, + 0x13c: 0x0113, 0x13d: 0x0112, 0x13e: 0x0113, 0x13f: 0x0112, + // Block 0x5, offset 0x140 + 0x140: 0x0a8a, 0x141: 0x0313, 0x142: 0x0312, 0x143: 0x0853, 0x144: 0x4753, 0x145: 0x4a53, + 0x146: 0x0113, 0x147: 0x0112, 0x148: 0x0113, 0x149: 0x0112, 0x14a: 0x0113, 0x14b: 0x0112, + 0x14c: 0x0113, 0x14d: 0x0112, 0x14e: 0x0113, 0x14f: 0x0112, 0x150: 0x0b0a, 0x151: 0x0b8a, + 0x152: 0x0c0a, 0x153: 0x0b52, 0x154: 0x0b52, 0x155: 0x0012, 0x156: 0x0e52, 0x157: 0x1152, + 0x158: 0x0012, 0x159: 0x1752, 0x15a: 0x0012, 0x15b: 0x1a52, 0x15c: 0x0c8a, 0x15d: 0x0012, + 0x15e: 0x0012, 0x15f: 0x0012, 0x160: 0x1d52, 0x161: 0x0d0a, 0x162: 0x0012, 0x163: 0x2052, + 0x164: 0x0012, 0x165: 0x0d8a, 0x166: 0x0e0a, 0x167: 0x0012, 0x168: 0x2652, 0x169: 0x2652, + 0x16a: 0x0e8a, 0x16b: 0x0f0a, 0x16c: 0x0f8a, 0x16d: 0x0012, 0x16e: 0x0012, 0x16f: 0x1d52, + 0x170: 0x0012, 0x171: 0x100a, 0x172: 0x2c52, 0x173: 0x0012, 0x174: 0x0012, 0x175: 0x3252, + 0x176: 0x0012, 0x177: 0x0012, 0x178: 0x0012, 0x179: 0x0012, 0x17a: 0x0012, 0x17b: 0x0012, + 0x17c: 0x0012, 0x17d: 0x108a, 0x17e: 0x0012, 0x17f: 0x0012, + // Block 0x6, offset 0x180 + 0x180: 0x3552, 0x181: 0x0012, 0x182: 0x110a, 0x183: 0x3852, 0x184: 0x0012, 0x185: 0x0012, + 0x186: 0x0012, 0x187: 0x118a, 0x188: 0x3552, 0x189: 0x4752, 0x18a: 0x3b52, 0x18b: 0x3e52, + 0x18c: 0x4a52, 0x18d: 0x0012, 0x18e: 0x0012, 0x18f: 0x0012, 0x190: 0x0012, 0x191: 0x0012, + 0x192: 0x4152, 0x193: 0x0012, 0x194: 0x0010, 0x195: 0x0012, 0x196: 0x0012, 0x197: 0x0012, + 0x198: 0x0012, 0x199: 0x0012, 0x19a: 0x0012, 0x19b: 0x0012, 0x19c: 0x0012, 0x19d: 0x120a, + 0x19e: 0x128a, 0x19f: 0x0012, 0x1a0: 0x0012, 0x1a1: 0x0012, 0x1a2: 0x0012, 0x1a3: 0x0012, + 0x1a4: 0x0012, 0x1a5: 0x0012, 0x1a6: 0x0012, 0x1a7: 0x0012, 0x1a8: 0x0012, 0x1a9: 0x0012, + 0x1aa: 0x0012, 0x1ab: 0x0012, 0x1ac: 0x0012, 0x1ad: 0x0012, 0x1ae: 0x0012, 0x1af: 0x0012, + 0x1b0: 0x0015, 0x1b1: 0x0015, 0x1b2: 0x0015, 0x1b3: 0x0015, 0x1b4: 0x0015, 0x1b5: 0x0015, + 0x1b6: 0x0015, 0x1b7: 0x0015, 0x1b8: 0x0015, 0x1b9: 0x0014, 0x1ba: 0x0014, 0x1bb: 0x0014, + 0x1bc: 0x0014, 0x1bd: 0x0014, 0x1be: 0x0014, 0x1bf: 0x0014, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x0024, 0x1c1: 0x0024, 0x1c2: 0x0024, 0x1c3: 0x0024, 0x1c4: 0x0024, 0x1c5: 0x130d, + 0x1c6: 0x0024, 0x1c7: 0x0034, 0x1c8: 0x0034, 0x1c9: 0x0034, 0x1ca: 0x0024, 0x1cb: 0x0024, + 0x1cc: 0x0024, 0x1cd: 0x0034, 0x1ce: 0x0034, 0x1cf: 0x0014, 0x1d0: 0x0024, 0x1d1: 0x0024, + 0x1d2: 0x0024, 0x1d3: 0x0034, 0x1d4: 0x0034, 0x1d5: 0x0034, 0x1d6: 0x0034, 0x1d7: 0x0024, + 0x1d8: 0x0034, 0x1d9: 0x0034, 0x1da: 0x0034, 0x1db: 0x0024, 0x1dc: 0x0034, 0x1dd: 0x0034, + 0x1de: 0x0034, 0x1df: 0x0034, 0x1e0: 0x0034, 0x1e1: 0x0034, 0x1e2: 0x0034, 0x1e3: 0x0024, + 0x1e4: 0x0024, 0x1e5: 0x0024, 0x1e6: 0x0024, 0x1e7: 0x0024, 0x1e8: 0x0024, 0x1e9: 0x0024, + 0x1ea: 0x0024, 0x1eb: 0x0024, 0x1ec: 0x0024, 0x1ed: 0x0024, 0x1ee: 0x0024, 0x1ef: 0x0024, + 0x1f0: 0x0113, 0x1f1: 0x0112, 0x1f2: 0x0113, 0x1f3: 0x0112, 0x1f4: 0x0014, 0x1f5: 0x0004, + 0x1f6: 0x0113, 0x1f7: 0x0112, 0x1fa: 0x0015, 0x1fb: 0x4d52, + 0x1fc: 0x5052, 0x1fd: 0x5052, 0x1ff: 0x5353, + // Block 0x8, offset 0x200 + 0x204: 0x0004, 0x205: 0x0004, + 0x206: 0x2a13, 0x207: 0x0054, 0x208: 0x2513, 0x209: 0x2713, 0x20a: 0x2513, + 0x20c: 0x5653, 0x20e: 0x5953, 0x20f: 0x5c53, 0x210: 0x138a, 0x211: 0x2013, + 0x212: 0x2013, 0x213: 0x2013, 0x214: 0x2013, 0x215: 0x2013, 0x216: 0x2013, 0x217: 0x2013, + 0x218: 0x2013, 0x219: 0x2013, 0x21a: 0x2013, 0x21b: 0x2013, 0x21c: 0x2013, 0x21d: 0x2013, + 0x21e: 0x2013, 0x21f: 0x2013, 0x220: 0x5f53, 0x221: 0x5f53, 0x223: 0x5f53, + 0x224: 0x5f53, 0x225: 0x5f53, 0x226: 0x5f53, 0x227: 0x5f53, 0x228: 0x5f53, 0x229: 0x5f53, + 0x22a: 0x5f53, 0x22b: 0x5f53, 0x22c: 0x2a12, 0x22d: 0x2512, 0x22e: 0x2712, 0x22f: 0x2512, + 0x230: 0x14ca, 0x231: 0x2012, 0x232: 0x2012, 0x233: 0x2012, 0x234: 0x2012, 0x235: 0x2012, + 0x236: 0x2012, 0x237: 0x2012, 0x238: 0x2012, 0x239: 0x2012, 0x23a: 0x2012, 0x23b: 0x2012, + 0x23c: 0x2012, 0x23d: 0x2012, 0x23e: 0x2012, 0x23f: 0x2012, + // Block 0x9, offset 0x240 + 0x240: 0x5f52, 0x241: 0x5f52, 0x242: 0x160a, 0x243: 0x5f52, 0x244: 0x5f52, 0x245: 0x5f52, + 0x246: 0x5f52, 0x247: 0x5f52, 0x248: 0x5f52, 0x249: 0x5f52, 0x24a: 0x5f52, 0x24b: 0x5f52, + 0x24c: 0x5652, 0x24d: 0x5952, 0x24e: 0x5c52, 0x24f: 0x1813, 0x250: 0x168a, 0x251: 0x170a, + 0x252: 0x0013, 0x253: 0x0013, 0x254: 0x0013, 0x255: 0x178a, 0x256: 0x180a, 0x257: 0x1812, + 0x258: 0x0113, 0x259: 0x0112, 0x25a: 0x0113, 0x25b: 0x0112, 0x25c: 0x0113, 0x25d: 0x0112, + 0x25e: 0x0113, 0x25f: 0x0112, 0x260: 0x0113, 0x261: 0x0112, 0x262: 0x0113, 0x263: 0x0112, + 0x264: 0x0113, 0x265: 0x0112, 0x266: 0x0113, 0x267: 0x0112, 0x268: 0x0113, 0x269: 0x0112, + 0x26a: 0x0113, 0x26b: 0x0112, 0x26c: 0x0113, 0x26d: 0x0112, 0x26e: 0x0113, 0x26f: 0x0112, + 0x270: 0x188a, 0x271: 0x190a, 0x272: 0x0b12, 0x273: 0x5352, 0x274: 0x6253, 0x275: 0x198a, + 0x277: 0x0f13, 0x278: 0x0f12, 0x279: 0x0b13, 0x27a: 0x0113, 0x27b: 0x0112, + 0x27c: 0x0012, 0x27d: 0x4d53, 0x27e: 0x5053, 0x27f: 0x5053, + // Block 0xa, offset 0x280 + 0x280: 0x6852, 0x281: 0x6852, 0x282: 0x6852, 0x283: 0x6852, 0x284: 0x6852, 0x285: 0x6852, + 0x286: 0x6852, 0x287: 0x1a0a, 0x288: 0x0012, 0x28a: 0x0010, + 0x291: 0x0034, + 0x292: 0x0024, 0x293: 0x0024, 0x294: 0x0024, 0x295: 0x0024, 0x296: 0x0034, 0x297: 0x0024, + 0x298: 0x0024, 0x299: 0x0024, 0x29a: 0x0034, 0x29b: 0x0034, 0x29c: 0x0024, 0x29d: 0x0024, + 0x29e: 0x0024, 0x29f: 0x0024, 0x2a0: 0x0024, 0x2a1: 0x0024, 0x2a2: 0x0034, 0x2a3: 0x0034, + 0x2a4: 0x0034, 0x2a5: 0x0034, 0x2a6: 0x0034, 0x2a7: 0x0034, 0x2a8: 0x0024, 0x2a9: 0x0024, + 0x2aa: 0x0034, 0x2ab: 0x0024, 0x2ac: 0x0024, 0x2ad: 0x0034, 0x2ae: 0x0034, 0x2af: 0x0024, + 0x2b0: 0x0034, 0x2b1: 0x0034, 0x2b2: 0x0034, 0x2b3: 0x0034, 0x2b4: 0x0034, 0x2b5: 0x0034, + 0x2b6: 0x0034, 0x2b7: 0x0034, 0x2b8: 0x0034, 0x2b9: 0x0034, 0x2ba: 0x0034, 0x2bb: 0x0034, + 0x2bc: 0x0034, 0x2bd: 0x0034, 0x2bf: 0x0034, + // Block 0xb, offset 0x2c0 + 0x2c0: 0x7053, 0x2c1: 0x7053, 0x2c2: 0x7053, 0x2c3: 0x7053, 0x2c4: 0x7053, 0x2c5: 0x7053, + 0x2c7: 0x7053, + 0x2cd: 0x7053, 0x2d0: 0x1aea, 0x2d1: 0x1b6a, + 0x2d2: 0x1bea, 0x2d3: 0x1c6a, 0x2d4: 0x1cea, 0x2d5: 0x1d6a, 0x2d6: 0x1dea, 0x2d7: 0x1e6a, + 0x2d8: 0x1eea, 0x2d9: 0x1f6a, 0x2da: 0x1fea, 0x2db: 0x206a, 0x2dc: 0x20ea, 0x2dd: 0x216a, + 0x2de: 0x21ea, 0x2df: 0x226a, 0x2e0: 0x22ea, 0x2e1: 0x236a, 0x2e2: 0x23ea, 0x2e3: 0x246a, + 0x2e4: 0x24ea, 0x2e5: 0x256a, 0x2e6: 0x25ea, 0x2e7: 0x266a, 0x2e8: 0x26ea, 0x2e9: 0x276a, + 0x2ea: 0x27ea, 0x2eb: 0x286a, 0x2ec: 0x28ea, 0x2ed: 0x296a, 0x2ee: 0x29ea, 0x2ef: 0x2a6a, + 0x2f0: 0x2aea, 0x2f1: 0x2b6a, 0x2f2: 0x2bea, 0x2f3: 0x2c6a, 0x2f4: 0x2cea, 0x2f5: 0x2d6a, + 0x2f6: 0x2dea, 0x2f7: 0x2e6a, 0x2f8: 0x2eea, 0x2f9: 0x2f6a, 0x2fa: 0x2fea, + 0x2fc: 0x0014, 0x2fd: 0x306a, 0x2fe: 0x30ea, 0x2ff: 0x316a, + // Block 0xc, offset 0x300 + 0x300: 0x0812, 0x301: 0x0812, 0x302: 0x0812, 0x303: 0x0812, 0x304: 0x0812, 0x305: 0x0812, + 0x308: 0x0813, 0x309: 0x0813, 0x30a: 0x0813, 0x30b: 0x0813, + 0x30c: 0x0813, 0x30d: 0x0813, 0x310: 0x3b1a, 0x311: 0x0812, + 0x312: 0x3bfa, 0x313: 0x0812, 0x314: 0x3d3a, 0x315: 0x0812, 0x316: 0x3e7a, 0x317: 0x0812, + 0x319: 0x0813, 0x31b: 0x0813, 0x31d: 0x0813, + 0x31f: 0x0813, 0x320: 0x0812, 0x321: 0x0812, 0x322: 0x0812, 0x323: 0x0812, + 0x324: 0x0812, 0x325: 0x0812, 0x326: 0x0812, 0x327: 0x0812, 0x328: 0x0813, 0x329: 0x0813, + 0x32a: 0x0813, 0x32b: 0x0813, 0x32c: 0x0813, 0x32d: 0x0813, 0x32e: 0x0813, 0x32f: 0x0813, + 0x330: 0x9252, 0x331: 0x9252, 0x332: 0x9552, 0x333: 0x9552, 0x334: 0x9852, 0x335: 0x9852, + 0x336: 0x9b52, 0x337: 0x9b52, 0x338: 0x9e52, 0x339: 0x9e52, 0x33a: 0xa152, 0x33b: 0xa152, + 0x33c: 0x4d52, 0x33d: 0x4d52, + // Block 0xd, offset 0x340 + 0x340: 0x3fba, 0x341: 0x40aa, 0x342: 0x419a, 0x343: 0x428a, 0x344: 0x437a, 0x345: 0x446a, + 0x346: 0x455a, 0x347: 0x464a, 0x348: 0x4739, 0x349: 0x4829, 0x34a: 0x4919, 0x34b: 0x4a09, + 0x34c: 0x4af9, 0x34d: 0x4be9, 0x34e: 0x4cd9, 0x34f: 0x4dc9, 0x350: 0x4eba, 0x351: 0x4faa, + 0x352: 0x509a, 0x353: 0x518a, 0x354: 0x527a, 0x355: 0x536a, 0x356: 0x545a, 0x357: 0x554a, + 0x358: 0x5639, 0x359: 0x5729, 0x35a: 0x5819, 0x35b: 0x5909, 0x35c: 0x59f9, 0x35d: 0x5ae9, + 0x35e: 0x5bd9, 0x35f: 0x5cc9, 0x360: 0x5dba, 0x361: 0x5eaa, 0x362: 0x5f9a, 0x363: 0x608a, + 0x364: 0x617a, 0x365: 0x626a, 0x366: 0x635a, 0x367: 0x644a, 0x368: 0x6539, 0x369: 0x6629, + 0x36a: 0x6719, 0x36b: 0x6809, 0x36c: 0x68f9, 0x36d: 0x69e9, 0x36e: 0x6ad9, 0x36f: 0x6bc9, + 0x370: 0x0812, 0x371: 0x0812, 0x372: 0x6cba, 0x373: 0x6dca, 0x374: 0x6e9a, + 0x376: 0x6f7a, 0x377: 0x705a, 0x378: 0x0813, 0x379: 0x0813, 0x37a: 0x9253, 0x37b: 0x9253, + 0x37c: 0x7199, 0x37d: 0x0004, 0x37e: 0x726a, 0x37f: 0x0004, + // Block 0xe, offset 0x380 + 0x380: 0x0004, 0x381: 0x0004, 0x382: 0x72ea, 0x383: 0x73fa, 0x384: 0x74ca, + 0x386: 0x75aa, 0x387: 0x768a, 0x388: 0x9553, 0x389: 0x9553, 0x38a: 0x9853, 0x38b: 0x9853, + 0x38c: 0x77c9, 0x38d: 0x0004, 0x38e: 0x0004, 0x38f: 0x0004, 0x390: 0x0812, 0x391: 0x0812, + 0x392: 0x789a, 0x393: 0x79da, 0x396: 0x7b1a, 0x397: 0x7bfa, + 0x398: 0x0813, 0x399: 0x0813, 0x39a: 0x9b53, 0x39b: 0x9b53, 0x39d: 0x0004, + 0x39e: 0x0004, 0x39f: 0x0004, 0x3a0: 0x0812, 0x3a1: 0x0812, 0x3a2: 0x7d3a, 0x3a3: 0x7e7a, + 0x3a4: 0x7fba, 0x3a5: 0x0912, 0x3a6: 0x809a, 0x3a7: 0x817a, 0x3a8: 0x0813, 0x3a9: 0x0813, + 0x3aa: 0xa153, 0x3ab: 0xa153, 0x3ac: 0x0913, 0x3ad: 0x0004, 0x3ae: 0x0004, 0x3af: 0x0004, + 0x3b2: 0x82ba, 0x3b3: 0x83ca, 0x3b4: 0x849a, + 0x3b6: 0x857a, 0x3b7: 0x865a, 0x3b8: 0x9e53, 0x3b9: 0x9e53, 0x3ba: 0x4d53, 0x3bb: 0x4d53, + 0x3bc: 0x8799, 0x3bd: 0x0004, 0x3be: 0x0004, + // Block 0xf, offset 0x3c0 + 0x3c2: 0x0013, + 0x3c7: 0x0013, 0x3ca: 0x0012, 0x3cb: 0x0013, + 0x3cc: 0x0013, 0x3cd: 0x0013, 0x3ce: 0x0012, 0x3cf: 0x0012, 0x3d0: 0x0013, 0x3d1: 0x0013, + 0x3d2: 0x0013, 0x3d3: 0x0012, 0x3d5: 0x0013, + 0x3d9: 0x0013, 0x3da: 0x0013, 0x3db: 0x0013, 0x3dc: 0x0013, 0x3dd: 0x0013, + 0x3e4: 0x0013, 0x3e6: 0x886b, 0x3e8: 0x0013, + 0x3ea: 0x88cb, 0x3eb: 0x890b, 0x3ec: 0x0013, 0x3ed: 0x0013, 0x3ef: 0x0012, + 0x3f0: 0x0013, 0x3f1: 0x0013, 0x3f2: 0xa453, 0x3f3: 0x0013, 0x3f4: 0x0012, 0x3f5: 0x0010, + 0x3f6: 0x0010, 0x3f7: 0x0010, 0x3f8: 0x0010, 0x3f9: 0x0012, + 0x3fc: 0x0012, 0x3fd: 0x0012, 0x3fe: 0x0013, 0x3ff: 0x0013, + // Block 0x10, offset 0x400 + 0x400: 0x1a13, 0x401: 0x1a13, 0x402: 0x1e13, 0x403: 0x1e13, 0x404: 0x1a13, 0x405: 0x1a13, + 0x406: 0x2613, 0x407: 0x2613, 0x408: 0x2a13, 0x409: 0x2a13, 0x40a: 0x2e13, 0x40b: 0x2e13, + 0x40c: 0x2a13, 0x40d: 0x2a13, 0x40e: 0x2613, 0x40f: 0x2613, 0x410: 0xa752, 0x411: 0xa752, + 0x412: 0xaa52, 0x413: 0xaa52, 0x414: 0xad52, 0x415: 0xad52, 0x416: 0xaa52, 0x417: 0xaa52, + 0x418: 0xa752, 0x419: 0xa752, 0x41a: 0x1a12, 0x41b: 0x1a12, 0x41c: 0x1e12, 0x41d: 0x1e12, + 0x41e: 0x1a12, 0x41f: 0x1a12, 0x420: 0x2612, 0x421: 0x2612, 0x422: 0x2a12, 0x423: 0x2a12, + 0x424: 0x2e12, 0x425: 0x2e12, 0x426: 0x2a12, 0x427: 0x2a12, 0x428: 0x2612, 0x429: 0x2612, + // Block 0x11, offset 0x440 + 0x440: 0x6552, 0x441: 0x6552, 0x442: 0x6552, 0x443: 0x6552, 0x444: 0x6552, 0x445: 0x6552, + 0x446: 0x6552, 0x447: 0x6552, 0x448: 0x6552, 0x449: 0x6552, 0x44a: 0x6552, 0x44b: 0x6552, + 0x44c: 0x6552, 0x44d: 0x6552, 0x44e: 0x6552, 0x44f: 0x6552, 0x450: 0xb052, 0x451: 0xb052, + 0x452: 0xb052, 0x453: 0xb052, 0x454: 0xb052, 0x455: 0xb052, 0x456: 0xb052, 0x457: 0xb052, + 0x458: 0xb052, 0x459: 0xb052, 0x45a: 0xb052, 0x45b: 0xb052, 0x45c: 0xb052, 0x45d: 0xb052, + 0x45e: 0xb052, 0x460: 0x0113, 0x461: 0x0112, 0x462: 0x896b, 0x463: 0x8b53, + 0x464: 0x89cb, 0x465: 0x8a2a, 0x466: 0x8a8a, 0x467: 0x0f13, 0x468: 0x0f12, 0x469: 0x0313, + 0x46a: 0x0312, 0x46b: 0x0713, 0x46c: 0x0712, 0x46d: 0x8aeb, 0x46e: 0x8b4b, 0x46f: 0x8bab, + 0x470: 0x8c0b, 0x471: 0x0012, 0x472: 0x0113, 0x473: 0x0112, 0x474: 0x0012, 0x475: 0x0313, + 0x476: 0x0312, 0x477: 0x0012, 0x478: 0x0012, 0x479: 0x0012, 0x47a: 0x0012, 0x47b: 0x0012, + 0x47c: 0x0015, 0x47d: 0x0015, 0x47e: 0x8c6b, 0x47f: 0x8ccb, + // Block 0x12, offset 0x480 + 0x480: 0x0113, 0x481: 0x0112, 0x482: 0x0113, 0x483: 0x0112, 0x484: 0x0113, 0x485: 0x0112, + 0x486: 0x0113, 0x487: 0x0112, 0x488: 0x0014, 0x489: 0x0014, 0x48a: 0x0014, 0x48b: 0x0713, + 0x48c: 0x0712, 0x48d: 0x8d2b, 0x48e: 0x0012, 0x48f: 0x0010, 0x490: 0x0113, 0x491: 0x0112, + 0x492: 0x0113, 0x493: 0x0112, 0x494: 0x6552, 0x495: 0x0012, 0x496: 0x0113, 0x497: 0x0112, + 0x498: 0x0113, 0x499: 0x0112, 0x49a: 0x0113, 0x49b: 0x0112, 0x49c: 0x0113, 0x49d: 0x0112, + 0x49e: 0x0113, 0x49f: 0x0112, 0x4a0: 0x0113, 0x4a1: 0x0112, 0x4a2: 0x0113, 0x4a3: 0x0112, + 0x4a4: 0x0113, 0x4a5: 0x0112, 0x4a6: 0x0113, 0x4a7: 0x0112, 0x4a8: 0x0113, 0x4a9: 0x0112, + 0x4aa: 0x8d8b, 0x4ab: 0x8deb, 0x4ac: 0x8e4b, 0x4ad: 0x8eab, 0x4ae: 0x8f0b, 0x4af: 0x0012, + 0x4b0: 0x8f6b, 0x4b1: 0x8fcb, 0x4b2: 0x902b, 0x4b3: 0xb353, 0x4b4: 0x0113, 0x4b5: 0x0112, + 0x4b6: 0x0113, 0x4b7: 0x0112, 0x4b8: 0x0113, 0x4b9: 0x0112, 0x4ba: 0x0113, 0x4bb: 0x0112, + 0x4bc: 0x0113, 0x4bd: 0x0112, 0x4be: 0x0113, 0x4bf: 0x0112, + // Block 0x13, offset 0x4c0 + 0x4c0: 0x90ea, 0x4c1: 0x916a, 0x4c2: 0x91ea, 0x4c3: 0x926a, 0x4c4: 0x931a, 0x4c5: 0x93ca, + 0x4c6: 0x944a, + 0x4d3: 0x94ca, 0x4d4: 0x95aa, 0x4d5: 0x968a, 0x4d6: 0x976a, 0x4d7: 0x984a, + 0x4dd: 0x0010, + 0x4de: 0x0034, 0x4df: 0x0010, 0x4e0: 0x0010, 0x4e1: 0x0010, 0x4e2: 0x0010, 0x4e3: 0x0010, + 0x4e4: 0x0010, 0x4e5: 0x0010, 0x4e6: 0x0010, 0x4e7: 0x0010, 0x4e8: 0x0010, + 0x4ea: 0x0010, 0x4eb: 0x0010, 0x4ec: 0x0010, 0x4ed: 0x0010, 0x4ee: 0x0010, 0x4ef: 0x0010, + 0x4f0: 0x0010, 0x4f1: 0x0010, 0x4f2: 0x0010, 0x4f3: 0x0010, 0x4f4: 0x0010, 0x4f5: 0x0010, + 0x4f6: 0x0010, 0x4f8: 0x0010, 0x4f9: 0x0010, 0x4fa: 0x0010, 0x4fb: 0x0010, + 0x4fc: 0x0010, 0x4fe: 0x0010, + // Block 0x14, offset 0x500 + 0x500: 0x2213, 0x501: 0x2213, 0x502: 0x2613, 0x503: 0x2613, 0x504: 0x2213, 0x505: 0x2213, + 0x506: 0x2e13, 0x507: 0x2e13, 0x508: 0x2213, 0x509: 0x2213, 0x50a: 0x2613, 0x50b: 0x2613, + 0x50c: 0x2213, 0x50d: 0x2213, 0x50e: 0x3e13, 0x50f: 0x3e13, 0x510: 0x2213, 0x511: 0x2213, + 0x512: 0x2613, 0x513: 0x2613, 0x514: 0x2213, 0x515: 0x2213, 0x516: 0x2e13, 0x517: 0x2e13, + 0x518: 0x2213, 0x519: 0x2213, 0x51a: 0x2613, 0x51b: 0x2613, 0x51c: 0x2213, 0x51d: 0x2213, + 0x51e: 0xbc53, 0x51f: 0xbc53, 0x520: 0xbf53, 0x521: 0xbf53, 0x522: 0x2212, 0x523: 0x2212, + 0x524: 0x2612, 0x525: 0x2612, 0x526: 0x2212, 0x527: 0x2212, 0x528: 0x2e12, 0x529: 0x2e12, + 0x52a: 0x2212, 0x52b: 0x2212, 0x52c: 0x2612, 0x52d: 0x2612, 0x52e: 0x2212, 0x52f: 0x2212, + 0x530: 0x3e12, 0x531: 0x3e12, 0x532: 0x2212, 0x533: 0x2212, 0x534: 0x2612, 0x535: 0x2612, + 0x536: 0x2212, 0x537: 0x2212, 0x538: 0x2e12, 0x539: 0x2e12, 0x53a: 0x2212, 0x53b: 0x2212, + 0x53c: 0x2612, 0x53d: 0x2612, 0x53e: 0x2212, 0x53f: 0x2212, + // Block 0x15, offset 0x540 + 0x542: 0x0010, + 0x547: 0x0010, 0x549: 0x0010, 0x54b: 0x0010, + 0x54d: 0x0010, 0x54e: 0x0010, 0x54f: 0x0010, 0x551: 0x0010, + 0x552: 0x0010, 0x554: 0x0010, 0x557: 0x0010, + 0x559: 0x0010, 0x55b: 0x0010, 0x55d: 0x0010, + 0x55f: 0x0010, 0x561: 0x0010, 0x562: 0x0010, + 0x564: 0x0010, 0x567: 0x0010, 0x568: 0x0010, 0x569: 0x0010, + 0x56a: 0x0010, 0x56c: 0x0010, 0x56d: 0x0010, 0x56e: 0x0010, 0x56f: 0x0010, + 0x570: 0x0010, 0x571: 0x0010, 0x572: 0x0010, 0x574: 0x0010, 0x575: 0x0010, + 0x576: 0x0010, 0x577: 0x0010, 0x579: 0x0010, 0x57a: 0x0010, 0x57b: 0x0010, + 0x57c: 0x0010, 0x57e: 0x0010, +} + +// caseIndex: 25 blocks, 1600 entries, 3200 bytes +// Block 0 is the zero block. +var caseIndex = [1600]uint16{ + // Block 0x0, offset 0x0 + // Block 0x1, offset 0x40 + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc2: 0x14, 0xc3: 0x15, 0xc4: 0x16, 0xc5: 0x17, 0xc6: 0x01, 0xc7: 0x02, + 0xc8: 0x18, 0xc9: 0x03, 0xca: 0x04, 0xcb: 0x19, 0xcc: 0x1a, 0xcd: 0x05, 0xce: 0x06, 0xcf: 0x07, + 0xd0: 0x1b, 0xd1: 0x1c, 0xd2: 0x1d, 0xd3: 0x1e, 0xd4: 0x1f, 0xd5: 0x20, 0xd6: 0x08, 0xd7: 0x21, + 0xd8: 0x22, 0xd9: 0x23, 0xda: 0x24, 0xdb: 0x25, 0xdc: 0x26, 0xdd: 0x27, 0xde: 0x28, 0xdf: 0x29, + 0xe0: 0x02, 0xe1: 0x03, 0xe2: 0x04, 0xe3: 0x05, + 0xea: 0x06, 0xeb: 0x07, 0xec: 0x07, 0xed: 0x08, 0xef: 0x09, + 0xf0: 0x14, 0xf3: 0x16, + // Block 0x4, offset 0x100 + 0x120: 0x2a, 0x121: 0x2b, 0x122: 0x2c, 0x123: 0x2d, 0x124: 0x2e, 0x125: 0x2f, 0x126: 0x30, 0x127: 0x31, + 0x128: 0x32, 0x129: 0x33, 0x12a: 0x34, 0x12b: 0x35, 0x12c: 0x36, 0x12d: 0x37, 0x12e: 0x38, 0x12f: 0x39, + 0x130: 0x3a, 0x131: 0x3b, 0x132: 0x3c, 0x133: 0x3d, 0x134: 0x3e, 0x135: 0x3f, 0x136: 0x40, 0x137: 0x41, + 0x138: 0x42, 0x139: 0x43, 0x13a: 0x44, 0x13b: 0x45, 0x13c: 0x46, 0x13d: 0x47, 0x13e: 0x48, 0x13f: 0x49, + // Block 0x5, offset 0x140 + 0x140: 0x4a, 0x141: 0x4b, 0x142: 0x4c, 0x143: 0x09, 0x144: 0x24, 0x145: 0x24, 0x146: 0x24, 0x147: 0x24, + 0x148: 0x24, 0x149: 0x4d, 0x14a: 0x4e, 0x14b: 0x4f, 0x14c: 0x50, 0x14d: 0x51, 0x14e: 0x52, 0x14f: 0x53, + 0x150: 0x54, 0x151: 0x24, 0x152: 0x24, 0x153: 0x24, 0x154: 0x24, 0x155: 0x24, 0x156: 0x24, 0x157: 0x24, + 0x158: 0x24, 0x159: 0x55, 0x15a: 0x56, 0x15b: 0x57, 0x15c: 0x58, 0x15d: 0x59, 0x15e: 0x5a, 0x15f: 0x5b, + 0x160: 0x5c, 0x161: 0x5d, 0x162: 0x5e, 0x163: 0x5f, 0x164: 0x60, 0x165: 0x61, 0x167: 0x62, + 0x168: 0x63, 0x169: 0x64, 0x16a: 0x65, 0x16b: 0x66, 0x16c: 0x67, 0x16d: 0x68, 0x16e: 0x69, 0x16f: 0x6a, + 0x170: 0x6b, 0x171: 0x6c, 0x172: 0x6d, 0x173: 0x6e, 0x174: 0x6f, 0x175: 0x70, 0x176: 0x71, 0x177: 0x72, + 0x178: 0x73, 0x179: 0x73, 0x17a: 0x74, 0x17b: 0x73, 0x17c: 0x75, 0x17d: 0x0a, 0x17e: 0x0b, 0x17f: 0x0c, + // Block 0x6, offset 0x180 + 0x180: 0x76, 0x181: 0x77, 0x182: 0x78, 0x183: 0x79, 0x184: 0x0d, 0x185: 0x7a, 0x186: 0x7b, + 0x192: 0x7c, 0x193: 0x0e, + 0x1b0: 0x7d, 0x1b1: 0x0f, 0x1b2: 0x73, 0x1b3: 0x7e, 0x1b4: 0x7f, 0x1b5: 0x80, 0x1b6: 0x81, 0x1b7: 0x82, + 0x1b8: 0x83, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x84, 0x1c2: 0x85, 0x1c3: 0x86, 0x1c4: 0x87, 0x1c5: 0x24, 0x1c6: 0x88, + // Block 0x8, offset 0x200 + 0x200: 0x89, 0x201: 0x24, 0x202: 0x24, 0x203: 0x24, 0x204: 0x24, 0x205: 0x24, 0x206: 0x24, 0x207: 0x24, + 0x208: 0x24, 0x209: 0x24, 0x20a: 0x24, 0x20b: 0x24, 0x20c: 0x24, 0x20d: 0x24, 0x20e: 0x24, 0x20f: 0x24, + 0x210: 0x24, 0x211: 0x24, 0x212: 0x8a, 0x213: 0x8b, 0x214: 0x24, 0x215: 0x24, 0x216: 0x24, 0x217: 0x24, + 0x218: 0x8c, 0x219: 0x8d, 0x21a: 0x8e, 0x21b: 0x8f, 0x21c: 0x90, 0x21d: 0x91, 0x21e: 0x10, 0x21f: 0x92, + 0x220: 0x93, 0x221: 0x94, 0x222: 0x24, 0x223: 0x95, 0x224: 0x96, 0x225: 0x97, 0x226: 0x98, 0x227: 0x99, + 0x228: 0x9a, 0x229: 0x9b, 0x22a: 0x9c, 0x22b: 0x9d, 0x22c: 0x9e, 0x22d: 0x9f, 0x22e: 0xa0, 0x22f: 0xa1, + 0x230: 0x24, 0x231: 0x24, 0x232: 0x24, 0x233: 0x24, 0x234: 0x24, 0x235: 0x24, 0x236: 0x24, 0x237: 0x24, + 0x238: 0x24, 0x239: 0x24, 0x23a: 0x24, 0x23b: 0x24, 0x23c: 0x24, 0x23d: 0x24, 0x23e: 0x24, 0x23f: 0x24, + // Block 0x9, offset 0x240 + 0x240: 0x24, 0x241: 0x24, 0x242: 0x24, 0x243: 0x24, 0x244: 0x24, 0x245: 0x24, 0x246: 0x24, 0x247: 0x24, + 0x248: 0x24, 0x249: 0x24, 0x24a: 0x24, 0x24b: 0x24, 0x24c: 0x24, 0x24d: 0x24, 0x24e: 0x24, 0x24f: 0x24, + 0x250: 0x24, 0x251: 0x24, 0x252: 0x24, 0x253: 0x24, 0x254: 0x24, 0x255: 0x24, 0x256: 0x24, 0x257: 0x24, + 0x258: 0x24, 0x259: 0x24, 0x25a: 0x24, 0x25b: 0x24, 0x25c: 0x24, 0x25d: 0x24, 0x25e: 0x24, 0x25f: 0x24, + 0x260: 0x24, 0x261: 0x24, 0x262: 0x24, 0x263: 0x24, 0x264: 0x24, 0x265: 0x24, 0x266: 0x24, 0x267: 0x24, + 0x268: 0x24, 0x269: 0x24, 0x26a: 0x24, 0x26b: 0x24, 0x26c: 0x24, 0x26d: 0x24, 0x26e: 0x24, 0x26f: 0x24, + 0x270: 0x24, 0x271: 0x24, 0x272: 0x24, 0x273: 0x24, 0x274: 0x24, 0x275: 0x24, 0x276: 0x24, 0x277: 0x24, + 0x278: 0x24, 0x279: 0x24, 0x27a: 0x24, 0x27b: 0x24, 0x27c: 0x24, 0x27d: 0x24, 0x27e: 0x24, 0x27f: 0x24, + // Block 0xa, offset 0x280 + 0x280: 0x24, 0x281: 0x24, 0x282: 0x24, 0x283: 0x24, 0x284: 0x24, 0x285: 0x24, 0x286: 0x24, 0x287: 0x24, + 0x288: 0x24, 0x289: 0x24, 0x28a: 0x24, 0x28b: 0x24, 0x28c: 0x24, 0x28d: 0x24, 0x28e: 0x24, 0x28f: 0x24, + 0x290: 0x24, 0x291: 0x24, 0x292: 0x24, 0x293: 0x24, 0x294: 0x24, 0x295: 0x24, 0x296: 0x24, 0x297: 0x24, + 0x298: 0x24, 0x299: 0x24, 0x29a: 0x24, 0x29b: 0x24, 0x29c: 0x24, 0x29d: 0x24, 0x29e: 0xa2, 0x29f: 0xa3, + // Block 0xb, offset 0x2c0 + 0x2ec: 0x11, 0x2ed: 0xa4, 0x2ee: 0xa5, 0x2ef: 0xa6, + 0x2f0: 0x24, 0x2f1: 0x24, 0x2f2: 0x24, 0x2f3: 0x24, 0x2f4: 0xa7, 0x2f5: 0xa8, 0x2f6: 0xa9, 0x2f7: 0xaa, + 0x2f8: 0xab, 0x2f9: 0xac, 0x2fa: 0x24, 0x2fb: 0xad, 0x2fc: 0xae, 0x2fd: 0xaf, 0x2fe: 0xb0, 0x2ff: 0xb1, + // Block 0xc, offset 0x300 + 0x300: 0xb2, 0x301: 0xb3, 0x302: 0x24, 0x303: 0xb4, 0x305: 0xb5, 0x307: 0xb6, + 0x30a: 0xb7, 0x30b: 0xb8, 0x30c: 0xb9, 0x30d: 0xba, 0x30e: 0xbb, 0x30f: 0xbc, + 0x310: 0xbd, 0x311: 0xbe, 0x312: 0xbf, 0x313: 0xc0, 0x314: 0xc1, 0x315: 0xc2, + 0x318: 0x24, 0x319: 0x24, 0x31a: 0x24, 0x31b: 0x24, 0x31c: 0xc3, 0x31d: 0xc4, + 0x320: 0xc5, 0x321: 0xc6, 0x322: 0xc7, 0x323: 0xc8, 0x324: 0xc9, 0x326: 0xca, + 0x328: 0xcb, 0x329: 0xcc, 0x32a: 0xcd, 0x32b: 0xce, 0x32c: 0x5f, 0x32d: 0xcf, 0x32e: 0xd0, + 0x330: 0x24, 0x331: 0xd1, 0x332: 0xd2, 0x333: 0xd3, 0x334: 0xd4, + 0x33a: 0xd5, 0x33c: 0xd6, 0x33d: 0xd7, 0x33e: 0xd8, 0x33f: 0xd9, + // Block 0xd, offset 0x340 + 0x340: 0xda, 0x341: 0xdb, 0x342: 0xdc, 0x343: 0xdd, 0x344: 0xde, 0x345: 0xdf, 0x346: 0xe0, 0x347: 0xe1, + 0x348: 0xe2, 0x34a: 0xe3, 0x34b: 0xe4, 0x34c: 0xe5, 0x34d: 0xe6, + 0x350: 0xe7, 0x351: 0xe8, 0x352: 0xe9, 0x353: 0xea, 0x356: 0xeb, 0x357: 0xec, + 0x358: 0xed, 0x359: 0xee, 0x35a: 0xef, 0x35b: 0xf0, 0x35c: 0xf1, + 0x360: 0xf2, 0x362: 0xf3, 0x363: 0xf4, 0x364: 0xf5, 0x365: 0xf6, 0x366: 0xf7, 0x367: 0xf8, + 0x368: 0xf9, 0x369: 0xfa, 0x36a: 0xfb, 0x36b: 0xfc, + 0x370: 0xfd, 0x371: 0xfe, 0x372: 0xff, 0x374: 0x100, 0x375: 0x101, 0x376: 0x102, + 0x37b: 0x103, 0x37e: 0x104, + // Block 0xe, offset 0x380 + 0x380: 0x24, 0x381: 0x24, 0x382: 0x24, 0x383: 0x24, 0x384: 0x24, 0x385: 0x24, 0x386: 0x24, 0x387: 0x24, + 0x388: 0x24, 0x389: 0x24, 0x38a: 0x24, 0x38b: 0x24, 0x38c: 0x24, 0x38d: 0x24, 0x38e: 0x105, + 0x390: 0x24, 0x391: 0x106, 0x392: 0x24, 0x393: 0x24, 0x394: 0x24, 0x395: 0x107, + // Block 0xf, offset 0x3c0 + 0x3c0: 0x24, 0x3c1: 0x24, 0x3c2: 0x24, 0x3c3: 0x24, 0x3c4: 0x24, 0x3c5: 0x24, 0x3c6: 0x24, 0x3c7: 0x24, + 0x3c8: 0x24, 0x3c9: 0x24, 0x3ca: 0x24, 0x3cb: 0x24, 0x3cc: 0x24, 0x3cd: 0x24, 0x3ce: 0x24, 0x3cf: 0x24, + 0x3d0: 0x108, + // Block 0x10, offset 0x400 + 0x410: 0x24, 0x411: 0x24, 0x412: 0x24, 0x413: 0x24, 0x414: 0x24, 0x415: 0x24, 0x416: 0x24, 0x417: 0x24, + 0x418: 0x24, 0x419: 0x109, + // Block 0x11, offset 0x440 + 0x460: 0x24, 0x461: 0x24, 0x462: 0x24, 0x463: 0x24, 0x464: 0x24, 0x465: 0x24, 0x466: 0x24, 0x467: 0x24, + 0x468: 0xfc, 0x469: 0x10a, 0x46b: 0x10b, 0x46c: 0x10c, 0x46d: 0x10d, 0x46e: 0x10e, + 0x479: 0x10f, 0x47c: 0x24, 0x47d: 0x110, 0x47e: 0x111, 0x47f: 0x112, + // Block 0x12, offset 0x480 + 0x4b0: 0x24, 0x4b1: 0x113, 0x4b2: 0x114, + // Block 0x13, offset 0x4c0 + 0x4c5: 0x115, 0x4c6: 0x116, + 0x4c9: 0x117, + 0x4d0: 0x118, 0x4d1: 0x119, 0x4d2: 0x11a, 0x4d3: 0x11b, 0x4d4: 0x11c, 0x4d5: 0x11d, 0x4d6: 0x11e, 0x4d7: 0x11f, + 0x4d8: 0x120, 0x4d9: 0x121, 0x4da: 0x122, 0x4db: 0x123, 0x4dc: 0x124, 0x4dd: 0x125, 0x4de: 0x126, 0x4df: 0x127, + 0x4e8: 0x128, 0x4e9: 0x129, 0x4ea: 0x12a, + // Block 0x14, offset 0x500 + 0x500: 0x12b, 0x504: 0x12c, 0x505: 0x12d, + 0x50b: 0x12e, + 0x520: 0x24, 0x521: 0x24, 0x522: 0x24, 0x523: 0x12f, 0x524: 0x12, 0x525: 0x130, + 0x538: 0x131, 0x539: 0x13, 0x53a: 0x132, + // Block 0x15, offset 0x540 + 0x544: 0x133, 0x545: 0x134, 0x546: 0x135, + 0x54f: 0x136, + 0x56f: 0x137, + // Block 0x16, offset 0x580 + 0x590: 0x0a, 0x591: 0x0b, 0x592: 0x0c, 0x593: 0x0d, 0x594: 0x0e, 0x596: 0x0f, + 0x59b: 0x10, 0x59d: 0x11, 0x59e: 0x12, 0x59f: 0x13, + // Block 0x17, offset 0x5c0 + 0x5c0: 0x138, 0x5c1: 0x139, 0x5c4: 0x139, 0x5c5: 0x139, 0x5c6: 0x139, 0x5c7: 0x13a, + // Block 0x18, offset 0x600 + 0x620: 0x15, +} + +// sparseOffsets: 296 entries, 592 bytes +var sparseOffsets = []uint16{0x0, 0x9, 0xf, 0x18, 0x24, 0x2e, 0x34, 0x37, 0x3b, 0x3e, 0x42, 0x4c, 0x4e, 0x57, 0x5e, 0x63, 0x71, 0x72, 0x80, 0x8f, 0x99, 0x9c, 0xa3, 0xab, 0xae, 0xb0, 0xc0, 0xc6, 0xd4, 0xdf, 0xec, 0xf7, 0x103, 0x10d, 0x119, 0x124, 0x130, 0x13c, 0x144, 0x14d, 0x157, 0x162, 0x16e, 0x174, 0x17f, 0x185, 0x18d, 0x190, 0x195, 0x199, 0x19d, 0x1a4, 0x1ad, 0x1b5, 0x1b6, 0x1bf, 0x1c6, 0x1ce, 0x1d4, 0x1d9, 0x1dd, 0x1e0, 0x1e2, 0x1e5, 0x1ea, 0x1eb, 0x1ed, 0x1ef, 0x1f1, 0x1f8, 0x1fd, 0x201, 0x20a, 0x20d, 0x210, 0x216, 0x217, 0x222, 0x223, 0x224, 0x229, 0x236, 0x23f, 0x240, 0x248, 0x251, 0x25a, 0x263, 0x268, 0x26b, 0x276, 0x284, 0x286, 0x28d, 0x291, 0x29d, 0x29e, 0x2a9, 0x2b1, 0x2b9, 0x2bf, 0x2c0, 0x2ce, 0x2d3, 0x2d6, 0x2db, 0x2df, 0x2e5, 0x2ea, 0x2ed, 0x2f2, 0x2f7, 0x2f8, 0x2fe, 0x300, 0x301, 0x303, 0x305, 0x308, 0x309, 0x30b, 0x30e, 0x314, 0x318, 0x31a, 0x31f, 0x326, 0x331, 0x33b, 0x33c, 0x345, 0x349, 0x34e, 0x356, 0x35c, 0x362, 0x36c, 0x371, 0x37a, 0x380, 0x389, 0x38d, 0x395, 0x397, 0x399, 0x39c, 0x39e, 0x3a0, 0x3a1, 0x3a2, 0x3a4, 0x3a6, 0x3ac, 0x3b1, 0x3b3, 0x3ba, 0x3bd, 0x3bf, 0x3c5, 0x3ca, 0x3cc, 0x3cd, 0x3ce, 0x3cf, 0x3d1, 0x3d3, 0x3d5, 0x3d8, 0x3da, 0x3dd, 0x3e5, 0x3e8, 0x3ec, 0x3f4, 0x3f6, 0x3f7, 0x3f8, 0x3fa, 0x400, 0x402, 0x403, 0x405, 0x407, 0x409, 0x416, 0x417, 0x418, 0x41c, 0x41e, 0x41f, 0x420, 0x421, 0x422, 0x425, 0x428, 0x42b, 0x431, 0x432, 0x434, 0x438, 0x43c, 0x442, 0x445, 0x44c, 0x450, 0x454, 0x45d, 0x466, 0x46c, 0x472, 0x47c, 0x486, 0x488, 0x491, 0x497, 0x49d, 0x4a3, 0x4a6, 0x4ac, 0x4af, 0x4b8, 0x4b9, 0x4c0, 0x4c4, 0x4c5, 0x4c8, 0x4d2, 0x4d5, 0x4d7, 0x4de, 0x4e6, 0x4ec, 0x4f2, 0x4f3, 0x4f9, 0x4fc, 0x504, 0x50b, 0x515, 0x51d, 0x520, 0x521, 0x522, 0x523, 0x524, 0x526, 0x527, 0x529, 0x52b, 0x52d, 0x531, 0x532, 0x534, 0x537, 0x539, 0x53c, 0x53e, 0x543, 0x548, 0x54c, 0x54d, 0x550, 0x554, 0x55f, 0x563, 0x56b, 0x570, 0x574, 0x577, 0x57b, 0x57e, 0x581, 0x586, 0x58a, 0x58e, 0x592, 0x596, 0x598, 0x59a, 0x59d, 0x5a2, 0x5a5, 0x5a7, 0x5aa, 0x5ac, 0x5b2, 0x5bb, 0x5c0, 0x5c1, 0x5c4, 0x5c5, 0x5c6, 0x5c7, 0x5c9, 0x5ca, 0x5cb} + +// sparseValues: 1483 entries, 5932 bytes +var sparseValues = [1483]valueRange{ + // Block 0x0, offset 0x0 + {value: 0x0004, lo: 0xa8, hi: 0xa8}, + {value: 0x0012, lo: 0xaa, hi: 0xaa}, + {value: 0x0014, lo: 0xad, hi: 0xad}, + {value: 0x0004, lo: 0xaf, hi: 0xaf}, + {value: 0x0004, lo: 0xb4, hi: 0xb4}, + {value: 0x001a, lo: 0xb5, hi: 0xb5}, + {value: 0x0054, lo: 0xb7, hi: 0xb7}, + {value: 0x0004, lo: 0xb8, hi: 0xb8}, + {value: 0x0012, lo: 0xba, hi: 0xba}, + // Block 0x1, offset 0x9 + {value: 0x2013, lo: 0x80, hi: 0x96}, + {value: 0x2013, lo: 0x98, hi: 0x9e}, + {value: 0x009a, lo: 0x9f, hi: 0x9f}, + {value: 0x2012, lo: 0xa0, hi: 0xb6}, + {value: 0x2012, lo: 0xb8, hi: 0xbe}, + {value: 0x0252, lo: 0xbf, hi: 0xbf}, + // Block 0x2, offset 0xf + {value: 0x0117, lo: 0x80, hi: 0xaf}, + {value: 0x011b, lo: 0xb0, hi: 0xb0}, + {value: 0x019a, lo: 0xb1, hi: 0xb1}, + {value: 0x0117, lo: 0xb2, hi: 0xb7}, + {value: 0x0012, lo: 0xb8, hi: 0xb8}, + {value: 0x0316, lo: 0xb9, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x0316, lo: 0xbd, hi: 0xbe}, + {value: 0x0553, lo: 0xbf, hi: 0xbf}, + // Block 0x3, offset 0x18 + {value: 0x0552, lo: 0x80, hi: 0x80}, + {value: 0x0316, lo: 0x81, hi: 0x82}, + {value: 0x0716, lo: 0x83, hi: 0x84}, + {value: 0x0316, lo: 0x85, hi: 0x86}, + {value: 0x0f16, lo: 0x87, hi: 0x88}, + {value: 0x01da, lo: 0x89, hi: 0x89}, + {value: 0x0117, lo: 0x8a, hi: 0xb7}, + {value: 0x0253, lo: 0xb8, hi: 0xb8}, + {value: 0x0316, lo: 0xb9, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x0316, lo: 0xbd, hi: 0xbe}, + {value: 0x028a, lo: 0xbf, hi: 0xbf}, + // Block 0x4, offset 0x24 + {value: 0x0117, lo: 0x80, hi: 0x9f}, + {value: 0x2f53, lo: 0xa0, hi: 0xa0}, + {value: 0x0012, lo: 0xa1, hi: 0xa1}, + {value: 0x0117, lo: 0xa2, hi: 0xb3}, + {value: 0x0012, lo: 0xb4, hi: 0xb9}, + {value: 0x090b, lo: 0xba, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x2953, lo: 0xbd, hi: 0xbd}, + {value: 0x098b, lo: 0xbe, hi: 0xbe}, + {value: 0x0a0a, lo: 0xbf, hi: 0xbf}, + // Block 0x5, offset 0x2e + {value: 0x0015, lo: 0x80, hi: 0x81}, + {value: 0x0014, lo: 0x82, hi: 0x97}, + {value: 0x0004, lo: 0x98, hi: 0x9d}, + {value: 0x0014, lo: 0x9e, hi: 0x9f}, + {value: 0x0015, lo: 0xa0, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xbf}, + // Block 0x6, offset 0x34 + {value: 0x0024, lo: 0x80, hi: 0x94}, + {value: 0x0034, lo: 0x95, hi: 0xbc}, + {value: 0x0024, lo: 0xbd, hi: 0xbf}, + // Block 0x7, offset 0x37 + {value: 0x6553, lo: 0x80, hi: 0x8f}, + {value: 0x2013, lo: 0x90, hi: 0x9f}, + {value: 0x5f53, lo: 0xa0, hi: 0xaf}, + {value: 0x2012, lo: 0xb0, hi: 0xbf}, + // Block 0x8, offset 0x3b + {value: 0x5f52, lo: 0x80, hi: 0x8f}, + {value: 0x6552, lo: 0x90, hi: 0x9f}, + {value: 0x0117, lo: 0xa0, hi: 0xbf}, + // Block 0x9, offset 0x3e + {value: 0x0117, lo: 0x80, hi: 0x81}, + {value: 0x0024, lo: 0x83, hi: 0x87}, + {value: 0x0014, lo: 0x88, hi: 0x89}, + {value: 0x0117, lo: 0x8a, hi: 0xbf}, + // Block 0xa, offset 0x42 + {value: 0x0f13, lo: 0x80, hi: 0x80}, + {value: 0x0316, lo: 0x81, hi: 0x82}, + {value: 0x0716, lo: 0x83, hi: 0x84}, + {value: 0x0316, lo: 0x85, hi: 0x86}, + {value: 0x0f16, lo: 0x87, hi: 0x88}, + {value: 0x0316, lo: 0x89, hi: 0x8a}, + {value: 0x0716, lo: 0x8b, hi: 0x8c}, + {value: 0x0316, lo: 0x8d, hi: 0x8e}, + {value: 0x0f12, lo: 0x8f, hi: 0x8f}, + {value: 0x0117, lo: 0x90, hi: 0xbf}, + // Block 0xb, offset 0x4c + {value: 0x0117, lo: 0x80, hi: 0xaf}, + {value: 0x6553, lo: 0xb1, hi: 0xbf}, + // Block 0xc, offset 0x4e + {value: 0x3013, lo: 0x80, hi: 0x8f}, + {value: 0x6853, lo: 0x90, hi: 0x96}, + {value: 0x0014, lo: 0x99, hi: 0x99}, + {value: 0x0010, lo: 0x9a, hi: 0x9c}, + {value: 0x0010, lo: 0x9e, hi: 0x9e}, + {value: 0x0054, lo: 0x9f, hi: 0x9f}, + {value: 0x0012, lo: 0xa0, hi: 0xa0}, + {value: 0x6552, lo: 0xa1, hi: 0xaf}, + {value: 0x3012, lo: 0xb0, hi: 0xbf}, + // Block 0xd, offset 0x57 + {value: 0x0034, lo: 0x81, hi: 0x82}, + {value: 0x0024, lo: 0x84, hi: 0x84}, + {value: 0x0034, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0x87, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0xaa}, + {value: 0x0010, lo: 0xaf, hi: 0xb3}, + {value: 0x0054, lo: 0xb4, hi: 0xb4}, + // Block 0xe, offset 0x5e + {value: 0x0014, lo: 0x80, hi: 0x85}, + {value: 0x0024, lo: 0x90, hi: 0x97}, + {value: 0x0034, lo: 0x98, hi: 0x9a}, + {value: 0x0014, lo: 0x9c, hi: 0x9c}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0xf, offset 0x63 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x8a}, + {value: 0x0034, lo: 0x8b, hi: 0x92}, + {value: 0x0024, lo: 0x93, hi: 0x94}, + {value: 0x0034, lo: 0x95, hi: 0x96}, + {value: 0x0024, lo: 0x97, hi: 0x9b}, + {value: 0x0034, lo: 0x9c, hi: 0x9c}, + {value: 0x0024, lo: 0x9d, hi: 0x9e}, + {value: 0x0034, lo: 0x9f, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0x0010, lo: 0xab, hi: 0xab}, + {value: 0x0010, lo: 0xae, hi: 0xaf}, + {value: 0x0034, lo: 0xb0, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xbf}, + // Block 0x10, offset 0x71 + {value: 0x0010, lo: 0x80, hi: 0xbf}, + // Block 0x11, offset 0x72 + {value: 0x0010, lo: 0x80, hi: 0x93}, + {value: 0x0010, lo: 0x95, hi: 0x95}, + {value: 0x0024, lo: 0x96, hi: 0x9c}, + {value: 0x0014, lo: 0x9d, hi: 0x9d}, + {value: 0x0024, lo: 0x9f, hi: 0xa2}, + {value: 0x0034, lo: 0xa3, hi: 0xa3}, + {value: 0x0024, lo: 0xa4, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xa6}, + {value: 0x0024, lo: 0xa7, hi: 0xa8}, + {value: 0x0034, lo: 0xaa, hi: 0xaa}, + {value: 0x0024, lo: 0xab, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xbc}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x12, offset 0x80 + {value: 0x0014, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0034, lo: 0x91, hi: 0x91}, + {value: 0x0010, lo: 0x92, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb0}, + {value: 0x0034, lo: 0xb1, hi: 0xb1}, + {value: 0x0024, lo: 0xb2, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0024, lo: 0xb5, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb9}, + {value: 0x0024, lo: 0xba, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbc}, + {value: 0x0024, lo: 0xbd, hi: 0xbd}, + {value: 0x0034, lo: 0xbe, hi: 0xbe}, + {value: 0x0024, lo: 0xbf, hi: 0xbf}, + // Block 0x13, offset 0x8f + {value: 0x0024, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0024, lo: 0x83, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x84}, + {value: 0x0024, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0024, lo: 0x87, hi: 0x87}, + {value: 0x0034, lo: 0x88, hi: 0x88}, + {value: 0x0024, lo: 0x89, hi: 0x8a}, + {value: 0x0010, lo: 0x8d, hi: 0xbf}, + // Block 0x14, offset 0x99 + {value: 0x0010, lo: 0x80, hi: 0xa5}, + {value: 0x0014, lo: 0xa6, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + // Block 0x15, offset 0x9c + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0024, lo: 0xab, hi: 0xb1}, + {value: 0x0034, lo: 0xb2, hi: 0xb2}, + {value: 0x0024, lo: 0xb3, hi: 0xb3}, + {value: 0x0014, lo: 0xb4, hi: 0xb5}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + {value: 0x0034, lo: 0xbd, hi: 0xbd}, + // Block 0x16, offset 0xa3 + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0024, lo: 0x96, hi: 0x99}, + {value: 0x0014, lo: 0x9a, hi: 0x9a}, + {value: 0x0024, lo: 0x9b, hi: 0xa3}, + {value: 0x0014, lo: 0xa4, hi: 0xa4}, + {value: 0x0024, lo: 0xa5, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa8}, + {value: 0x0024, lo: 0xa9, hi: 0xad}, + // Block 0x17, offset 0xab + {value: 0x0010, lo: 0x80, hi: 0x98}, + {value: 0x0034, lo: 0x99, hi: 0x9b}, + {value: 0x0010, lo: 0xa0, hi: 0xaa}, + // Block 0x18, offset 0xae + {value: 0x0010, lo: 0xa0, hi: 0xb4}, + {value: 0x0010, lo: 0xb6, hi: 0xbf}, + // Block 0x19, offset 0xb0 + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0034, lo: 0x93, hi: 0x93}, + {value: 0x0024, lo: 0x94, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa2}, + {value: 0x0034, lo: 0xa3, hi: 0xa3}, + {value: 0x0024, lo: 0xa4, hi: 0xa5}, + {value: 0x0034, lo: 0xa6, hi: 0xa6}, + {value: 0x0024, lo: 0xa7, hi: 0xa8}, + {value: 0x0034, lo: 0xa9, hi: 0xa9}, + {value: 0x0024, lo: 0xaa, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xb2}, + {value: 0x0024, lo: 0xb3, hi: 0xb5}, + {value: 0x0034, lo: 0xb6, hi: 0xb6}, + {value: 0x0024, lo: 0xb7, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0024, lo: 0xbb, hi: 0xbf}, + // Block 0x1a, offset 0xc0 + {value: 0x0014, lo: 0x80, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0xb9}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x1b, offset 0xc6 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x88}, + {value: 0x0010, lo: 0x89, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0024, lo: 0x91, hi: 0x91}, + {value: 0x0034, lo: 0x92, hi: 0x92}, + {value: 0x0024, lo: 0x93, hi: 0x94}, + {value: 0x0014, lo: 0x95, hi: 0x97}, + {value: 0x0010, lo: 0x98, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0014, lo: 0xb1, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xbf}, + // Block 0x1c, offset 0xd4 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb2}, + {value: 0x0010, lo: 0xb6, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x1d, offset 0xdf + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8e, hi: 0x8e}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0x9c, hi: 0x9d}, + {value: 0x0010, lo: 0x9f, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xb1}, + {value: 0x0010, lo: 0xbc, hi: 0xbc}, + {value: 0x0024, lo: 0xbe, hi: 0xbe}, + // Block 0x1e, offset 0xec + {value: 0x0014, lo: 0x81, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8a}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb6}, + {value: 0x0010, lo: 0xb8, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x1f, offset 0xf7 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x82}, + {value: 0x0014, lo: 0x87, hi: 0x88}, + {value: 0x0014, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0014, lo: 0x91, hi: 0x91}, + {value: 0x0010, lo: 0x99, hi: 0x9c}, + {value: 0x0010, lo: 0x9e, hi: 0x9e}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb5}, + // Block 0x20, offset 0x103 + {value: 0x0014, lo: 0x81, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8d}, + {value: 0x0010, lo: 0x8f, hi: 0x91}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x21, offset 0x10d + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x85}, + {value: 0x0014, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x89, hi: 0x89}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb9, hi: 0xb9}, + {value: 0x0014, lo: 0xba, hi: 0xbf}, + // Block 0x22, offset 0x119 + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbe}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x23, offset 0x124 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0014, lo: 0x95, hi: 0x96}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0x9c, hi: 0x9d}, + {value: 0x0010, lo: 0x9f, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + // Block 0x24, offset 0x130 + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8a}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0x95}, + {value: 0x0010, lo: 0x99, hi: 0x9a}, + {value: 0x0010, lo: 0x9c, hi: 0x9c}, + {value: 0x0010, lo: 0x9e, hi: 0x9f}, + {value: 0x0010, lo: 0xa3, hi: 0xa4}, + {value: 0x0010, lo: 0xa8, hi: 0xaa}, + {value: 0x0010, lo: 0xae, hi: 0xb9}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x25, offset 0x13c + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x82}, + {value: 0x0010, lo: 0x86, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + // Block 0x26, offset 0x144 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x83}, + {value: 0x0014, lo: 0x84, hi: 0x84}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb9}, + {value: 0x0010, lo: 0xbd, hi: 0xbd}, + {value: 0x0014, lo: 0xbe, hi: 0xbf}, + // Block 0x27, offset 0x14d + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x84}, + {value: 0x0014, lo: 0x86, hi: 0x88}, + {value: 0x0014, lo: 0x8a, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0034, lo: 0x95, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x9a}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + // Block 0x28, offset 0x157 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbe}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x29, offset 0x162 + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0014, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x95, hi: 0x96}, + {value: 0x0010, lo: 0x9e, hi: 0x9e}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb1, hi: 0xb2}, + // Block 0x2a, offset 0x16e + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x2b, offset 0x174 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x86, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8e, hi: 0x8e}, + {value: 0x0010, lo: 0x94, hi: 0x97}, + {value: 0x0010, lo: 0x9f, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xba, hi: 0xbf}, + // Block 0x2c, offset 0x17f + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x96}, + {value: 0x0010, lo: 0x9a, hi: 0xb1}, + {value: 0x0010, lo: 0xb3, hi: 0xbb}, + {value: 0x0010, lo: 0xbd, hi: 0xbd}, + // Block 0x2d, offset 0x185 + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0010, lo: 0x8f, hi: 0x91}, + {value: 0x0014, lo: 0x92, hi: 0x94}, + {value: 0x0014, lo: 0x96, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x9f}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + // Block 0x2e, offset 0x18d + {value: 0x0014, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb4, hi: 0xb7}, + {value: 0x0034, lo: 0xb8, hi: 0xba}, + // Block 0x2f, offset 0x190 + {value: 0x0004, lo: 0x86, hi: 0x86}, + {value: 0x0014, lo: 0x87, hi: 0x87}, + {value: 0x0034, lo: 0x88, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8e}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x30, offset 0x195 + {value: 0x0014, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb4, hi: 0xb7}, + {value: 0x0034, lo: 0xb8, hi: 0xba}, + {value: 0x0014, lo: 0xbb, hi: 0xbc}, + // Block 0x31, offset 0x199 + {value: 0x0004, lo: 0x86, hi: 0x86}, + {value: 0x0034, lo: 0x88, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x32, offset 0x19d + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0034, lo: 0x98, hi: 0x99}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0x0034, lo: 0xb5, hi: 0xb5}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + {value: 0x0034, lo: 0xb9, hi: 0xb9}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x33, offset 0x1a4 + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0010, lo: 0x89, hi: 0xac}, + {value: 0x0034, lo: 0xb1, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xba, hi: 0xbd}, + {value: 0x0014, lo: 0xbe, hi: 0xbe}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x34, offset 0x1ad + {value: 0x0034, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0024, lo: 0x82, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x84}, + {value: 0x0024, lo: 0x86, hi: 0x87}, + {value: 0x0010, lo: 0x88, hi: 0x8c}, + {value: 0x0014, lo: 0x8d, hi: 0x97}, + {value: 0x0014, lo: 0x99, hi: 0xbc}, + // Block 0x35, offset 0x1b5 + {value: 0x0034, lo: 0x86, hi: 0x86}, + // Block 0x36, offset 0x1b6 + {value: 0x0010, lo: 0xab, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + {value: 0x0010, lo: 0xb8, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbc}, + {value: 0x0014, lo: 0xbd, hi: 0xbe}, + // Block 0x37, offset 0x1bf + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x96, hi: 0x97}, + {value: 0x0014, lo: 0x98, hi: 0x99}, + {value: 0x0014, lo: 0x9e, hi: 0xa0}, + {value: 0x0010, lo: 0xa2, hi: 0xa4}, + {value: 0x0010, lo: 0xa7, hi: 0xad}, + {value: 0x0014, lo: 0xb1, hi: 0xb4}, + // Block 0x38, offset 0x1c6 + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x84}, + {value: 0x0014, lo: 0x85, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8f, hi: 0x9c}, + {value: 0x0014, lo: 0x9d, hi: 0x9d}, + {value: 0x6c53, lo: 0xa0, hi: 0xbf}, + // Block 0x39, offset 0x1ce + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x98}, + {value: 0x0010, lo: 0x9a, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x3a, offset 0x1d4 + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb5}, + {value: 0x0010, lo: 0xb8, hi: 0xbe}, + // Block 0x3b, offset 0x1d9 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x82, hi: 0x85}, + {value: 0x0010, lo: 0x88, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0xbf}, + // Block 0x3c, offset 0x1dd + {value: 0x0010, lo: 0x80, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0x95}, + {value: 0x0010, lo: 0x98, hi: 0xbf}, + // Block 0x3d, offset 0x1e0 + {value: 0x0010, lo: 0x80, hi: 0x9a}, + {value: 0x0024, lo: 0x9d, hi: 0x9f}, + // Block 0x3e, offset 0x1e2 + {value: 0x0010, lo: 0x80, hi: 0x8f}, + {value: 0x7453, lo: 0xa0, hi: 0xaf}, + {value: 0x7853, lo: 0xb0, hi: 0xbf}, + // Block 0x3f, offset 0x1e5 + {value: 0x7c53, lo: 0x80, hi: 0x8f}, + {value: 0x8053, lo: 0x90, hi: 0x9f}, + {value: 0x7c53, lo: 0xa0, hi: 0xaf}, + {value: 0x0813, lo: 0xb0, hi: 0xb5}, + {value: 0x0892, lo: 0xb8, hi: 0xbd}, + // Block 0x40, offset 0x1ea + {value: 0x0010, lo: 0x81, hi: 0xbf}, + // Block 0x41, offset 0x1eb + {value: 0x0010, lo: 0x80, hi: 0xac}, + {value: 0x0010, lo: 0xaf, hi: 0xbf}, + // Block 0x42, offset 0x1ed + {value: 0x0010, lo: 0x81, hi: 0x9a}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x43, offset 0x1ef + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0010, lo: 0xae, hi: 0xb8}, + // Block 0x44, offset 0x1f1 + {value: 0x0010, lo: 0x80, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x91}, + {value: 0x0014, lo: 0x92, hi: 0x93}, + {value: 0x0034, lo: 0x94, hi: 0x94}, + {value: 0x0010, lo: 0xa0, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + // Block 0x45, offset 0x1f8 + {value: 0x0010, lo: 0x80, hi: 0x91}, + {value: 0x0014, lo: 0x92, hi: 0x93}, + {value: 0x0010, lo: 0xa0, hi: 0xac}, + {value: 0x0010, lo: 0xae, hi: 0xb0}, + {value: 0x0014, lo: 0xb2, hi: 0xb3}, + // Block 0x46, offset 0x1fd + {value: 0x0014, lo: 0xb4, hi: 0xb5}, + {value: 0x0010, lo: 0xb6, hi: 0xb6}, + {value: 0x0014, lo: 0xb7, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x47, offset 0x201 + {value: 0x0010, lo: 0x80, hi: 0x85}, + {value: 0x0014, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0014, lo: 0x89, hi: 0x91}, + {value: 0x0034, lo: 0x92, hi: 0x92}, + {value: 0x0014, lo: 0x93, hi: 0x93}, + {value: 0x0004, lo: 0x97, hi: 0x97}, + {value: 0x0024, lo: 0x9d, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + // Block 0x48, offset 0x20a + {value: 0x0014, lo: 0x8b, hi: 0x8e}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x49, offset 0x20d + {value: 0x0010, lo: 0x80, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0xb8}, + // Block 0x4a, offset 0x210 + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0014, lo: 0x85, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0xa8}, + {value: 0x0034, lo: 0xa9, hi: 0xa9}, + {value: 0x0010, lo: 0xaa, hi: 0xaa}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x4b, offset 0x216 + {value: 0x0010, lo: 0x80, hi: 0xb5}, + // Block 0x4c, offset 0x217 + {value: 0x0010, lo: 0x80, hi: 0x9e}, + {value: 0x0014, lo: 0xa0, hi: 0xa2}, + {value: 0x0010, lo: 0xa3, hi: 0xa6}, + {value: 0x0014, lo: 0xa7, hi: 0xa8}, + {value: 0x0010, lo: 0xa9, hi: 0xab}, + {value: 0x0010, lo: 0xb0, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb2}, + {value: 0x0010, lo: 0xb3, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xb9}, + {value: 0x0024, lo: 0xba, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbb}, + // Block 0x4d, offset 0x222 + {value: 0x0010, lo: 0x86, hi: 0x8f}, + // Block 0x4e, offset 0x223 + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x4f, offset 0x224 + {value: 0x0010, lo: 0x80, hi: 0x96}, + {value: 0x0024, lo: 0x97, hi: 0x97}, + {value: 0x0034, lo: 0x98, hi: 0x98}, + {value: 0x0010, lo: 0x99, hi: 0x9a}, + {value: 0x0014, lo: 0x9b, hi: 0x9b}, + // Block 0x50, offset 0x229 + {value: 0x0010, lo: 0x95, hi: 0x95}, + {value: 0x0014, lo: 0x96, hi: 0x96}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0014, lo: 0x98, hi: 0x9e}, + {value: 0x0034, lo: 0xa0, hi: 0xa0}, + {value: 0x0010, lo: 0xa1, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa2}, + {value: 0x0010, lo: 0xa3, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xac}, + {value: 0x0010, lo: 0xad, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb4}, + {value: 0x0024, lo: 0xb5, hi: 0xbc}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0x51, offset 0x236 + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0004, lo: 0xa7, hi: 0xa7}, + {value: 0x0024, lo: 0xb0, hi: 0xb4}, + {value: 0x0034, lo: 0xb5, hi: 0xba}, + {value: 0x0024, lo: 0xbb, hi: 0xbc}, + {value: 0x0034, lo: 0xbd, hi: 0xbd}, + {value: 0x0014, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0x52, offset 0x23f + {value: 0x0034, lo: 0x80, hi: 0x80}, + // Block 0x53, offset 0x240 + {value: 0x0014, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x54, offset 0x248 + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0030, lo: 0x84, hi: 0x84}, + {value: 0x0010, lo: 0x85, hi: 0x8b}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0024, lo: 0xab, hi: 0xab}, + {value: 0x0034, lo: 0xac, hi: 0xac}, + {value: 0x0024, lo: 0xad, hi: 0xb3}, + // Block 0x55, offset 0x251 + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa5}, + {value: 0x0010, lo: 0xa6, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa9}, + {value: 0x0030, lo: 0xaa, hi: 0xaa}, + {value: 0x0034, lo: 0xab, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xbf}, + // Block 0x56, offset 0x25a + {value: 0x0010, lo: 0x80, hi: 0xa5}, + {value: 0x0034, lo: 0xa6, hi: 0xa6}, + {value: 0x0010, lo: 0xa7, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa9}, + {value: 0x0010, lo: 0xaa, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xae}, + {value: 0x0014, lo: 0xaf, hi: 0xb1}, + {value: 0x0030, lo: 0xb2, hi: 0xb3}, + // Block 0x57, offset 0x263 + {value: 0x0010, lo: 0x80, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xb3}, + {value: 0x0010, lo: 0xb4, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + // Block 0x58, offset 0x268 + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x8d, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbd}, + // Block 0x59, offset 0x26b + {value: 0x31ea, lo: 0x80, hi: 0x80}, + {value: 0x326a, lo: 0x81, hi: 0x81}, + {value: 0x32ea, lo: 0x82, hi: 0x82}, + {value: 0x336a, lo: 0x83, hi: 0x83}, + {value: 0x33ea, lo: 0x84, hi: 0x84}, + {value: 0x346a, lo: 0x85, hi: 0x85}, + {value: 0x34ea, lo: 0x86, hi: 0x86}, + {value: 0x356a, lo: 0x87, hi: 0x87}, + {value: 0x35ea, lo: 0x88, hi: 0x88}, + {value: 0x8353, lo: 0x90, hi: 0xba}, + {value: 0x8353, lo: 0xbd, hi: 0xbf}, + // Block 0x5a, offset 0x276 + {value: 0x0024, lo: 0x90, hi: 0x92}, + {value: 0x0034, lo: 0x94, hi: 0x99}, + {value: 0x0024, lo: 0x9a, hi: 0x9b}, + {value: 0x0034, lo: 0x9c, hi: 0x9f}, + {value: 0x0024, lo: 0xa0, hi: 0xa0}, + {value: 0x0010, lo: 0xa1, hi: 0xa1}, + {value: 0x0034, lo: 0xa2, hi: 0xa8}, + {value: 0x0010, lo: 0xa9, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xb3}, + {value: 0x0024, lo: 0xb4, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb7}, + {value: 0x0024, lo: 0xb8, hi: 0xb9}, + {value: 0x0010, lo: 0xba, hi: 0xba}, + // Block 0x5b, offset 0x284 + {value: 0x0012, lo: 0x80, hi: 0xab}, + {value: 0x0015, lo: 0xac, hi: 0xbf}, + // Block 0x5c, offset 0x286 + {value: 0x0015, lo: 0x80, hi: 0xaa}, + {value: 0x0012, lo: 0xab, hi: 0xb7}, + {value: 0x0015, lo: 0xb8, hi: 0xb8}, + {value: 0x8752, lo: 0xb9, hi: 0xb9}, + {value: 0x0012, lo: 0xba, hi: 0xbc}, + {value: 0x8b52, lo: 0xbd, hi: 0xbd}, + {value: 0x0012, lo: 0xbe, hi: 0xbf}, + // Block 0x5d, offset 0x28d + {value: 0x0012, lo: 0x80, hi: 0x8d}, + {value: 0x8f52, lo: 0x8e, hi: 0x8e}, + {value: 0x0012, lo: 0x8f, hi: 0x9a}, + {value: 0x0015, lo: 0x9b, hi: 0xbf}, + // Block 0x5e, offset 0x291 + {value: 0x0024, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0024, lo: 0x83, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0024, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x90}, + {value: 0x0024, lo: 0x91, hi: 0xb5}, + {value: 0x0034, lo: 0xb6, hi: 0xb9}, + {value: 0x0024, lo: 0xbb, hi: 0xbb}, + {value: 0x0034, lo: 0xbc, hi: 0xbd}, + {value: 0x0024, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0x5f, offset 0x29d + {value: 0x0117, lo: 0x80, hi: 0xbf}, + // Block 0x60, offset 0x29e + {value: 0x0117, lo: 0x80, hi: 0x95}, + {value: 0x369a, lo: 0x96, hi: 0x96}, + {value: 0x374a, lo: 0x97, hi: 0x97}, + {value: 0x37fa, lo: 0x98, hi: 0x98}, + {value: 0x38aa, lo: 0x99, hi: 0x99}, + {value: 0x395a, lo: 0x9a, hi: 0x9a}, + {value: 0x3a0a, lo: 0x9b, hi: 0x9b}, + {value: 0x0012, lo: 0x9c, hi: 0x9d}, + {value: 0x3abb, lo: 0x9e, hi: 0x9e}, + {value: 0x0012, lo: 0x9f, hi: 0x9f}, + {value: 0x0117, lo: 0xa0, hi: 0xbf}, + // Block 0x61, offset 0x2a9 + {value: 0x0812, lo: 0x80, hi: 0x87}, + {value: 0x0813, lo: 0x88, hi: 0x8f}, + {value: 0x0812, lo: 0x90, hi: 0x95}, + {value: 0x0813, lo: 0x98, hi: 0x9d}, + {value: 0x0812, lo: 0xa0, hi: 0xa7}, + {value: 0x0813, lo: 0xa8, hi: 0xaf}, + {value: 0x0812, lo: 0xb0, hi: 0xb7}, + {value: 0x0813, lo: 0xb8, hi: 0xbf}, + // Block 0x62, offset 0x2b1 + {value: 0x0004, lo: 0x8b, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8f}, + {value: 0x0054, lo: 0x98, hi: 0x99}, + {value: 0x0054, lo: 0xa4, hi: 0xa4}, + {value: 0x0054, lo: 0xa7, hi: 0xa7}, + {value: 0x0014, lo: 0xaa, hi: 0xae}, + {value: 0x0010, lo: 0xaf, hi: 0xaf}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x63, offset 0x2b9 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x94, hi: 0x94}, + {value: 0x0014, lo: 0xa0, hi: 0xa4}, + {value: 0x0014, lo: 0xa6, hi: 0xaf}, + {value: 0x0015, lo: 0xb1, hi: 0xb1}, + {value: 0x0015, lo: 0xbf, hi: 0xbf}, + // Block 0x64, offset 0x2bf + {value: 0x0015, lo: 0x90, hi: 0x9c}, + // Block 0x65, offset 0x2c0 + {value: 0x0024, lo: 0x90, hi: 0x91}, + {value: 0x0034, lo: 0x92, hi: 0x93}, + {value: 0x0024, lo: 0x94, hi: 0x97}, + {value: 0x0034, lo: 0x98, hi: 0x9a}, + {value: 0x0024, lo: 0x9b, hi: 0x9c}, + {value: 0x0014, lo: 0x9d, hi: 0xa0}, + {value: 0x0024, lo: 0xa1, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa4}, + {value: 0x0034, lo: 0xa5, hi: 0xa6}, + {value: 0x0024, lo: 0xa7, hi: 0xa7}, + {value: 0x0034, lo: 0xa8, hi: 0xa8}, + {value: 0x0024, lo: 0xa9, hi: 0xa9}, + {value: 0x0034, lo: 0xaa, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb0}, + // Block 0x66, offset 0x2ce + {value: 0x0016, lo: 0x85, hi: 0x86}, + {value: 0x0012, lo: 0x87, hi: 0x89}, + {value: 0xa452, lo: 0x8e, hi: 0x8e}, + {value: 0x1013, lo: 0xa0, hi: 0xaf}, + {value: 0x1012, lo: 0xb0, hi: 0xbf}, + // Block 0x67, offset 0x2d3 + {value: 0x0010, lo: 0x80, hi: 0x82}, + {value: 0x0716, lo: 0x83, hi: 0x84}, + {value: 0x0010, lo: 0x85, hi: 0x88}, + // Block 0x68, offset 0x2d6 + {value: 0xa753, lo: 0xb6, hi: 0xb7}, + {value: 0xaa53, lo: 0xb8, hi: 0xb9}, + {value: 0xad53, lo: 0xba, hi: 0xbb}, + {value: 0xaa53, lo: 0xbc, hi: 0xbd}, + {value: 0xa753, lo: 0xbe, hi: 0xbf}, + // Block 0x69, offset 0x2db + {value: 0x3013, lo: 0x80, hi: 0x8f}, + {value: 0x6553, lo: 0x90, hi: 0x9f}, + {value: 0xb053, lo: 0xa0, hi: 0xae}, + {value: 0x3012, lo: 0xb0, hi: 0xbf}, + // Block 0x6a, offset 0x2df + {value: 0x0117, lo: 0x80, hi: 0xa3}, + {value: 0x0012, lo: 0xa4, hi: 0xa4}, + {value: 0x0716, lo: 0xab, hi: 0xac}, + {value: 0x0316, lo: 0xad, hi: 0xae}, + {value: 0x0024, lo: 0xaf, hi: 0xb1}, + {value: 0x0117, lo: 0xb2, hi: 0xb3}, + // Block 0x6b, offset 0x2e5 + {value: 0x6c52, lo: 0x80, hi: 0x9f}, + {value: 0x7052, lo: 0xa0, hi: 0xa5}, + {value: 0x7052, lo: 0xa7, hi: 0xa7}, + {value: 0x7052, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x6c, offset 0x2ea + {value: 0x0010, lo: 0x80, hi: 0xa7}, + {value: 0x0014, lo: 0xaf, hi: 0xaf}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0x6d, offset 0x2ed + {value: 0x0010, lo: 0x80, hi: 0x96}, + {value: 0x0010, lo: 0xa0, hi: 0xa6}, + {value: 0x0010, lo: 0xa8, hi: 0xae}, + {value: 0x0010, lo: 0xb0, hi: 0xb6}, + {value: 0x0010, lo: 0xb8, hi: 0xbe}, + // Block 0x6e, offset 0x2f2 + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x88, hi: 0x8e}, + {value: 0x0010, lo: 0x90, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x9e}, + {value: 0x0024, lo: 0xa0, hi: 0xbf}, + // Block 0x6f, offset 0x2f7 + {value: 0x0014, lo: 0xaf, hi: 0xaf}, + // Block 0x70, offset 0x2f8 + {value: 0x0014, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0xaa, hi: 0xad}, + {value: 0x0030, lo: 0xae, hi: 0xaf}, + {value: 0x0004, lo: 0xb1, hi: 0xb5}, + {value: 0x0014, lo: 0xbb, hi: 0xbb}, + {value: 0x0010, lo: 0xbc, hi: 0xbc}, + // Block 0x71, offset 0x2fe + {value: 0x0034, lo: 0x99, hi: 0x9a}, + {value: 0x0004, lo: 0x9b, hi: 0x9e}, + // Block 0x72, offset 0x300 + {value: 0x0004, lo: 0xbc, hi: 0xbe}, + // Block 0x73, offset 0x301 + {value: 0x0010, lo: 0x85, hi: 0xaf}, + {value: 0x0010, lo: 0xb1, hi: 0xbf}, + // Block 0x74, offset 0x303 + {value: 0x0010, lo: 0x80, hi: 0x8e}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x75, offset 0x305 + {value: 0x0010, lo: 0x80, hi: 0x94}, + {value: 0x0014, lo: 0x95, hi: 0x95}, + {value: 0x0010, lo: 0x96, hi: 0xbf}, + // Block 0x76, offset 0x308 + {value: 0x0010, lo: 0x80, hi: 0x8c}, + // Block 0x77, offset 0x309 + {value: 0x0010, lo: 0x90, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbd}, + // Block 0x78, offset 0x30b + {value: 0x0010, lo: 0x80, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0010, lo: 0x90, hi: 0xab}, + // Block 0x79, offset 0x30e + {value: 0x0117, lo: 0x80, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xae}, + {value: 0x0024, lo: 0xaf, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb2}, + {value: 0x0024, lo: 0xb4, hi: 0xbd}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x7a, offset 0x314 + {value: 0x0117, lo: 0x80, hi: 0x9b}, + {value: 0x0015, lo: 0x9c, hi: 0x9d}, + {value: 0x0024, lo: 0x9e, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x7b, offset 0x318 + {value: 0x0010, lo: 0x80, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb1}, + // Block 0x7c, offset 0x31a + {value: 0x0004, lo: 0x80, hi: 0x87}, + {value: 0x0014, lo: 0x88, hi: 0xa1}, + {value: 0x0117, lo: 0xa2, hi: 0xaf}, + {value: 0x0012, lo: 0xb0, hi: 0xb1}, + {value: 0x0117, lo: 0xb2, hi: 0xbf}, + // Block 0x7d, offset 0x31f + {value: 0x0117, lo: 0x80, hi: 0xaf}, + {value: 0x0015, lo: 0xb0, hi: 0xb0}, + {value: 0x0012, lo: 0xb1, hi: 0xb8}, + {value: 0x0316, lo: 0xb9, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x8753, lo: 0xbd, hi: 0xbd}, + {value: 0x0117, lo: 0xbe, hi: 0xbf}, + // Block 0x7e, offset 0x326 + {value: 0x0117, lo: 0x82, hi: 0x83}, + {value: 0x6553, lo: 0x84, hi: 0x84}, + {value: 0x908b, lo: 0x85, hi: 0x85}, + {value: 0x8f53, lo: 0x86, hi: 0x86}, + {value: 0x0f16, lo: 0x87, hi: 0x88}, + {value: 0x0316, lo: 0x89, hi: 0x8a}, + {value: 0x0316, lo: 0xb5, hi: 0xb6}, + {value: 0x0010, lo: 0xb7, hi: 0xb7}, + {value: 0x0015, lo: 0xb8, hi: 0xb9}, + {value: 0x0012, lo: 0xba, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbf}, + // Block 0x7f, offset 0x331 + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x8a}, + {value: 0x0014, lo: 0x8b, hi: 0x8b}, + {value: 0x0010, lo: 0x8c, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xa6}, + {value: 0x0010, lo: 0xa7, hi: 0xa7}, + {value: 0x0034, lo: 0xac, hi: 0xac}, + // Block 0x80, offset 0x33b + {value: 0x0010, lo: 0x80, hi: 0xb3}, + // Block 0x81, offset 0x33c + {value: 0x0010, lo: 0x80, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x84}, + {value: 0x0014, lo: 0x85, hi: 0x85}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0024, lo: 0xa0, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xb7}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0010, lo: 0xbd, hi: 0xbe}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x82, offset 0x345 + {value: 0x0010, lo: 0x80, hi: 0xa5}, + {value: 0x0014, lo: 0xa6, hi: 0xaa}, + {value: 0x0034, lo: 0xab, hi: 0xad}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x83, offset 0x349 + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0014, lo: 0x87, hi: 0x91}, + {value: 0x0010, lo: 0x92, hi: 0x92}, + {value: 0x0030, lo: 0x93, hi: 0x93}, + {value: 0x0010, lo: 0xa0, hi: 0xbc}, + // Block 0x84, offset 0x34e + {value: 0x0014, lo: 0x80, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0xb2}, + {value: 0x0034, lo: 0xb3, hi: 0xb3}, + {value: 0x0010, lo: 0xb4, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xb9}, + {value: 0x0010, lo: 0xba, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x85, offset 0x356 + {value: 0x0030, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0014, lo: 0xa5, hi: 0xa5}, + {value: 0x0004, lo: 0xa6, hi: 0xa6}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0x86, offset 0x35c + {value: 0x0010, lo: 0x80, hi: 0xa8}, + {value: 0x0014, lo: 0xa9, hi: 0xae}, + {value: 0x0010, lo: 0xaf, hi: 0xb0}, + {value: 0x0014, lo: 0xb1, hi: 0xb2}, + {value: 0x0010, lo: 0xb3, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb6}, + // Block 0x87, offset 0x362 + {value: 0x0010, lo: 0x80, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0010, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0004, lo: 0xb0, hi: 0xb0}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbd}, + // Block 0x88, offset 0x36c + {value: 0x0024, lo: 0xb0, hi: 0xb0}, + {value: 0x0024, lo: 0xb2, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0024, lo: 0xb7, hi: 0xb8}, + {value: 0x0024, lo: 0xbe, hi: 0xbf}, + // Block 0x89, offset 0x371 + {value: 0x0024, lo: 0x81, hi: 0x81}, + {value: 0x0004, lo: 0x9d, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xaf}, + {value: 0x0010, lo: 0xb2, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb5}, + {value: 0x0034, lo: 0xb6, hi: 0xb6}, + // Block 0x8a, offset 0x37a + {value: 0x0010, lo: 0x81, hi: 0x86}, + {value: 0x0010, lo: 0x89, hi: 0x8e}, + {value: 0x0010, lo: 0x91, hi: 0x96}, + {value: 0x0010, lo: 0xa0, hi: 0xa6}, + {value: 0x0010, lo: 0xa8, hi: 0xae}, + {value: 0x0012, lo: 0xb0, hi: 0xbf}, + // Block 0x8b, offset 0x380 + {value: 0x0012, lo: 0x80, hi: 0x92}, + {value: 0xb352, lo: 0x93, hi: 0x93}, + {value: 0x0012, lo: 0x94, hi: 0x9a}, + {value: 0x0014, lo: 0x9b, hi: 0x9b}, + {value: 0x0015, lo: 0x9c, hi: 0x9f}, + {value: 0x0012, lo: 0xa0, hi: 0xa8}, + {value: 0x0014, lo: 0xa9, hi: 0xa9}, + {value: 0x0004, lo: 0xaa, hi: 0xab}, + {value: 0x74d2, lo: 0xb0, hi: 0xbf}, + // Block 0x8c, offset 0x389 + {value: 0x78d2, lo: 0x80, hi: 0x8f}, + {value: 0x7cd2, lo: 0x90, hi: 0x9f}, + {value: 0x80d2, lo: 0xa0, hi: 0xaf}, + {value: 0x7cd2, lo: 0xb0, hi: 0xbf}, + // Block 0x8d, offset 0x38d + {value: 0x0010, lo: 0x80, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xa5}, + {value: 0x0010, lo: 0xa6, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa8}, + {value: 0x0010, lo: 0xa9, hi: 0xaa}, + {value: 0x0010, lo: 0xac, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0x8e, offset 0x395 + {value: 0x0010, lo: 0x80, hi: 0xa3}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x8f, offset 0x397 + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x8b, hi: 0xbb}, + // Block 0x90, offset 0x399 + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x83, hi: 0x84}, + {value: 0x0010, lo: 0x86, hi: 0xbf}, + // Block 0x91, offset 0x39c + {value: 0x0010, lo: 0x80, hi: 0xb1}, + {value: 0x0004, lo: 0xb2, hi: 0xbf}, + // Block 0x92, offset 0x39e + {value: 0x0004, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x93, hi: 0xbf}, + // Block 0x93, offset 0x3a0 + {value: 0x0010, lo: 0x80, hi: 0xbd}, + // Block 0x94, offset 0x3a1 + {value: 0x0010, lo: 0x90, hi: 0xbf}, + // Block 0x95, offset 0x3a2 + {value: 0x0010, lo: 0x80, hi: 0x8f}, + {value: 0x0010, lo: 0x92, hi: 0xbf}, + // Block 0x96, offset 0x3a4 + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0010, lo: 0xb0, hi: 0xbb}, + // Block 0x97, offset 0x3a6 + {value: 0x0014, lo: 0x80, hi: 0x8f}, + {value: 0x0054, lo: 0x93, hi: 0x93}, + {value: 0x0024, lo: 0xa0, hi: 0xa6}, + {value: 0x0034, lo: 0xa7, hi: 0xad}, + {value: 0x0024, lo: 0xae, hi: 0xaf}, + {value: 0x0010, lo: 0xb3, hi: 0xb4}, + // Block 0x98, offset 0x3ac + {value: 0x0010, lo: 0x8d, hi: 0x8f}, + {value: 0x0054, lo: 0x92, hi: 0x92}, + {value: 0x0054, lo: 0x95, hi: 0x95}, + {value: 0x0010, lo: 0xb0, hi: 0xb4}, + {value: 0x0010, lo: 0xb6, hi: 0xbf}, + // Block 0x99, offset 0x3b1 + {value: 0x0010, lo: 0x80, hi: 0xbc}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x9a, offset 0x3b3 + {value: 0x0054, lo: 0x87, hi: 0x87}, + {value: 0x0054, lo: 0x8e, hi: 0x8e}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0054, lo: 0x9a, hi: 0x9a}, + {value: 0x5f53, lo: 0xa1, hi: 0xba}, + {value: 0x0004, lo: 0xbe, hi: 0xbe}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x9b, offset 0x3ba + {value: 0x0004, lo: 0x80, hi: 0x80}, + {value: 0x5f52, lo: 0x81, hi: 0x9a}, + {value: 0x0004, lo: 0xb0, hi: 0xb0}, + // Block 0x9c, offset 0x3bd + {value: 0x0014, lo: 0x9e, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xbe}, + // Block 0x9d, offset 0x3bf + {value: 0x0010, lo: 0x82, hi: 0x87}, + {value: 0x0010, lo: 0x8a, hi: 0x8f}, + {value: 0x0010, lo: 0x92, hi: 0x97}, + {value: 0x0010, lo: 0x9a, hi: 0x9c}, + {value: 0x0004, lo: 0xa3, hi: 0xa3}, + {value: 0x0014, lo: 0xb9, hi: 0xbb}, + // Block 0x9e, offset 0x3c5 + {value: 0x0010, lo: 0x80, hi: 0x8b}, + {value: 0x0010, lo: 0x8d, hi: 0xa6}, + {value: 0x0010, lo: 0xa8, hi: 0xba}, + {value: 0x0010, lo: 0xbc, hi: 0xbd}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x9f, offset 0x3ca + {value: 0x0010, lo: 0x80, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x9d}, + // Block 0xa0, offset 0x3cc + {value: 0x0010, lo: 0x80, hi: 0xba}, + // Block 0xa1, offset 0x3cd + {value: 0x0010, lo: 0x80, hi: 0xb4}, + // Block 0xa2, offset 0x3ce + {value: 0x0034, lo: 0xbd, hi: 0xbd}, + // Block 0xa3, offset 0x3cf + {value: 0x0010, lo: 0x80, hi: 0x9c}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0xa4, offset 0x3d1 + {value: 0x0010, lo: 0x80, hi: 0x90}, + {value: 0x0034, lo: 0xa0, hi: 0xa0}, + // Block 0xa5, offset 0x3d3 + {value: 0x0010, lo: 0x80, hi: 0x9f}, + {value: 0x0010, lo: 0xad, hi: 0xbf}, + // Block 0xa6, offset 0x3d5 + {value: 0x0010, lo: 0x80, hi: 0x8a}, + {value: 0x0010, lo: 0x90, hi: 0xb5}, + {value: 0x0024, lo: 0xb6, hi: 0xba}, + // Block 0xa7, offset 0x3d8 + {value: 0x0010, lo: 0x80, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0xa8, offset 0x3da + {value: 0x0010, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x88, hi: 0x8f}, + {value: 0x0010, lo: 0x91, hi: 0x95}, + // Block 0xa9, offset 0x3dd + {value: 0x2813, lo: 0x80, hi: 0x87}, + {value: 0x3813, lo: 0x88, hi: 0x8f}, + {value: 0x2813, lo: 0x90, hi: 0x97}, + {value: 0xb653, lo: 0x98, hi: 0x9f}, + {value: 0xb953, lo: 0xa0, hi: 0xa7}, + {value: 0x2812, lo: 0xa8, hi: 0xaf}, + {value: 0x3812, lo: 0xb0, hi: 0xb7}, + {value: 0x2812, lo: 0xb8, hi: 0xbf}, + // Block 0xaa, offset 0x3e5 + {value: 0xb652, lo: 0x80, hi: 0x87}, + {value: 0xb952, lo: 0x88, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0xbf}, + // Block 0xab, offset 0x3e8 + {value: 0x0010, lo: 0x80, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0xb953, lo: 0xb0, hi: 0xb7}, + {value: 0xb653, lo: 0xb8, hi: 0xbf}, + // Block 0xac, offset 0x3ec + {value: 0x2813, lo: 0x80, hi: 0x87}, + {value: 0x3813, lo: 0x88, hi: 0x8f}, + {value: 0x2813, lo: 0x90, hi: 0x93}, + {value: 0xb952, lo: 0x98, hi: 0x9f}, + {value: 0xb652, lo: 0xa0, hi: 0xa7}, + {value: 0x2812, lo: 0xa8, hi: 0xaf}, + {value: 0x3812, lo: 0xb0, hi: 0xb7}, + {value: 0x2812, lo: 0xb8, hi: 0xbb}, + // Block 0xad, offset 0x3f4 + {value: 0x0010, lo: 0x80, hi: 0xa7}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0xae, offset 0x3f6 + {value: 0x0010, lo: 0x80, hi: 0xa3}, + // Block 0xaf, offset 0x3f7 + {value: 0x0010, lo: 0x80, hi: 0xb6}, + // Block 0xb0, offset 0x3f8 + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xa7}, + // Block 0xb1, offset 0x3fa + {value: 0x0010, lo: 0x80, hi: 0x85}, + {value: 0x0010, lo: 0x88, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0xb5}, + {value: 0x0010, lo: 0xb7, hi: 0xb8}, + {value: 0x0010, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xb2, offset 0x400 + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xb6}, + // Block 0xb3, offset 0x402 + {value: 0x0010, lo: 0x80, hi: 0x9e}, + // Block 0xb4, offset 0x403 + {value: 0x0010, lo: 0xa0, hi: 0xb2}, + {value: 0x0010, lo: 0xb4, hi: 0xb5}, + // Block 0xb5, offset 0x405 + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xb9}, + // Block 0xb6, offset 0x407 + {value: 0x0010, lo: 0x80, hi: 0xb7}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0xb7, offset 0x409 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x83}, + {value: 0x0014, lo: 0x85, hi: 0x86}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0014, lo: 0x8e, hi: 0x8e}, + {value: 0x0024, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0x93}, + {value: 0x0010, lo: 0x95, hi: 0x97}, + {value: 0x0010, lo: 0x99, hi: 0xb5}, + {value: 0x0024, lo: 0xb8, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xb8, offset 0x416 + {value: 0x0010, lo: 0xa0, hi: 0xbc}, + // Block 0xb9, offset 0x417 + {value: 0x0010, lo: 0x80, hi: 0x9c}, + // Block 0xba, offset 0x418 + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0010, lo: 0x89, hi: 0xa4}, + {value: 0x0024, lo: 0xa5, hi: 0xa5}, + {value: 0x0034, lo: 0xa6, hi: 0xa6}, + // Block 0xbb, offset 0x41c + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xb2}, + // Block 0xbc, offset 0x41e + {value: 0x0010, lo: 0x80, hi: 0x91}, + // Block 0xbd, offset 0x41f + {value: 0x0010, lo: 0x80, hi: 0x88}, + // Block 0xbe, offset 0x420 + {value: 0x5653, lo: 0x80, hi: 0xb2}, + // Block 0xbf, offset 0x421 + {value: 0x5652, lo: 0x80, hi: 0xb2}, + // Block 0xc0, offset 0x422 + {value: 0x0010, lo: 0x80, hi: 0xa3}, + {value: 0x0024, lo: 0xa4, hi: 0xa7}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0xc1, offset 0x425 + {value: 0x0010, lo: 0x80, hi: 0xa9}, + {value: 0x0024, lo: 0xab, hi: 0xac}, + {value: 0x0010, lo: 0xb0, hi: 0xb1}, + // Block 0xc2, offset 0x428 + {value: 0x0010, lo: 0x80, hi: 0x9c}, + {value: 0x0010, lo: 0xa7, hi: 0xa7}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0xc3, offset 0x42b + {value: 0x0010, lo: 0x80, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x87}, + {value: 0x0024, lo: 0x88, hi: 0x8a}, + {value: 0x0034, lo: 0x8b, hi: 0x8b}, + {value: 0x0024, lo: 0x8c, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x90}, + // Block 0xc4, offset 0x431 + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0xc5, offset 0x432 + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0010, lo: 0xa0, hi: 0xb6}, + // Block 0xc6, offset 0x434 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbf}, + // Block 0xc7, offset 0x438 + {value: 0x0014, lo: 0x80, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xc8, offset 0x43c + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb6}, + {value: 0x0010, lo: 0xb7, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0014, lo: 0xbd, hi: 0xbd}, + // Block 0xc9, offset 0x442 + {value: 0x0014, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0xa8}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0xca, offset 0x445 + {value: 0x0024, lo: 0x80, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0xa6}, + {value: 0x0014, lo: 0xa7, hi: 0xab}, + {value: 0x0010, lo: 0xac, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xb2}, + {value: 0x0034, lo: 0xb3, hi: 0xb4}, + {value: 0x0010, lo: 0xb6, hi: 0xbf}, + // Block 0xcb, offset 0x44c + {value: 0x0010, lo: 0x84, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0xb2}, + {value: 0x0034, lo: 0xb3, hi: 0xb3}, + {value: 0x0010, lo: 0xb6, hi: 0xb6}, + // Block 0xcc, offset 0x450 + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xbe}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xcd, offset 0x454 + {value: 0x0030, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x84}, + {value: 0x0014, lo: 0x89, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0014, lo: 0x8b, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x8e}, + {value: 0x0014, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0x9a}, + {value: 0x0010, lo: 0x9c, hi: 0x9c}, + // Block 0xce, offset 0x45d + {value: 0x0010, lo: 0x80, hi: 0x91}, + {value: 0x0010, lo: 0x93, hi: 0xae}, + {value: 0x0014, lo: 0xaf, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0014, lo: 0xb4, hi: 0xb4}, + {value: 0x0030, lo: 0xb5, hi: 0xb5}, + {value: 0x0034, lo: 0xb6, hi: 0xb6}, + {value: 0x0014, lo: 0xb7, hi: 0xb7}, + {value: 0x0014, lo: 0xbe, hi: 0xbe}, + // Block 0xcf, offset 0x466 + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x88, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8d}, + {value: 0x0010, lo: 0x8f, hi: 0x9d}, + {value: 0x0010, lo: 0x9f, hi: 0xa8}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0xd0, offset 0x46c + {value: 0x0010, lo: 0x80, hi: 0x9e}, + {value: 0x0014, lo: 0x9f, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa2}, + {value: 0x0014, lo: 0xa3, hi: 0xa8}, + {value: 0x0034, lo: 0xa9, hi: 0xaa}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0xd1, offset 0x472 + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbb, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0xd2, offset 0x47c + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0030, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0x9d, hi: 0xa3}, + {value: 0x0024, lo: 0xa6, hi: 0xac}, + {value: 0x0024, lo: 0xb0, hi: 0xb4}, + // Block 0xd3, offset 0x486 + {value: 0x0010, lo: 0x80, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbf}, + // Block 0xd4, offset 0x488 + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x84}, + {value: 0x0010, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x8a}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0024, lo: 0x9e, hi: 0x9e}, + {value: 0x0010, lo: 0x9f, hi: 0xa1}, + // Block 0xd5, offset 0x491 + {value: 0x0010, lo: 0x80, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb8}, + {value: 0x0010, lo: 0xb9, hi: 0xb9}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbe}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0xd6, offset 0x497 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0x85}, + {value: 0x0010, lo: 0x87, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0xd7, offset 0x49d + {value: 0x0010, lo: 0x80, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb5}, + {value: 0x0010, lo: 0xb8, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xd8, offset 0x4a3 + {value: 0x0034, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x98, hi: 0x9b}, + {value: 0x0014, lo: 0x9c, hi: 0x9d}, + // Block 0xd9, offset 0x4a6 + {value: 0x0010, lo: 0x80, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbc}, + {value: 0x0014, lo: 0xbd, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xda, offset 0x4ac + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x84, hi: 0x84}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0xdb, offset 0x4af + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0014, lo: 0xab, hi: 0xab}, + {value: 0x0010, lo: 0xac, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb5}, + {value: 0x0030, lo: 0xb6, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + {value: 0x0010, lo: 0xb8, hi: 0xb8}, + // Block 0xdc, offset 0x4b8 + {value: 0x0010, lo: 0x80, hi: 0x89}, + // Block 0xdd, offset 0x4b9 + {value: 0x0014, lo: 0x9d, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa5}, + {value: 0x0010, lo: 0xa6, hi: 0xa6}, + {value: 0x0014, lo: 0xa7, hi: 0xaa}, + {value: 0x0034, lo: 0xab, hi: 0xab}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0xde, offset 0x4c0 + {value: 0x0010, lo: 0x80, hi: 0xae}, + {value: 0x0014, lo: 0xaf, hi: 0xb7}, + {value: 0x0010, lo: 0xb8, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + // Block 0xdf, offset 0x4c4 + {value: 0x5f53, lo: 0xa0, hi: 0xbf}, + // Block 0xe0, offset 0x4c5 + {value: 0x5f52, lo: 0x80, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xe1, offset 0x4c8 + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x89, hi: 0x89}, + {value: 0x0010, lo: 0x8c, hi: 0x93}, + {value: 0x0010, lo: 0x95, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0xb5}, + {value: 0x0010, lo: 0xb7, hi: 0xb8}, + {value: 0x0014, lo: 0xbb, hi: 0xbc}, + {value: 0x0030, lo: 0xbd, hi: 0xbd}, + {value: 0x0034, lo: 0xbe, hi: 0xbe}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xe2, offset 0x4d2 + {value: 0x0010, lo: 0x80, hi: 0x82}, + {value: 0x0034, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0xe3, offset 0x4d5 + {value: 0x0010, lo: 0xa0, hi: 0xa7}, + {value: 0x0010, lo: 0xaa, hi: 0xbf}, + // Block 0xe4, offset 0x4d7 + {value: 0x0010, lo: 0x80, hi: 0x93}, + {value: 0x0014, lo: 0x94, hi: 0x97}, + {value: 0x0014, lo: 0x9a, hi: 0x9b}, + {value: 0x0010, lo: 0x9c, hi: 0x9f}, + {value: 0x0034, lo: 0xa0, hi: 0xa0}, + {value: 0x0010, lo: 0xa1, hi: 0xa1}, + {value: 0x0010, lo: 0xa3, hi: 0xa4}, + // Block 0xe5, offset 0x4de + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x8a}, + {value: 0x0010, lo: 0x8b, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb8}, + {value: 0x0010, lo: 0xb9, hi: 0xba}, + {value: 0x0014, lo: 0xbb, hi: 0xbe}, + // Block 0xe6, offset 0x4e6 + {value: 0x0034, lo: 0x87, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0014, lo: 0x91, hi: 0x96}, + {value: 0x0010, lo: 0x97, hi: 0x98}, + {value: 0x0014, lo: 0x99, hi: 0x9b}, + {value: 0x0010, lo: 0x9c, hi: 0xbf}, + // Block 0xe7, offset 0x4ec + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0014, lo: 0x8a, hi: 0x96}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0014, lo: 0x98, hi: 0x98}, + {value: 0x0034, lo: 0x99, hi: 0x99}, + {value: 0x0010, lo: 0x9d, hi: 0x9d}, + // Block 0xe8, offset 0x4f2 + {value: 0x0010, lo: 0x80, hi: 0xb8}, + // Block 0xe9, offset 0x4f3 + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb6}, + {value: 0x0014, lo: 0xb8, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xea, offset 0x4f9 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0010, lo: 0xb2, hi: 0xbf}, + // Block 0xeb, offset 0x4fc + {value: 0x0010, lo: 0x80, hi: 0x8f}, + {value: 0x0014, lo: 0x92, hi: 0xa7}, + {value: 0x0010, lo: 0xa9, hi: 0xa9}, + {value: 0x0014, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb4, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb6}, + // Block 0xec, offset 0x504 + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x88, hi: 0x89}, + {value: 0x0010, lo: 0x8b, hi: 0xb0}, + {value: 0x0014, lo: 0xb1, hi: 0xb6}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + {value: 0x0014, lo: 0xbc, hi: 0xbd}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0xed, offset 0x50b + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x85}, + {value: 0x0010, lo: 0x86, hi: 0x86}, + {value: 0x0014, lo: 0x87, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0010, lo: 0xa0, hi: 0xa5}, + {value: 0x0010, lo: 0xa7, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xbf}, + // Block 0xee, offset 0x515 + {value: 0x0010, lo: 0x80, hi: 0x8e}, + {value: 0x0014, lo: 0x90, hi: 0x91}, + {value: 0x0010, lo: 0x93, hi: 0x94}, + {value: 0x0014, lo: 0x95, hi: 0x95}, + {value: 0x0010, lo: 0x96, hi: 0x96}, + {value: 0x0034, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0x98, hi: 0x98}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + // Block 0xef, offset 0x51d + {value: 0x0010, lo: 0xa0, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb6}, + // Block 0xf0, offset 0x520 + {value: 0x0010, lo: 0xb0, hi: 0xb0}, + // Block 0xf1, offset 0x521 + {value: 0x0010, lo: 0x80, hi: 0x99}, + // Block 0xf2, offset 0x522 + {value: 0x0010, lo: 0x80, hi: 0xae}, + // Block 0xf3, offset 0x523 + {value: 0x0010, lo: 0x80, hi: 0x83}, + // Block 0xf4, offset 0x524 + {value: 0x0010, lo: 0x80, hi: 0xae}, + {value: 0x0014, lo: 0xb0, hi: 0xb8}, + // Block 0xf5, offset 0x526 + {value: 0x0010, lo: 0x80, hi: 0x86}, + // Block 0xf6, offset 0x527 + {value: 0x0010, lo: 0x80, hi: 0x9e}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + // Block 0xf7, offset 0x529 + {value: 0x0010, lo: 0x90, hi: 0xad}, + {value: 0x0034, lo: 0xb0, hi: 0xb4}, + // Block 0xf8, offset 0x52b + {value: 0x0010, lo: 0x80, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb6}, + // Block 0xf9, offset 0x52d + {value: 0x0014, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0010, lo: 0xa3, hi: 0xb7}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0xfa, offset 0x531 + {value: 0x0010, lo: 0x80, hi: 0x8f}, + // Block 0xfb, offset 0x532 + {value: 0x2013, lo: 0x80, hi: 0x9f}, + {value: 0x2012, lo: 0xa0, hi: 0xbf}, + // Block 0xfc, offset 0x534 + {value: 0x0010, lo: 0x80, hi: 0x8a}, + {value: 0x0014, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0xbf}, + // Block 0xfd, offset 0x537 + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0014, lo: 0x8f, hi: 0x9f}, + // Block 0xfe, offset 0x539 + {value: 0x0014, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa3, hi: 0xa4}, + {value: 0x0030, lo: 0xb0, hi: 0xb1}, + // Block 0xff, offset 0x53c + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0010, lo: 0xb0, hi: 0xbc}, + // Block 0x100, offset 0x53e + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0014, lo: 0x9d, hi: 0x9d}, + {value: 0x0034, lo: 0x9e, hi: 0x9e}, + {value: 0x0014, lo: 0xa0, hi: 0xa3}, + // Block 0x101, offset 0x543 + {value: 0x0030, lo: 0xa5, hi: 0xa6}, + {value: 0x0034, lo: 0xa7, hi: 0xa9}, + {value: 0x0030, lo: 0xad, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbf}, + // Block 0x102, offset 0x548 + {value: 0x0034, lo: 0x80, hi: 0x82}, + {value: 0x0024, lo: 0x85, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8b}, + {value: 0x0024, lo: 0xaa, hi: 0xad}, + // Block 0x103, offset 0x54c + {value: 0x0024, lo: 0x82, hi: 0x84}, + // Block 0x104, offset 0x54d + {value: 0x0013, lo: 0x80, hi: 0x99}, + {value: 0x0012, lo: 0x9a, hi: 0xb3}, + {value: 0x0013, lo: 0xb4, hi: 0xbf}, + // Block 0x105, offset 0x550 + {value: 0x0013, lo: 0x80, hi: 0x8d}, + {value: 0x0012, lo: 0x8e, hi: 0x94}, + {value: 0x0012, lo: 0x96, hi: 0xa7}, + {value: 0x0013, lo: 0xa8, hi: 0xbf}, + // Block 0x106, offset 0x554 + {value: 0x0013, lo: 0x80, hi: 0x81}, + {value: 0x0012, lo: 0x82, hi: 0x9b}, + {value: 0x0013, lo: 0x9c, hi: 0x9c}, + {value: 0x0013, lo: 0x9e, hi: 0x9f}, + {value: 0x0013, lo: 0xa2, hi: 0xa2}, + {value: 0x0013, lo: 0xa5, hi: 0xa6}, + {value: 0x0013, lo: 0xa9, hi: 0xac}, + {value: 0x0013, lo: 0xae, hi: 0xb5}, + {value: 0x0012, lo: 0xb6, hi: 0xb9}, + {value: 0x0012, lo: 0xbb, hi: 0xbb}, + {value: 0x0012, lo: 0xbd, hi: 0xbf}, + // Block 0x107, offset 0x55f + {value: 0x0012, lo: 0x80, hi: 0x83}, + {value: 0x0012, lo: 0x85, hi: 0x8f}, + {value: 0x0013, lo: 0x90, hi: 0xa9}, + {value: 0x0012, lo: 0xaa, hi: 0xbf}, + // Block 0x108, offset 0x563 + {value: 0x0012, lo: 0x80, hi: 0x83}, + {value: 0x0013, lo: 0x84, hi: 0x85}, + {value: 0x0013, lo: 0x87, hi: 0x8a}, + {value: 0x0013, lo: 0x8d, hi: 0x94}, + {value: 0x0013, lo: 0x96, hi: 0x9c}, + {value: 0x0012, lo: 0x9e, hi: 0xb7}, + {value: 0x0013, lo: 0xb8, hi: 0xb9}, + {value: 0x0013, lo: 0xbb, hi: 0xbe}, + // Block 0x109, offset 0x56b + {value: 0x0013, lo: 0x80, hi: 0x84}, + {value: 0x0013, lo: 0x86, hi: 0x86}, + {value: 0x0013, lo: 0x8a, hi: 0x90}, + {value: 0x0012, lo: 0x92, hi: 0xab}, + {value: 0x0013, lo: 0xac, hi: 0xbf}, + // Block 0x10a, offset 0x570 + {value: 0x0013, lo: 0x80, hi: 0x85}, + {value: 0x0012, lo: 0x86, hi: 0x9f}, + {value: 0x0013, lo: 0xa0, hi: 0xb9}, + {value: 0x0012, lo: 0xba, hi: 0xbf}, + // Block 0x10b, offset 0x574 + {value: 0x0012, lo: 0x80, hi: 0x93}, + {value: 0x0013, lo: 0x94, hi: 0xad}, + {value: 0x0012, lo: 0xae, hi: 0xbf}, + // Block 0x10c, offset 0x577 + {value: 0x0012, lo: 0x80, hi: 0x87}, + {value: 0x0013, lo: 0x88, hi: 0xa1}, + {value: 0x0012, lo: 0xa2, hi: 0xbb}, + {value: 0x0013, lo: 0xbc, hi: 0xbf}, + // Block 0x10d, offset 0x57b + {value: 0x0013, lo: 0x80, hi: 0x95}, + {value: 0x0012, lo: 0x96, hi: 0xaf}, + {value: 0x0013, lo: 0xb0, hi: 0xbf}, + // Block 0x10e, offset 0x57e + {value: 0x0013, lo: 0x80, hi: 0x89}, + {value: 0x0012, lo: 0x8a, hi: 0xa5}, + {value: 0x0013, lo: 0xa8, hi: 0xbf}, + // Block 0x10f, offset 0x581 + {value: 0x0013, lo: 0x80, hi: 0x80}, + {value: 0x0012, lo: 0x82, hi: 0x9a}, + {value: 0x0012, lo: 0x9c, hi: 0xa1}, + {value: 0x0013, lo: 0xa2, hi: 0xba}, + {value: 0x0012, lo: 0xbc, hi: 0xbf}, + // Block 0x110, offset 0x586 + {value: 0x0012, lo: 0x80, hi: 0x94}, + {value: 0x0012, lo: 0x96, hi: 0x9b}, + {value: 0x0013, lo: 0x9c, hi: 0xb4}, + {value: 0x0012, lo: 0xb6, hi: 0xbf}, + // Block 0x111, offset 0x58a + {value: 0x0012, lo: 0x80, hi: 0x8e}, + {value: 0x0012, lo: 0x90, hi: 0x95}, + {value: 0x0013, lo: 0x96, hi: 0xae}, + {value: 0x0012, lo: 0xb0, hi: 0xbf}, + // Block 0x112, offset 0x58e + {value: 0x0012, lo: 0x80, hi: 0x88}, + {value: 0x0012, lo: 0x8a, hi: 0x8f}, + {value: 0x0013, lo: 0x90, hi: 0xa8}, + {value: 0x0012, lo: 0xaa, hi: 0xbf}, + // Block 0x113, offset 0x592 + {value: 0x0012, lo: 0x80, hi: 0x82}, + {value: 0x0012, lo: 0x84, hi: 0x89}, + {value: 0x0017, lo: 0x8a, hi: 0x8b}, + {value: 0x0010, lo: 0x8e, hi: 0xbf}, + // Block 0x114, offset 0x596 + {value: 0x0014, lo: 0x80, hi: 0xb6}, + {value: 0x0014, lo: 0xbb, hi: 0xbf}, + // Block 0x115, offset 0x598 + {value: 0x0014, lo: 0x80, hi: 0xac}, + {value: 0x0014, lo: 0xb5, hi: 0xb5}, + // Block 0x116, offset 0x59a + {value: 0x0014, lo: 0x84, hi: 0x84}, + {value: 0x0014, lo: 0x9b, hi: 0x9f}, + {value: 0x0014, lo: 0xa1, hi: 0xaf}, + // Block 0x117, offset 0x59d + {value: 0x0024, lo: 0x80, hi: 0x86}, + {value: 0x0024, lo: 0x88, hi: 0x98}, + {value: 0x0024, lo: 0x9b, hi: 0xa1}, + {value: 0x0024, lo: 0xa3, hi: 0xa4}, + {value: 0x0024, lo: 0xa6, hi: 0xaa}, + // Block 0x118, offset 0x5a2 + {value: 0x0010, lo: 0x80, hi: 0xac}, + {value: 0x0024, lo: 0xb0, hi: 0xb6}, + {value: 0x0014, lo: 0xb7, hi: 0xbd}, + // Block 0x119, offset 0x5a5 + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x8e, hi: 0x8e}, + // Block 0x11a, offset 0x5a7 + {value: 0x0010, lo: 0x80, hi: 0xab}, + {value: 0x0024, lo: 0xac, hi: 0xaf}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0x11b, offset 0x5aa + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0034, lo: 0x90, hi: 0x96}, + // Block 0x11c, offset 0x5ac + {value: 0xbc52, lo: 0x80, hi: 0x81}, + {value: 0xbf52, lo: 0x82, hi: 0x83}, + {value: 0x0024, lo: 0x84, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0014, lo: 0x8b, hi: 0x8b}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x11d, offset 0x5b2 + {value: 0x0010, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x9f}, + {value: 0x0010, lo: 0xa1, hi: 0xa2}, + {value: 0x0010, lo: 0xa4, hi: 0xa4}, + {value: 0x0010, lo: 0xa7, hi: 0xa7}, + {value: 0x0010, lo: 0xa9, hi: 0xb2}, + {value: 0x0010, lo: 0xb4, hi: 0xb7}, + {value: 0x0010, lo: 0xb9, hi: 0xb9}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + // Block 0x11e, offset 0x5bb + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x8b, hi: 0x9b}, + {value: 0x0010, lo: 0xa1, hi: 0xa3}, + {value: 0x0010, lo: 0xa5, hi: 0xa9}, + {value: 0x0010, lo: 0xab, hi: 0xbb}, + // Block 0x11f, offset 0x5c0 + {value: 0x0013, lo: 0xb0, hi: 0xbf}, + // Block 0x120, offset 0x5c1 + {value: 0x0013, lo: 0x80, hi: 0x89}, + {value: 0x0013, lo: 0x90, hi: 0xa9}, + {value: 0x0013, lo: 0xb0, hi: 0xbf}, + // Block 0x121, offset 0x5c4 + {value: 0x0013, lo: 0x80, hi: 0x89}, + // Block 0x122, offset 0x5c5 + {value: 0x0014, lo: 0xbb, hi: 0xbf}, + // Block 0x123, offset 0x5c6 + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0x124, offset 0x5c7 + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0014, lo: 0xa0, hi: 0xbf}, + // Block 0x125, offset 0x5c9 + {value: 0x0014, lo: 0x80, hi: 0xbf}, + // Block 0x126, offset 0x5ca + {value: 0x0014, lo: 0x80, hi: 0xaf}, +} + +// Total table size 15212 bytes (14KiB); checksum: 1EB13752 diff --git a/vendor/golang.org/x/text/cases/tables9.0.0.go b/vendor/golang.org/x/text/cases/tables9.0.0.go new file mode 100644 index 00000000..636d5d14 --- /dev/null +++ b/vendor/golang.org/x/text/cases/tables9.0.0.go @@ -0,0 +1,2216 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +//go:build !go1.10 +// +build !go1.10 + +package cases + +// UnicodeVersion is the Unicode version from which the tables in this package are derived. +const UnicodeVersion = "9.0.0" + +var xorData string = "" + // Size: 185 bytes + "\x00\x06\x07\x00\x01?\x00\x0f\x03\x00\x0f\x12\x00\x0f\x1f\x00\x0f\x1d" + + "\x00\x01\x13\x00\x0f\x16\x00\x0f\x0b\x00\x0f3\x00\x0f7\x00\x01#\x00\x0f?" + + "\x00\x0e'\x00\x0f/\x00\x0e>\x00\x0f*\x00\x0c&\x00\x0c*\x00\x0c;\x00\x0c9" + + "\x00\x0c%\x00\x01\x08\x00\x03\x0d\x00\x03\x09\x00\x02\x06\x00\x02\x02" + + "\x00\x02\x0c\x00\x01\x00\x00\x01\x03\x00\x01\x01\x00\x01 \x00\x01\x0c" + + "\x00\x01\x10\x00\x03\x10\x00\x036 \x00\x037 \x00\x0b#\x10\x00\x0b 0\x00" + + "\x0b!\x10\x00\x0b!0\x00\x0b(\x04\x00\x03\x04\x1e\x00\x03\x0a\x00\x02:" + + "\x00\x02>\x00\x02,\x00\x02\x00\x00\x02\x10\x00\x01<\x00\x01&\x00\x01*" + + "\x00\x01.\x00\x010\x003 \x00\x01\x18\x00\x01(\x00\x01\x1e\x00\x01\x22" + +var exceptions string = "" + // Size: 2068 bytes + "\x00\x12\x12μΜΜ\x12\x12ssSSSs\x13\x18i̇i̇\x10\x09II\x13\x1bʼnʼNʼN\x11" + + "\x09sSS\x12\x12dždžDž\x12\x12dždžDŽ\x10\x12DŽDž\x12\x12ljljLj\x12\x12ljljLJ\x10\x12LJLj" + + "\x12\x12njnjNj\x12\x12njnjNJ\x10\x12NJNj\x13\x1bǰJ̌J̌\x12\x12dzdzDz\x12\x12dzdzDZ\x10" + + "\x12DZDz\x13\x18ⱥⱥ\x13\x18ⱦⱦ\x10\x1bⱾⱾ\x10\x1bⱿⱿ\x10\x1bⱯⱯ\x10\x1bⱭⱭ\x10" + + "\x1bⱰⱰ\x10\x1bꞫꞫ\x10\x1bꞬꞬ\x10\x1bꞍꞍ\x10\x1bꞪꞪ\x10\x1bꞮꞮ\x10\x1bⱢⱢ\x10" + + "\x1bꞭꞭ\x10\x1bⱮⱮ\x10\x1bⱤⱤ\x10\x1bꞱꞱ\x10\x1bꞲꞲ\x10\x1bꞰꞰ2\x12ιΙΙ\x166ΐ" + + "Ϊ́Ϊ́\x166ΰΫ́Ϋ́\x12\x12σΣΣ\x12\x12βΒΒ\x12\x12θΘΘ\x12\x12φΦΦ\x12" + + "\x12πΠΠ\x12\x12κΚΚ\x12\x12ρΡΡ\x12\x12εΕΕ\x14$եւԵՒԵւ\x12\x12вВВ\x12\x12дД" + + "Д\x12\x12оОО\x12\x12сСС\x12\x12тТТ\x12\x12тТТ\x12\x12ъЪЪ\x12\x12ѣѢѢ\x13" + + "\x1bꙋꙊꙊ\x13\x1bẖH̱H̱\x13\x1bẗT̈T̈\x13\x1bẘW̊W̊\x13\x1bẙY̊Y̊\x13\x1ba" + + "ʾAʾAʾ\x13\x1bṡṠṠ\x12\x10ssß\x14$ὐΥ̓Υ̓\x166ὒΥ̓̀Υ̓̀\x166ὔΥ̓́Υ̓́\x166" + + "ὖΥ̓͂Υ̓͂\x15+ἀιἈΙᾈ\x15+ἁιἉΙᾉ\x15+ἂιἊΙᾊ\x15+ἃιἋΙᾋ\x15+ἄιἌΙᾌ\x15+ἅιἍΙᾍ" + + "\x15+ἆιἎΙᾎ\x15+ἇιἏΙᾏ\x15\x1dἀιᾀἈΙ\x15\x1dἁιᾁἉΙ\x15\x1dἂιᾂἊΙ\x15\x1dἃιᾃἋΙ" + + "\x15\x1dἄιᾄἌΙ\x15\x1dἅιᾅἍΙ\x15\x1dἆιᾆἎΙ\x15\x1dἇιᾇἏΙ\x15+ἠιἨΙᾘ\x15+ἡιἩΙᾙ" + + "\x15+ἢιἪΙᾚ\x15+ἣιἫΙᾛ\x15+ἤιἬΙᾜ\x15+ἥιἭΙᾝ\x15+ἦιἮΙᾞ\x15+ἧιἯΙᾟ\x15\x1dἠιᾐἨ" + + "Ι\x15\x1dἡιᾑἩΙ\x15\x1dἢιᾒἪΙ\x15\x1dἣιᾓἫΙ\x15\x1dἤιᾔἬΙ\x15\x1dἥιᾕἭΙ\x15" + + "\x1dἦιᾖἮΙ\x15\x1dἧιᾗἯΙ\x15+ὠιὨΙᾨ\x15+ὡιὩΙᾩ\x15+ὢιὪΙᾪ\x15+ὣιὫΙᾫ\x15+ὤιὬΙᾬ" + + "\x15+ὥιὭΙᾭ\x15+ὦιὮΙᾮ\x15+ὧιὯΙᾯ\x15\x1dὠιᾠὨΙ\x15\x1dὡιᾡὩΙ\x15\x1dὢιᾢὪΙ" + + "\x15\x1dὣιᾣὫΙ\x15\x1dὤιᾤὬΙ\x15\x1dὥιᾥὭΙ\x15\x1dὦιᾦὮΙ\x15\x1dὧιᾧὯΙ\x15-ὰι" + + "ᾺΙᾺͅ\x14#αιΑΙᾼ\x14$άιΆΙΆͅ\x14$ᾶΑ͂Α͂\x166ᾶιΑ͂Ιᾼ͂\x14\x1cαιᾳΑΙ\x12" + + "\x12ιΙΙ\x15-ὴιῊΙῊͅ\x14#ηιΗΙῌ\x14$ήιΉΙΉͅ\x14$ῆΗ͂Η͂\x166ῆιΗ͂Ιῌ͂\x14\x1c" + + "ηιῃΗΙ\x166ῒΪ̀Ϊ̀\x166ΐΪ́Ϊ́\x14$ῖΙ͂Ι͂\x166ῗΪ͂Ϊ͂\x166ῢΫ̀Ϋ" + + "̀\x166ΰΫ́Ϋ́\x14$ῤΡ̓Ρ̓\x14$ῦΥ͂Υ͂\x166ῧΫ͂Ϋ͂\x15-ὼιῺΙῺͅ\x14#ωιΩΙ" + + "ῼ\x14$ώιΏΙΏͅ\x14$ῶΩ͂Ω͂\x166ῶιΩ͂Ιῼ͂\x14\x1cωιῳΩΙ\x12\x10ωω\x11\x08kk" + + "\x12\x10åå\x12\x10ɫɫ\x12\x10ɽɽ\x10\x12ȺȺ\x10\x12ȾȾ\x12\x10ɑɑ\x12\x10ɱɱ" + + "\x12\x10ɐɐ\x12\x10ɒɒ\x12\x10ȿȿ\x12\x10ɀɀ\x12\x10ɥɥ\x12\x10ɦɦ\x12\x10ɜɜ" + + "\x12\x10ɡɡ\x12\x10ɬɬ\x12\x10ɪɪ\x12\x10ʞʞ\x12\x10ʇʇ\x12\x10ʝʝ\x12\x12ffFF" + + "Ff\x12\x12fiFIFi\x12\x12flFLFl\x13\x1bffiFFIFfi\x13\x1bfflFFLFfl\x12\x12" + + "stSTSt\x12\x12stSTSt\x14$մնՄՆՄն\x14$մեՄԵՄե\x14$միՄԻՄի\x14$վնՎՆՎն\x14$մխՄ" + + "ԽՄխ" + +// lookup returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *caseTrie) lookup(s []byte) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return caseValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = caseIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *caseTrie) lookupUnsafe(s []byte) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return caseValues[c0] + } + i := caseIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = caseIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = caseIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// lookupString returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *caseTrie) lookupString(s string) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return caseValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := caseIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = caseIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = caseIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *caseTrie) lookupStringUnsafe(s string) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return caseValues[c0] + } + i := caseIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = caseIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = caseIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// caseTrie. Total size: 11742 bytes (11.47 KiB). Checksum: 795fe57ee5135873. +type caseTrie struct{} + +func newCaseTrie(i int) *caseTrie { + return &caseTrie{} +} + +// lookupValue determines the type of block n and looks up the value for b. +func (t *caseTrie) lookupValue(n uint32, b byte) uint16 { + switch { + case n < 18: + return uint16(caseValues[n<<6+uint32(b)]) + default: + n -= 18 + return uint16(sparse.lookup(n, b)) + } +} + +// caseValues: 20 blocks, 1280 entries, 2560 bytes +// The third block is the zero block. +var caseValues = [1280]uint16{ + // Block 0x0, offset 0x0 + 0x27: 0x0054, + 0x2e: 0x0054, + 0x30: 0x0010, 0x31: 0x0010, 0x32: 0x0010, 0x33: 0x0010, 0x34: 0x0010, 0x35: 0x0010, + 0x36: 0x0010, 0x37: 0x0010, 0x38: 0x0010, 0x39: 0x0010, 0x3a: 0x0054, + // Block 0x1, offset 0x40 + 0x41: 0x2013, 0x42: 0x2013, 0x43: 0x2013, 0x44: 0x2013, 0x45: 0x2013, + 0x46: 0x2013, 0x47: 0x2013, 0x48: 0x2013, 0x49: 0x2013, 0x4a: 0x2013, 0x4b: 0x2013, + 0x4c: 0x2013, 0x4d: 0x2013, 0x4e: 0x2013, 0x4f: 0x2013, 0x50: 0x2013, 0x51: 0x2013, + 0x52: 0x2013, 0x53: 0x2013, 0x54: 0x2013, 0x55: 0x2013, 0x56: 0x2013, 0x57: 0x2013, + 0x58: 0x2013, 0x59: 0x2013, 0x5a: 0x2013, + 0x5e: 0x0004, 0x5f: 0x0010, 0x60: 0x0004, 0x61: 0x2012, 0x62: 0x2012, 0x63: 0x2012, + 0x64: 0x2012, 0x65: 0x2012, 0x66: 0x2012, 0x67: 0x2012, 0x68: 0x2012, 0x69: 0x2012, + 0x6a: 0x2012, 0x6b: 0x2012, 0x6c: 0x2012, 0x6d: 0x2012, 0x6e: 0x2012, 0x6f: 0x2012, + 0x70: 0x2012, 0x71: 0x2012, 0x72: 0x2012, 0x73: 0x2012, 0x74: 0x2012, 0x75: 0x2012, + 0x76: 0x2012, 0x77: 0x2012, 0x78: 0x2012, 0x79: 0x2012, 0x7a: 0x2012, + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc0: 0x0852, 0xc1: 0x0b53, 0xc2: 0x0113, 0xc3: 0x0112, 0xc4: 0x0113, 0xc5: 0x0112, + 0xc6: 0x0b53, 0xc7: 0x0f13, 0xc8: 0x0f12, 0xc9: 0x0e53, 0xca: 0x1153, 0xcb: 0x0713, + 0xcc: 0x0712, 0xcd: 0x0012, 0xce: 0x1453, 0xcf: 0x1753, 0xd0: 0x1a53, 0xd1: 0x0313, + 0xd2: 0x0312, 0xd3: 0x1d53, 0xd4: 0x2053, 0xd5: 0x2352, 0xd6: 0x2653, 0xd7: 0x2653, + 0xd8: 0x0113, 0xd9: 0x0112, 0xda: 0x2952, 0xdb: 0x0012, 0xdc: 0x1d53, 0xdd: 0x2c53, + 0xde: 0x2f52, 0xdf: 0x3253, 0xe0: 0x0113, 0xe1: 0x0112, 0xe2: 0x0113, 0xe3: 0x0112, + 0xe4: 0x0113, 0xe5: 0x0112, 0xe6: 0x3553, 0xe7: 0x0f13, 0xe8: 0x0f12, 0xe9: 0x3853, + 0xea: 0x0012, 0xeb: 0x0012, 0xec: 0x0113, 0xed: 0x0112, 0xee: 0x3553, 0xef: 0x1f13, + 0xf0: 0x1f12, 0xf1: 0x3b53, 0xf2: 0x3e53, 0xf3: 0x0713, 0xf4: 0x0712, 0xf5: 0x0313, + 0xf6: 0x0312, 0xf7: 0x4153, 0xf8: 0x0113, 0xf9: 0x0112, 0xfa: 0x0012, 0xfb: 0x0010, + 0xfc: 0x0113, 0xfd: 0x0112, 0xfe: 0x0012, 0xff: 0x4452, + // Block 0x4, offset 0x100 + 0x100: 0x0010, 0x101: 0x0010, 0x102: 0x0010, 0x103: 0x0010, 0x104: 0x02db, 0x105: 0x0359, + 0x106: 0x03da, 0x107: 0x043b, 0x108: 0x04b9, 0x109: 0x053a, 0x10a: 0x059b, 0x10b: 0x0619, + 0x10c: 0x069a, 0x10d: 0x0313, 0x10e: 0x0312, 0x10f: 0x1f13, 0x110: 0x1f12, 0x111: 0x0313, + 0x112: 0x0312, 0x113: 0x0713, 0x114: 0x0712, 0x115: 0x0313, 0x116: 0x0312, 0x117: 0x0f13, + 0x118: 0x0f12, 0x119: 0x0313, 0x11a: 0x0312, 0x11b: 0x0713, 0x11c: 0x0712, 0x11d: 0x1452, + 0x11e: 0x0113, 0x11f: 0x0112, 0x120: 0x0113, 0x121: 0x0112, 0x122: 0x0113, 0x123: 0x0112, + 0x124: 0x0113, 0x125: 0x0112, 0x126: 0x0113, 0x127: 0x0112, 0x128: 0x0113, 0x129: 0x0112, + 0x12a: 0x0113, 0x12b: 0x0112, 0x12c: 0x0113, 0x12d: 0x0112, 0x12e: 0x0113, 0x12f: 0x0112, + 0x130: 0x06fa, 0x131: 0x07ab, 0x132: 0x0829, 0x133: 0x08aa, 0x134: 0x0113, 0x135: 0x0112, + 0x136: 0x2353, 0x137: 0x4453, 0x138: 0x0113, 0x139: 0x0112, 0x13a: 0x0113, 0x13b: 0x0112, + 0x13c: 0x0113, 0x13d: 0x0112, 0x13e: 0x0113, 0x13f: 0x0112, + // Block 0x5, offset 0x140 + 0x140: 0x0a8a, 0x141: 0x0313, 0x142: 0x0312, 0x143: 0x0853, 0x144: 0x4753, 0x145: 0x4a53, + 0x146: 0x0113, 0x147: 0x0112, 0x148: 0x0113, 0x149: 0x0112, 0x14a: 0x0113, 0x14b: 0x0112, + 0x14c: 0x0113, 0x14d: 0x0112, 0x14e: 0x0113, 0x14f: 0x0112, 0x150: 0x0b0a, 0x151: 0x0b8a, + 0x152: 0x0c0a, 0x153: 0x0b52, 0x154: 0x0b52, 0x155: 0x0012, 0x156: 0x0e52, 0x157: 0x1152, + 0x158: 0x0012, 0x159: 0x1752, 0x15a: 0x0012, 0x15b: 0x1a52, 0x15c: 0x0c8a, 0x15d: 0x0012, + 0x15e: 0x0012, 0x15f: 0x0012, 0x160: 0x1d52, 0x161: 0x0d0a, 0x162: 0x0012, 0x163: 0x2052, + 0x164: 0x0012, 0x165: 0x0d8a, 0x166: 0x0e0a, 0x167: 0x0012, 0x168: 0x2652, 0x169: 0x2652, + 0x16a: 0x0e8a, 0x16b: 0x0f0a, 0x16c: 0x0f8a, 0x16d: 0x0012, 0x16e: 0x0012, 0x16f: 0x1d52, + 0x170: 0x0012, 0x171: 0x100a, 0x172: 0x2c52, 0x173: 0x0012, 0x174: 0x0012, 0x175: 0x3252, + 0x176: 0x0012, 0x177: 0x0012, 0x178: 0x0012, 0x179: 0x0012, 0x17a: 0x0012, 0x17b: 0x0012, + 0x17c: 0x0012, 0x17d: 0x108a, 0x17e: 0x0012, 0x17f: 0x0012, + // Block 0x6, offset 0x180 + 0x180: 0x3552, 0x181: 0x0012, 0x182: 0x0012, 0x183: 0x3852, 0x184: 0x0012, 0x185: 0x0012, + 0x186: 0x0012, 0x187: 0x110a, 0x188: 0x3552, 0x189: 0x4752, 0x18a: 0x3b52, 0x18b: 0x3e52, + 0x18c: 0x4a52, 0x18d: 0x0012, 0x18e: 0x0012, 0x18f: 0x0012, 0x190: 0x0012, 0x191: 0x0012, + 0x192: 0x4152, 0x193: 0x0012, 0x194: 0x0010, 0x195: 0x0012, 0x196: 0x0012, 0x197: 0x0012, + 0x198: 0x0012, 0x199: 0x0012, 0x19a: 0x0012, 0x19b: 0x0012, 0x19c: 0x0012, 0x19d: 0x118a, + 0x19e: 0x120a, 0x19f: 0x0012, 0x1a0: 0x0012, 0x1a1: 0x0012, 0x1a2: 0x0012, 0x1a3: 0x0012, + 0x1a4: 0x0012, 0x1a5: 0x0012, 0x1a6: 0x0012, 0x1a7: 0x0012, 0x1a8: 0x0012, 0x1a9: 0x0012, + 0x1aa: 0x0012, 0x1ab: 0x0012, 0x1ac: 0x0012, 0x1ad: 0x0012, 0x1ae: 0x0012, 0x1af: 0x0012, + 0x1b0: 0x0015, 0x1b1: 0x0015, 0x1b2: 0x0015, 0x1b3: 0x0015, 0x1b4: 0x0015, 0x1b5: 0x0015, + 0x1b6: 0x0015, 0x1b7: 0x0015, 0x1b8: 0x0015, 0x1b9: 0x0014, 0x1ba: 0x0014, 0x1bb: 0x0014, + 0x1bc: 0x0014, 0x1bd: 0x0014, 0x1be: 0x0014, 0x1bf: 0x0014, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x0024, 0x1c1: 0x0024, 0x1c2: 0x0024, 0x1c3: 0x0024, 0x1c4: 0x0024, 0x1c5: 0x128d, + 0x1c6: 0x0024, 0x1c7: 0x0034, 0x1c8: 0x0034, 0x1c9: 0x0034, 0x1ca: 0x0024, 0x1cb: 0x0024, + 0x1cc: 0x0024, 0x1cd: 0x0034, 0x1ce: 0x0034, 0x1cf: 0x0014, 0x1d0: 0x0024, 0x1d1: 0x0024, + 0x1d2: 0x0024, 0x1d3: 0x0034, 0x1d4: 0x0034, 0x1d5: 0x0034, 0x1d6: 0x0034, 0x1d7: 0x0024, + 0x1d8: 0x0034, 0x1d9: 0x0034, 0x1da: 0x0034, 0x1db: 0x0024, 0x1dc: 0x0034, 0x1dd: 0x0034, + 0x1de: 0x0034, 0x1df: 0x0034, 0x1e0: 0x0034, 0x1e1: 0x0034, 0x1e2: 0x0034, 0x1e3: 0x0024, + 0x1e4: 0x0024, 0x1e5: 0x0024, 0x1e6: 0x0024, 0x1e7: 0x0024, 0x1e8: 0x0024, 0x1e9: 0x0024, + 0x1ea: 0x0024, 0x1eb: 0x0024, 0x1ec: 0x0024, 0x1ed: 0x0024, 0x1ee: 0x0024, 0x1ef: 0x0024, + 0x1f0: 0x0113, 0x1f1: 0x0112, 0x1f2: 0x0113, 0x1f3: 0x0112, 0x1f4: 0x0014, 0x1f5: 0x0004, + 0x1f6: 0x0113, 0x1f7: 0x0112, 0x1fa: 0x0015, 0x1fb: 0x4d52, + 0x1fc: 0x5052, 0x1fd: 0x5052, 0x1ff: 0x5353, + // Block 0x8, offset 0x200 + 0x204: 0x0004, 0x205: 0x0004, + 0x206: 0x2a13, 0x207: 0x0054, 0x208: 0x2513, 0x209: 0x2713, 0x20a: 0x2513, + 0x20c: 0x5653, 0x20e: 0x5953, 0x20f: 0x5c53, 0x210: 0x130a, 0x211: 0x2013, + 0x212: 0x2013, 0x213: 0x2013, 0x214: 0x2013, 0x215: 0x2013, 0x216: 0x2013, 0x217: 0x2013, + 0x218: 0x2013, 0x219: 0x2013, 0x21a: 0x2013, 0x21b: 0x2013, 0x21c: 0x2013, 0x21d: 0x2013, + 0x21e: 0x2013, 0x21f: 0x2013, 0x220: 0x5f53, 0x221: 0x5f53, 0x223: 0x5f53, + 0x224: 0x5f53, 0x225: 0x5f53, 0x226: 0x5f53, 0x227: 0x5f53, 0x228: 0x5f53, 0x229: 0x5f53, + 0x22a: 0x5f53, 0x22b: 0x5f53, 0x22c: 0x2a12, 0x22d: 0x2512, 0x22e: 0x2712, 0x22f: 0x2512, + 0x230: 0x144a, 0x231: 0x2012, 0x232: 0x2012, 0x233: 0x2012, 0x234: 0x2012, 0x235: 0x2012, + 0x236: 0x2012, 0x237: 0x2012, 0x238: 0x2012, 0x239: 0x2012, 0x23a: 0x2012, 0x23b: 0x2012, + 0x23c: 0x2012, 0x23d: 0x2012, 0x23e: 0x2012, 0x23f: 0x2012, + // Block 0x9, offset 0x240 + 0x240: 0x5f52, 0x241: 0x5f52, 0x242: 0x158a, 0x243: 0x5f52, 0x244: 0x5f52, 0x245: 0x5f52, + 0x246: 0x5f52, 0x247: 0x5f52, 0x248: 0x5f52, 0x249: 0x5f52, 0x24a: 0x5f52, 0x24b: 0x5f52, + 0x24c: 0x5652, 0x24d: 0x5952, 0x24e: 0x5c52, 0x24f: 0x1813, 0x250: 0x160a, 0x251: 0x168a, + 0x252: 0x0013, 0x253: 0x0013, 0x254: 0x0013, 0x255: 0x170a, 0x256: 0x178a, 0x257: 0x1812, + 0x258: 0x0113, 0x259: 0x0112, 0x25a: 0x0113, 0x25b: 0x0112, 0x25c: 0x0113, 0x25d: 0x0112, + 0x25e: 0x0113, 0x25f: 0x0112, 0x260: 0x0113, 0x261: 0x0112, 0x262: 0x0113, 0x263: 0x0112, + 0x264: 0x0113, 0x265: 0x0112, 0x266: 0x0113, 0x267: 0x0112, 0x268: 0x0113, 0x269: 0x0112, + 0x26a: 0x0113, 0x26b: 0x0112, 0x26c: 0x0113, 0x26d: 0x0112, 0x26e: 0x0113, 0x26f: 0x0112, + 0x270: 0x180a, 0x271: 0x188a, 0x272: 0x0b12, 0x273: 0x5352, 0x274: 0x6253, 0x275: 0x190a, + 0x277: 0x0f13, 0x278: 0x0f12, 0x279: 0x0b13, 0x27a: 0x0113, 0x27b: 0x0112, + 0x27c: 0x0012, 0x27d: 0x4d53, 0x27e: 0x5053, 0x27f: 0x5053, + // Block 0xa, offset 0x280 + 0x280: 0x0812, 0x281: 0x0812, 0x282: 0x0812, 0x283: 0x0812, 0x284: 0x0812, 0x285: 0x0812, + 0x288: 0x0813, 0x289: 0x0813, 0x28a: 0x0813, 0x28b: 0x0813, + 0x28c: 0x0813, 0x28d: 0x0813, 0x290: 0x239a, 0x291: 0x0812, + 0x292: 0x247a, 0x293: 0x0812, 0x294: 0x25ba, 0x295: 0x0812, 0x296: 0x26fa, 0x297: 0x0812, + 0x299: 0x0813, 0x29b: 0x0813, 0x29d: 0x0813, + 0x29f: 0x0813, 0x2a0: 0x0812, 0x2a1: 0x0812, 0x2a2: 0x0812, 0x2a3: 0x0812, + 0x2a4: 0x0812, 0x2a5: 0x0812, 0x2a6: 0x0812, 0x2a7: 0x0812, 0x2a8: 0x0813, 0x2a9: 0x0813, + 0x2aa: 0x0813, 0x2ab: 0x0813, 0x2ac: 0x0813, 0x2ad: 0x0813, 0x2ae: 0x0813, 0x2af: 0x0813, + 0x2b0: 0x8b52, 0x2b1: 0x8b52, 0x2b2: 0x8e52, 0x2b3: 0x8e52, 0x2b4: 0x9152, 0x2b5: 0x9152, + 0x2b6: 0x9452, 0x2b7: 0x9452, 0x2b8: 0x9752, 0x2b9: 0x9752, 0x2ba: 0x9a52, 0x2bb: 0x9a52, + 0x2bc: 0x4d52, 0x2bd: 0x4d52, + // Block 0xb, offset 0x2c0 + 0x2c0: 0x283a, 0x2c1: 0x292a, 0x2c2: 0x2a1a, 0x2c3: 0x2b0a, 0x2c4: 0x2bfa, 0x2c5: 0x2cea, + 0x2c6: 0x2dda, 0x2c7: 0x2eca, 0x2c8: 0x2fb9, 0x2c9: 0x30a9, 0x2ca: 0x3199, 0x2cb: 0x3289, + 0x2cc: 0x3379, 0x2cd: 0x3469, 0x2ce: 0x3559, 0x2cf: 0x3649, 0x2d0: 0x373a, 0x2d1: 0x382a, + 0x2d2: 0x391a, 0x2d3: 0x3a0a, 0x2d4: 0x3afa, 0x2d5: 0x3bea, 0x2d6: 0x3cda, 0x2d7: 0x3dca, + 0x2d8: 0x3eb9, 0x2d9: 0x3fa9, 0x2da: 0x4099, 0x2db: 0x4189, 0x2dc: 0x4279, 0x2dd: 0x4369, + 0x2de: 0x4459, 0x2df: 0x4549, 0x2e0: 0x463a, 0x2e1: 0x472a, 0x2e2: 0x481a, 0x2e3: 0x490a, + 0x2e4: 0x49fa, 0x2e5: 0x4aea, 0x2e6: 0x4bda, 0x2e7: 0x4cca, 0x2e8: 0x4db9, 0x2e9: 0x4ea9, + 0x2ea: 0x4f99, 0x2eb: 0x5089, 0x2ec: 0x5179, 0x2ed: 0x5269, 0x2ee: 0x5359, 0x2ef: 0x5449, + 0x2f0: 0x0812, 0x2f1: 0x0812, 0x2f2: 0x553a, 0x2f3: 0x564a, 0x2f4: 0x571a, + 0x2f6: 0x57fa, 0x2f7: 0x58da, 0x2f8: 0x0813, 0x2f9: 0x0813, 0x2fa: 0x8b53, 0x2fb: 0x8b53, + 0x2fc: 0x5a19, 0x2fd: 0x0004, 0x2fe: 0x5aea, 0x2ff: 0x0004, + // Block 0xc, offset 0x300 + 0x300: 0x0004, 0x301: 0x0004, 0x302: 0x5b6a, 0x303: 0x5c7a, 0x304: 0x5d4a, + 0x306: 0x5e2a, 0x307: 0x5f0a, 0x308: 0x8e53, 0x309: 0x8e53, 0x30a: 0x9153, 0x30b: 0x9153, + 0x30c: 0x6049, 0x30d: 0x0004, 0x30e: 0x0004, 0x30f: 0x0004, 0x310: 0x0812, 0x311: 0x0812, + 0x312: 0x611a, 0x313: 0x625a, 0x316: 0x639a, 0x317: 0x647a, + 0x318: 0x0813, 0x319: 0x0813, 0x31a: 0x9453, 0x31b: 0x9453, 0x31d: 0x0004, + 0x31e: 0x0004, 0x31f: 0x0004, 0x320: 0x0812, 0x321: 0x0812, 0x322: 0x65ba, 0x323: 0x66fa, + 0x324: 0x683a, 0x325: 0x0912, 0x326: 0x691a, 0x327: 0x69fa, 0x328: 0x0813, 0x329: 0x0813, + 0x32a: 0x9a53, 0x32b: 0x9a53, 0x32c: 0x0913, 0x32d: 0x0004, 0x32e: 0x0004, 0x32f: 0x0004, + 0x332: 0x6b3a, 0x333: 0x6c4a, 0x334: 0x6d1a, + 0x336: 0x6dfa, 0x337: 0x6eda, 0x338: 0x9753, 0x339: 0x9753, 0x33a: 0x4d53, 0x33b: 0x4d53, + 0x33c: 0x7019, 0x33d: 0x0004, 0x33e: 0x0004, + // Block 0xd, offset 0x340 + 0x342: 0x0013, + 0x347: 0x0013, 0x34a: 0x0012, 0x34b: 0x0013, + 0x34c: 0x0013, 0x34d: 0x0013, 0x34e: 0x0012, 0x34f: 0x0012, 0x350: 0x0013, 0x351: 0x0013, + 0x352: 0x0013, 0x353: 0x0012, 0x355: 0x0013, + 0x359: 0x0013, 0x35a: 0x0013, 0x35b: 0x0013, 0x35c: 0x0013, 0x35d: 0x0013, + 0x364: 0x0013, 0x366: 0x70eb, 0x368: 0x0013, + 0x36a: 0x714b, 0x36b: 0x718b, 0x36c: 0x0013, 0x36d: 0x0013, 0x36f: 0x0012, + 0x370: 0x0013, 0x371: 0x0013, 0x372: 0x9d53, 0x373: 0x0013, 0x374: 0x0012, 0x375: 0x0010, + 0x376: 0x0010, 0x377: 0x0010, 0x378: 0x0010, 0x379: 0x0012, + 0x37c: 0x0012, 0x37d: 0x0012, 0x37e: 0x0013, 0x37f: 0x0013, + // Block 0xe, offset 0x380 + 0x380: 0x1a13, 0x381: 0x1a13, 0x382: 0x1e13, 0x383: 0x1e13, 0x384: 0x1a13, 0x385: 0x1a13, + 0x386: 0x2613, 0x387: 0x2613, 0x388: 0x2a13, 0x389: 0x2a13, 0x38a: 0x2e13, 0x38b: 0x2e13, + 0x38c: 0x2a13, 0x38d: 0x2a13, 0x38e: 0x2613, 0x38f: 0x2613, 0x390: 0xa052, 0x391: 0xa052, + 0x392: 0xa352, 0x393: 0xa352, 0x394: 0xa652, 0x395: 0xa652, 0x396: 0xa352, 0x397: 0xa352, + 0x398: 0xa052, 0x399: 0xa052, 0x39a: 0x1a12, 0x39b: 0x1a12, 0x39c: 0x1e12, 0x39d: 0x1e12, + 0x39e: 0x1a12, 0x39f: 0x1a12, 0x3a0: 0x2612, 0x3a1: 0x2612, 0x3a2: 0x2a12, 0x3a3: 0x2a12, + 0x3a4: 0x2e12, 0x3a5: 0x2e12, 0x3a6: 0x2a12, 0x3a7: 0x2a12, 0x3a8: 0x2612, 0x3a9: 0x2612, + // Block 0xf, offset 0x3c0 + 0x3c0: 0x6552, 0x3c1: 0x6552, 0x3c2: 0x6552, 0x3c3: 0x6552, 0x3c4: 0x6552, 0x3c5: 0x6552, + 0x3c6: 0x6552, 0x3c7: 0x6552, 0x3c8: 0x6552, 0x3c9: 0x6552, 0x3ca: 0x6552, 0x3cb: 0x6552, + 0x3cc: 0x6552, 0x3cd: 0x6552, 0x3ce: 0x6552, 0x3cf: 0x6552, 0x3d0: 0xa952, 0x3d1: 0xa952, + 0x3d2: 0xa952, 0x3d3: 0xa952, 0x3d4: 0xa952, 0x3d5: 0xa952, 0x3d6: 0xa952, 0x3d7: 0xa952, + 0x3d8: 0xa952, 0x3d9: 0xa952, 0x3da: 0xa952, 0x3db: 0xa952, 0x3dc: 0xa952, 0x3dd: 0xa952, + 0x3de: 0xa952, 0x3e0: 0x0113, 0x3e1: 0x0112, 0x3e2: 0x71eb, 0x3e3: 0x8853, + 0x3e4: 0x724b, 0x3e5: 0x72aa, 0x3e6: 0x730a, 0x3e7: 0x0f13, 0x3e8: 0x0f12, 0x3e9: 0x0313, + 0x3ea: 0x0312, 0x3eb: 0x0713, 0x3ec: 0x0712, 0x3ed: 0x736b, 0x3ee: 0x73cb, 0x3ef: 0x742b, + 0x3f0: 0x748b, 0x3f1: 0x0012, 0x3f2: 0x0113, 0x3f3: 0x0112, 0x3f4: 0x0012, 0x3f5: 0x0313, + 0x3f6: 0x0312, 0x3f7: 0x0012, 0x3f8: 0x0012, 0x3f9: 0x0012, 0x3fa: 0x0012, 0x3fb: 0x0012, + 0x3fc: 0x0015, 0x3fd: 0x0015, 0x3fe: 0x74eb, 0x3ff: 0x754b, + // Block 0x10, offset 0x400 + 0x400: 0x0113, 0x401: 0x0112, 0x402: 0x0113, 0x403: 0x0112, 0x404: 0x0113, 0x405: 0x0112, + 0x406: 0x0113, 0x407: 0x0112, 0x408: 0x0014, 0x409: 0x0004, 0x40a: 0x0004, 0x40b: 0x0713, + 0x40c: 0x0712, 0x40d: 0x75ab, 0x40e: 0x0012, 0x40f: 0x0010, 0x410: 0x0113, 0x411: 0x0112, + 0x412: 0x0113, 0x413: 0x0112, 0x414: 0x0012, 0x415: 0x0012, 0x416: 0x0113, 0x417: 0x0112, + 0x418: 0x0113, 0x419: 0x0112, 0x41a: 0x0113, 0x41b: 0x0112, 0x41c: 0x0113, 0x41d: 0x0112, + 0x41e: 0x0113, 0x41f: 0x0112, 0x420: 0x0113, 0x421: 0x0112, 0x422: 0x0113, 0x423: 0x0112, + 0x424: 0x0113, 0x425: 0x0112, 0x426: 0x0113, 0x427: 0x0112, 0x428: 0x0113, 0x429: 0x0112, + 0x42a: 0x760b, 0x42b: 0x766b, 0x42c: 0x76cb, 0x42d: 0x772b, 0x42e: 0x778b, + 0x430: 0x77eb, 0x431: 0x784b, 0x432: 0x78ab, 0x433: 0xac53, 0x434: 0x0113, 0x435: 0x0112, + 0x436: 0x0113, 0x437: 0x0112, + // Block 0x11, offset 0x440 + 0x440: 0x790a, 0x441: 0x798a, 0x442: 0x7a0a, 0x443: 0x7a8a, 0x444: 0x7b3a, 0x445: 0x7bea, + 0x446: 0x7c6a, + 0x453: 0x7cea, 0x454: 0x7dca, 0x455: 0x7eaa, 0x456: 0x7f8a, 0x457: 0x806a, + 0x45d: 0x0010, + 0x45e: 0x0034, 0x45f: 0x0010, 0x460: 0x0010, 0x461: 0x0010, 0x462: 0x0010, 0x463: 0x0010, + 0x464: 0x0010, 0x465: 0x0010, 0x466: 0x0010, 0x467: 0x0010, 0x468: 0x0010, + 0x46a: 0x0010, 0x46b: 0x0010, 0x46c: 0x0010, 0x46d: 0x0010, 0x46e: 0x0010, 0x46f: 0x0010, + 0x470: 0x0010, 0x471: 0x0010, 0x472: 0x0010, 0x473: 0x0010, 0x474: 0x0010, 0x475: 0x0010, + 0x476: 0x0010, 0x478: 0x0010, 0x479: 0x0010, 0x47a: 0x0010, 0x47b: 0x0010, + 0x47c: 0x0010, 0x47e: 0x0010, + // Block 0x12, offset 0x480 + 0x480: 0x2213, 0x481: 0x2213, 0x482: 0x2613, 0x483: 0x2613, 0x484: 0x2213, 0x485: 0x2213, + 0x486: 0x2e13, 0x487: 0x2e13, 0x488: 0x2213, 0x489: 0x2213, 0x48a: 0x2613, 0x48b: 0x2613, + 0x48c: 0x2213, 0x48d: 0x2213, 0x48e: 0x3e13, 0x48f: 0x3e13, 0x490: 0x2213, 0x491: 0x2213, + 0x492: 0x2613, 0x493: 0x2613, 0x494: 0x2213, 0x495: 0x2213, 0x496: 0x2e13, 0x497: 0x2e13, + 0x498: 0x2213, 0x499: 0x2213, 0x49a: 0x2613, 0x49b: 0x2613, 0x49c: 0x2213, 0x49d: 0x2213, + 0x49e: 0xb553, 0x49f: 0xb553, 0x4a0: 0xb853, 0x4a1: 0xb853, 0x4a2: 0x2212, 0x4a3: 0x2212, + 0x4a4: 0x2612, 0x4a5: 0x2612, 0x4a6: 0x2212, 0x4a7: 0x2212, 0x4a8: 0x2e12, 0x4a9: 0x2e12, + 0x4aa: 0x2212, 0x4ab: 0x2212, 0x4ac: 0x2612, 0x4ad: 0x2612, 0x4ae: 0x2212, 0x4af: 0x2212, + 0x4b0: 0x3e12, 0x4b1: 0x3e12, 0x4b2: 0x2212, 0x4b3: 0x2212, 0x4b4: 0x2612, 0x4b5: 0x2612, + 0x4b6: 0x2212, 0x4b7: 0x2212, 0x4b8: 0x2e12, 0x4b9: 0x2e12, 0x4ba: 0x2212, 0x4bb: 0x2212, + 0x4bc: 0x2612, 0x4bd: 0x2612, 0x4be: 0x2212, 0x4bf: 0x2212, + // Block 0x13, offset 0x4c0 + 0x4c2: 0x0010, + 0x4c7: 0x0010, 0x4c9: 0x0010, 0x4cb: 0x0010, + 0x4cd: 0x0010, 0x4ce: 0x0010, 0x4cf: 0x0010, 0x4d1: 0x0010, + 0x4d2: 0x0010, 0x4d4: 0x0010, 0x4d7: 0x0010, + 0x4d9: 0x0010, 0x4db: 0x0010, 0x4dd: 0x0010, + 0x4df: 0x0010, 0x4e1: 0x0010, 0x4e2: 0x0010, + 0x4e4: 0x0010, 0x4e7: 0x0010, 0x4e8: 0x0010, 0x4e9: 0x0010, + 0x4ea: 0x0010, 0x4ec: 0x0010, 0x4ed: 0x0010, 0x4ee: 0x0010, 0x4ef: 0x0010, + 0x4f0: 0x0010, 0x4f1: 0x0010, 0x4f2: 0x0010, 0x4f4: 0x0010, 0x4f5: 0x0010, + 0x4f6: 0x0010, 0x4f7: 0x0010, 0x4f9: 0x0010, 0x4fa: 0x0010, 0x4fb: 0x0010, + 0x4fc: 0x0010, 0x4fe: 0x0010, +} + +// caseIndex: 25 blocks, 1600 entries, 3200 bytes +// Block 0 is the zero block. +var caseIndex = [1600]uint16{ + // Block 0x0, offset 0x0 + // Block 0x1, offset 0x40 + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc2: 0x12, 0xc3: 0x13, 0xc4: 0x14, 0xc5: 0x15, 0xc6: 0x01, 0xc7: 0x02, + 0xc8: 0x16, 0xc9: 0x03, 0xca: 0x04, 0xcb: 0x17, 0xcc: 0x18, 0xcd: 0x05, 0xce: 0x06, 0xcf: 0x07, + 0xd0: 0x19, 0xd1: 0x1a, 0xd2: 0x1b, 0xd3: 0x1c, 0xd4: 0x1d, 0xd5: 0x1e, 0xd6: 0x1f, 0xd7: 0x20, + 0xd8: 0x21, 0xd9: 0x22, 0xda: 0x23, 0xdb: 0x24, 0xdc: 0x25, 0xdd: 0x26, 0xde: 0x27, 0xdf: 0x28, + 0xe0: 0x02, 0xe1: 0x03, 0xe2: 0x04, 0xe3: 0x05, + 0xea: 0x06, 0xeb: 0x07, 0xec: 0x07, 0xed: 0x08, 0xef: 0x09, + 0xf0: 0x14, 0xf3: 0x16, + // Block 0x4, offset 0x100 + 0x120: 0x29, 0x121: 0x2a, 0x122: 0x2b, 0x123: 0x2c, 0x124: 0x2d, 0x125: 0x2e, 0x126: 0x2f, 0x127: 0x30, + 0x128: 0x31, 0x129: 0x32, 0x12a: 0x33, 0x12b: 0x34, 0x12c: 0x35, 0x12d: 0x36, 0x12e: 0x37, 0x12f: 0x38, + 0x130: 0x39, 0x131: 0x3a, 0x132: 0x3b, 0x133: 0x3c, 0x134: 0x3d, 0x135: 0x3e, 0x136: 0x3f, 0x137: 0x40, + 0x138: 0x41, 0x139: 0x42, 0x13a: 0x43, 0x13b: 0x44, 0x13c: 0x45, 0x13d: 0x46, 0x13e: 0x47, 0x13f: 0x48, + // Block 0x5, offset 0x140 + 0x140: 0x49, 0x141: 0x4a, 0x142: 0x4b, 0x143: 0x4c, 0x144: 0x23, 0x145: 0x23, 0x146: 0x23, 0x147: 0x23, + 0x148: 0x23, 0x149: 0x4d, 0x14a: 0x4e, 0x14b: 0x4f, 0x14c: 0x50, 0x14d: 0x51, 0x14e: 0x52, 0x14f: 0x53, + 0x150: 0x54, 0x151: 0x23, 0x152: 0x23, 0x153: 0x23, 0x154: 0x23, 0x155: 0x23, 0x156: 0x23, 0x157: 0x23, + 0x158: 0x23, 0x159: 0x55, 0x15a: 0x56, 0x15b: 0x57, 0x15c: 0x58, 0x15d: 0x59, 0x15e: 0x5a, 0x15f: 0x5b, + 0x160: 0x5c, 0x161: 0x5d, 0x162: 0x5e, 0x163: 0x5f, 0x164: 0x60, 0x165: 0x61, 0x167: 0x62, + 0x168: 0x63, 0x169: 0x64, 0x16a: 0x65, 0x16c: 0x66, 0x16d: 0x67, 0x16e: 0x68, 0x16f: 0x69, + 0x170: 0x6a, 0x171: 0x6b, 0x172: 0x6c, 0x173: 0x6d, 0x174: 0x6e, 0x175: 0x6f, 0x176: 0x70, 0x177: 0x71, + 0x178: 0x72, 0x179: 0x72, 0x17a: 0x73, 0x17b: 0x72, 0x17c: 0x74, 0x17d: 0x08, 0x17e: 0x09, 0x17f: 0x0a, + // Block 0x6, offset 0x180 + 0x180: 0x75, 0x181: 0x76, 0x182: 0x77, 0x183: 0x78, 0x184: 0x0b, 0x185: 0x79, 0x186: 0x7a, + 0x192: 0x7b, 0x193: 0x0c, + 0x1b0: 0x7c, 0x1b1: 0x0d, 0x1b2: 0x72, 0x1b3: 0x7d, 0x1b4: 0x7e, 0x1b5: 0x7f, 0x1b6: 0x80, 0x1b7: 0x81, + 0x1b8: 0x82, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x83, 0x1c2: 0x84, 0x1c3: 0x85, 0x1c4: 0x86, 0x1c5: 0x23, 0x1c6: 0x87, + // Block 0x8, offset 0x200 + 0x200: 0x88, 0x201: 0x23, 0x202: 0x23, 0x203: 0x23, 0x204: 0x23, 0x205: 0x23, 0x206: 0x23, 0x207: 0x23, + 0x208: 0x23, 0x209: 0x23, 0x20a: 0x23, 0x20b: 0x23, 0x20c: 0x23, 0x20d: 0x23, 0x20e: 0x23, 0x20f: 0x23, + 0x210: 0x23, 0x211: 0x23, 0x212: 0x89, 0x213: 0x8a, 0x214: 0x23, 0x215: 0x23, 0x216: 0x23, 0x217: 0x23, + 0x218: 0x8b, 0x219: 0x8c, 0x21a: 0x8d, 0x21b: 0x8e, 0x21c: 0x8f, 0x21d: 0x90, 0x21e: 0x0e, 0x21f: 0x91, + 0x220: 0x92, 0x221: 0x93, 0x222: 0x23, 0x223: 0x94, 0x224: 0x95, 0x225: 0x96, 0x226: 0x97, 0x227: 0x98, + 0x228: 0x99, 0x229: 0x9a, 0x22a: 0x9b, 0x22b: 0x9c, 0x22c: 0x9d, 0x22d: 0x9e, 0x22e: 0x9f, 0x22f: 0xa0, + 0x230: 0x23, 0x231: 0x23, 0x232: 0x23, 0x233: 0x23, 0x234: 0x23, 0x235: 0x23, 0x236: 0x23, 0x237: 0x23, + 0x238: 0x23, 0x239: 0x23, 0x23a: 0x23, 0x23b: 0x23, 0x23c: 0x23, 0x23d: 0x23, 0x23e: 0x23, 0x23f: 0x23, + // Block 0x9, offset 0x240 + 0x240: 0x23, 0x241: 0x23, 0x242: 0x23, 0x243: 0x23, 0x244: 0x23, 0x245: 0x23, 0x246: 0x23, 0x247: 0x23, + 0x248: 0x23, 0x249: 0x23, 0x24a: 0x23, 0x24b: 0x23, 0x24c: 0x23, 0x24d: 0x23, 0x24e: 0x23, 0x24f: 0x23, + 0x250: 0x23, 0x251: 0x23, 0x252: 0x23, 0x253: 0x23, 0x254: 0x23, 0x255: 0x23, 0x256: 0x23, 0x257: 0x23, + 0x258: 0x23, 0x259: 0x23, 0x25a: 0x23, 0x25b: 0x23, 0x25c: 0x23, 0x25d: 0x23, 0x25e: 0x23, 0x25f: 0x23, + 0x260: 0x23, 0x261: 0x23, 0x262: 0x23, 0x263: 0x23, 0x264: 0x23, 0x265: 0x23, 0x266: 0x23, 0x267: 0x23, + 0x268: 0x23, 0x269: 0x23, 0x26a: 0x23, 0x26b: 0x23, 0x26c: 0x23, 0x26d: 0x23, 0x26e: 0x23, 0x26f: 0x23, + 0x270: 0x23, 0x271: 0x23, 0x272: 0x23, 0x273: 0x23, 0x274: 0x23, 0x275: 0x23, 0x276: 0x23, 0x277: 0x23, + 0x278: 0x23, 0x279: 0x23, 0x27a: 0x23, 0x27b: 0x23, 0x27c: 0x23, 0x27d: 0x23, 0x27e: 0x23, 0x27f: 0x23, + // Block 0xa, offset 0x280 + 0x280: 0x23, 0x281: 0x23, 0x282: 0x23, 0x283: 0x23, 0x284: 0x23, 0x285: 0x23, 0x286: 0x23, 0x287: 0x23, + 0x288: 0x23, 0x289: 0x23, 0x28a: 0x23, 0x28b: 0x23, 0x28c: 0x23, 0x28d: 0x23, 0x28e: 0x23, 0x28f: 0x23, + 0x290: 0x23, 0x291: 0x23, 0x292: 0x23, 0x293: 0x23, 0x294: 0x23, 0x295: 0x23, 0x296: 0x23, 0x297: 0x23, + 0x298: 0x23, 0x299: 0x23, 0x29a: 0x23, 0x29b: 0x23, 0x29c: 0x23, 0x29d: 0x23, 0x29e: 0xa1, 0x29f: 0xa2, + // Block 0xb, offset 0x2c0 + 0x2ec: 0x0f, 0x2ed: 0xa3, 0x2ee: 0xa4, 0x2ef: 0xa5, + 0x2f0: 0x23, 0x2f1: 0x23, 0x2f2: 0x23, 0x2f3: 0x23, 0x2f4: 0xa6, 0x2f5: 0xa7, 0x2f6: 0xa8, 0x2f7: 0xa9, + 0x2f8: 0xaa, 0x2f9: 0xab, 0x2fa: 0x23, 0x2fb: 0xac, 0x2fc: 0xad, 0x2fd: 0xae, 0x2fe: 0xaf, 0x2ff: 0xb0, + // Block 0xc, offset 0x300 + 0x300: 0xb1, 0x301: 0xb2, 0x302: 0x23, 0x303: 0xb3, 0x305: 0xb4, 0x307: 0xb5, + 0x30a: 0xb6, 0x30b: 0xb7, 0x30c: 0xb8, 0x30d: 0xb9, 0x30e: 0xba, 0x30f: 0xbb, + 0x310: 0xbc, 0x311: 0xbd, 0x312: 0xbe, 0x313: 0xbf, 0x314: 0xc0, 0x315: 0xc1, + 0x318: 0x23, 0x319: 0x23, 0x31a: 0x23, 0x31b: 0x23, 0x31c: 0xc2, 0x31d: 0xc3, + 0x320: 0xc4, 0x321: 0xc5, 0x322: 0xc6, 0x323: 0xc7, 0x324: 0xc8, 0x326: 0xc9, + 0x328: 0xca, 0x329: 0xcb, 0x32a: 0xcc, 0x32b: 0xcd, 0x32c: 0x5f, 0x32d: 0xce, 0x32e: 0xcf, + 0x330: 0x23, 0x331: 0xd0, 0x332: 0xd1, 0x333: 0xd2, + // Block 0xd, offset 0x340 + 0x340: 0xd3, 0x341: 0xd4, 0x342: 0xd5, 0x343: 0xd6, 0x344: 0xd7, 0x345: 0xd8, 0x346: 0xd9, 0x347: 0xda, + 0x348: 0xdb, 0x34a: 0xdc, 0x34b: 0xdd, 0x34c: 0xde, 0x34d: 0xdf, + 0x350: 0xe0, 0x351: 0xe1, 0x352: 0xe2, 0x353: 0xe3, 0x356: 0xe4, 0x357: 0xe5, + 0x358: 0xe6, 0x359: 0xe7, 0x35a: 0xe8, 0x35b: 0xe9, 0x35c: 0xea, + 0x362: 0xeb, 0x363: 0xec, + 0x36b: 0xed, + 0x370: 0xee, 0x371: 0xef, 0x372: 0xf0, + // Block 0xe, offset 0x380 + 0x380: 0x23, 0x381: 0x23, 0x382: 0x23, 0x383: 0x23, 0x384: 0x23, 0x385: 0x23, 0x386: 0x23, 0x387: 0x23, + 0x388: 0x23, 0x389: 0x23, 0x38a: 0x23, 0x38b: 0x23, 0x38c: 0x23, 0x38d: 0x23, 0x38e: 0xf1, + 0x390: 0x23, 0x391: 0xf2, 0x392: 0x23, 0x393: 0x23, 0x394: 0x23, 0x395: 0xf3, + // Block 0xf, offset 0x3c0 + 0x3c0: 0x23, 0x3c1: 0x23, 0x3c2: 0x23, 0x3c3: 0x23, 0x3c4: 0x23, 0x3c5: 0x23, 0x3c6: 0x23, 0x3c7: 0x23, + 0x3c8: 0x23, 0x3c9: 0x23, 0x3ca: 0x23, 0x3cb: 0x23, 0x3cc: 0x23, 0x3cd: 0x23, 0x3ce: 0x23, 0x3cf: 0x23, + 0x3d0: 0xf2, + // Block 0x10, offset 0x400 + 0x410: 0x23, 0x411: 0x23, 0x412: 0x23, 0x413: 0x23, 0x414: 0x23, 0x415: 0x23, 0x416: 0x23, 0x417: 0x23, + 0x418: 0x23, 0x419: 0xf4, + // Block 0x11, offset 0x440 + 0x460: 0x23, 0x461: 0x23, 0x462: 0x23, 0x463: 0x23, 0x464: 0x23, 0x465: 0x23, 0x466: 0x23, 0x467: 0x23, + 0x468: 0xed, 0x469: 0xf5, 0x46b: 0xf6, 0x46c: 0xf7, 0x46d: 0xf8, 0x46e: 0xf9, + 0x47c: 0x23, 0x47d: 0xfa, 0x47e: 0xfb, 0x47f: 0xfc, + // Block 0x12, offset 0x480 + 0x4b0: 0x23, 0x4b1: 0xfd, 0x4b2: 0xfe, + // Block 0x13, offset 0x4c0 + 0x4c5: 0xff, 0x4c6: 0x100, + 0x4c9: 0x101, + 0x4d0: 0x102, 0x4d1: 0x103, 0x4d2: 0x104, 0x4d3: 0x105, 0x4d4: 0x106, 0x4d5: 0x107, 0x4d6: 0x108, 0x4d7: 0x109, + 0x4d8: 0x10a, 0x4d9: 0x10b, 0x4da: 0x10c, 0x4db: 0x10d, 0x4dc: 0x10e, 0x4dd: 0x10f, 0x4de: 0x110, 0x4df: 0x111, + 0x4e8: 0x112, 0x4e9: 0x113, 0x4ea: 0x114, + // Block 0x14, offset 0x500 + 0x500: 0x115, + 0x520: 0x23, 0x521: 0x23, 0x522: 0x23, 0x523: 0x116, 0x524: 0x10, 0x525: 0x117, + 0x538: 0x118, 0x539: 0x11, 0x53a: 0x119, + // Block 0x15, offset 0x540 + 0x544: 0x11a, 0x545: 0x11b, 0x546: 0x11c, + 0x54f: 0x11d, + // Block 0x16, offset 0x580 + 0x590: 0x0a, 0x591: 0x0b, 0x592: 0x0c, 0x593: 0x0d, 0x594: 0x0e, 0x596: 0x0f, + 0x59b: 0x10, 0x59d: 0x11, 0x59e: 0x12, 0x59f: 0x13, + // Block 0x17, offset 0x5c0 + 0x5c0: 0x11e, 0x5c1: 0x11f, 0x5c4: 0x11f, 0x5c5: 0x11f, 0x5c6: 0x11f, 0x5c7: 0x120, + // Block 0x18, offset 0x600 + 0x620: 0x15, +} + +// sparseOffsets: 272 entries, 544 bytes +var sparseOffsets = []uint16{0x0, 0x9, 0xf, 0x18, 0x24, 0x2e, 0x3a, 0x3d, 0x41, 0x44, 0x48, 0x52, 0x54, 0x59, 0x69, 0x70, 0x75, 0x83, 0x84, 0x92, 0xa1, 0xab, 0xae, 0xb4, 0xbc, 0xbe, 0xc0, 0xce, 0xd4, 0xe2, 0xed, 0xf8, 0x103, 0x10f, 0x119, 0x124, 0x12f, 0x13b, 0x147, 0x14f, 0x157, 0x161, 0x16c, 0x178, 0x17e, 0x189, 0x18e, 0x196, 0x199, 0x19e, 0x1a2, 0x1a6, 0x1ad, 0x1b6, 0x1be, 0x1bf, 0x1c8, 0x1cf, 0x1d7, 0x1dd, 0x1e3, 0x1e8, 0x1ec, 0x1ef, 0x1f1, 0x1f4, 0x1f9, 0x1fa, 0x1fc, 0x1fe, 0x200, 0x207, 0x20c, 0x210, 0x219, 0x21c, 0x21f, 0x225, 0x226, 0x231, 0x232, 0x233, 0x238, 0x245, 0x24d, 0x255, 0x25e, 0x267, 0x270, 0x275, 0x278, 0x281, 0x28e, 0x290, 0x297, 0x299, 0x2a4, 0x2a5, 0x2b0, 0x2b8, 0x2c0, 0x2c6, 0x2c7, 0x2d5, 0x2da, 0x2dd, 0x2e2, 0x2e6, 0x2ec, 0x2f1, 0x2f4, 0x2f9, 0x2fe, 0x2ff, 0x305, 0x307, 0x308, 0x30a, 0x30c, 0x30f, 0x310, 0x312, 0x315, 0x31b, 0x31f, 0x321, 0x327, 0x32e, 0x332, 0x33b, 0x33c, 0x344, 0x348, 0x34d, 0x355, 0x35b, 0x361, 0x36b, 0x370, 0x379, 0x37f, 0x386, 0x38a, 0x392, 0x394, 0x396, 0x399, 0x39b, 0x39d, 0x39e, 0x39f, 0x3a1, 0x3a3, 0x3a9, 0x3ae, 0x3b0, 0x3b6, 0x3b9, 0x3bb, 0x3c1, 0x3c6, 0x3c8, 0x3c9, 0x3ca, 0x3cb, 0x3cd, 0x3cf, 0x3d1, 0x3d4, 0x3d6, 0x3d9, 0x3e1, 0x3e4, 0x3e8, 0x3f0, 0x3f2, 0x3f3, 0x3f4, 0x3f6, 0x3fc, 0x3fe, 0x3ff, 0x401, 0x403, 0x405, 0x412, 0x413, 0x414, 0x418, 0x41a, 0x41b, 0x41c, 0x41d, 0x41e, 0x422, 0x426, 0x42c, 0x42e, 0x435, 0x438, 0x43c, 0x442, 0x44b, 0x451, 0x457, 0x461, 0x46b, 0x46d, 0x474, 0x47a, 0x480, 0x486, 0x489, 0x48f, 0x492, 0x49a, 0x49b, 0x4a2, 0x4a3, 0x4a6, 0x4a7, 0x4ad, 0x4b0, 0x4b8, 0x4b9, 0x4ba, 0x4bb, 0x4bc, 0x4be, 0x4c0, 0x4c2, 0x4c6, 0x4c7, 0x4c9, 0x4ca, 0x4cb, 0x4cd, 0x4d2, 0x4d7, 0x4db, 0x4dc, 0x4df, 0x4e3, 0x4ee, 0x4f2, 0x4fa, 0x4ff, 0x503, 0x506, 0x50a, 0x50d, 0x510, 0x515, 0x519, 0x51d, 0x521, 0x525, 0x527, 0x529, 0x52c, 0x531, 0x533, 0x538, 0x541, 0x546, 0x547, 0x54a, 0x54b, 0x54c, 0x54e, 0x54f, 0x550} + +// sparseValues: 1360 entries, 5440 bytes +var sparseValues = [1360]valueRange{ + // Block 0x0, offset 0x0 + {value: 0x0004, lo: 0xa8, hi: 0xa8}, + {value: 0x0012, lo: 0xaa, hi: 0xaa}, + {value: 0x0014, lo: 0xad, hi: 0xad}, + {value: 0x0004, lo: 0xaf, hi: 0xaf}, + {value: 0x0004, lo: 0xb4, hi: 0xb4}, + {value: 0x001a, lo: 0xb5, hi: 0xb5}, + {value: 0x0054, lo: 0xb7, hi: 0xb7}, + {value: 0x0004, lo: 0xb8, hi: 0xb8}, + {value: 0x0012, lo: 0xba, hi: 0xba}, + // Block 0x1, offset 0x9 + {value: 0x2013, lo: 0x80, hi: 0x96}, + {value: 0x2013, lo: 0x98, hi: 0x9e}, + {value: 0x009a, lo: 0x9f, hi: 0x9f}, + {value: 0x2012, lo: 0xa0, hi: 0xb6}, + {value: 0x2012, lo: 0xb8, hi: 0xbe}, + {value: 0x0252, lo: 0xbf, hi: 0xbf}, + // Block 0x2, offset 0xf + {value: 0x0117, lo: 0x80, hi: 0xaf}, + {value: 0x011b, lo: 0xb0, hi: 0xb0}, + {value: 0x019a, lo: 0xb1, hi: 0xb1}, + {value: 0x0117, lo: 0xb2, hi: 0xb7}, + {value: 0x0012, lo: 0xb8, hi: 0xb8}, + {value: 0x0316, lo: 0xb9, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x0316, lo: 0xbd, hi: 0xbe}, + {value: 0x0553, lo: 0xbf, hi: 0xbf}, + // Block 0x3, offset 0x18 + {value: 0x0552, lo: 0x80, hi: 0x80}, + {value: 0x0316, lo: 0x81, hi: 0x82}, + {value: 0x0716, lo: 0x83, hi: 0x84}, + {value: 0x0316, lo: 0x85, hi: 0x86}, + {value: 0x0f16, lo: 0x87, hi: 0x88}, + {value: 0x01da, lo: 0x89, hi: 0x89}, + {value: 0x0117, lo: 0x8a, hi: 0xb7}, + {value: 0x0253, lo: 0xb8, hi: 0xb8}, + {value: 0x0316, lo: 0xb9, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x0316, lo: 0xbd, hi: 0xbe}, + {value: 0x028a, lo: 0xbf, hi: 0xbf}, + // Block 0x4, offset 0x24 + {value: 0x0117, lo: 0x80, hi: 0x9f}, + {value: 0x2f53, lo: 0xa0, hi: 0xa0}, + {value: 0x0012, lo: 0xa1, hi: 0xa1}, + {value: 0x0117, lo: 0xa2, hi: 0xb3}, + {value: 0x0012, lo: 0xb4, hi: 0xb9}, + {value: 0x090b, lo: 0xba, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x2953, lo: 0xbd, hi: 0xbd}, + {value: 0x098b, lo: 0xbe, hi: 0xbe}, + {value: 0x0a0a, lo: 0xbf, hi: 0xbf}, + // Block 0x5, offset 0x2e + {value: 0x0015, lo: 0x80, hi: 0x81}, + {value: 0x0004, lo: 0x82, hi: 0x85}, + {value: 0x0014, lo: 0x86, hi: 0x91}, + {value: 0x0004, lo: 0x92, hi: 0x96}, + {value: 0x0054, lo: 0x97, hi: 0x97}, + {value: 0x0004, lo: 0x98, hi: 0x9f}, + {value: 0x0015, lo: 0xa0, hi: 0xa4}, + {value: 0x0004, lo: 0xa5, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xac}, + {value: 0x0004, lo: 0xad, hi: 0xad}, + {value: 0x0014, lo: 0xae, hi: 0xae}, + {value: 0x0004, lo: 0xaf, hi: 0xbf}, + // Block 0x6, offset 0x3a + {value: 0x0024, lo: 0x80, hi: 0x94}, + {value: 0x0034, lo: 0x95, hi: 0xbc}, + {value: 0x0024, lo: 0xbd, hi: 0xbf}, + // Block 0x7, offset 0x3d + {value: 0x6553, lo: 0x80, hi: 0x8f}, + {value: 0x2013, lo: 0x90, hi: 0x9f}, + {value: 0x5f53, lo: 0xa0, hi: 0xaf}, + {value: 0x2012, lo: 0xb0, hi: 0xbf}, + // Block 0x8, offset 0x41 + {value: 0x5f52, lo: 0x80, hi: 0x8f}, + {value: 0x6552, lo: 0x90, hi: 0x9f}, + {value: 0x0117, lo: 0xa0, hi: 0xbf}, + // Block 0x9, offset 0x44 + {value: 0x0117, lo: 0x80, hi: 0x81}, + {value: 0x0024, lo: 0x83, hi: 0x87}, + {value: 0x0014, lo: 0x88, hi: 0x89}, + {value: 0x0117, lo: 0x8a, hi: 0xbf}, + // Block 0xa, offset 0x48 + {value: 0x0f13, lo: 0x80, hi: 0x80}, + {value: 0x0316, lo: 0x81, hi: 0x82}, + {value: 0x0716, lo: 0x83, hi: 0x84}, + {value: 0x0316, lo: 0x85, hi: 0x86}, + {value: 0x0f16, lo: 0x87, hi: 0x88}, + {value: 0x0316, lo: 0x89, hi: 0x8a}, + {value: 0x0716, lo: 0x8b, hi: 0x8c}, + {value: 0x0316, lo: 0x8d, hi: 0x8e}, + {value: 0x0f12, lo: 0x8f, hi: 0x8f}, + {value: 0x0117, lo: 0x90, hi: 0xbf}, + // Block 0xb, offset 0x52 + {value: 0x0117, lo: 0x80, hi: 0xaf}, + {value: 0x6553, lo: 0xb1, hi: 0xbf}, + // Block 0xc, offset 0x54 + {value: 0x3013, lo: 0x80, hi: 0x8f}, + {value: 0x6853, lo: 0x90, hi: 0x96}, + {value: 0x0014, lo: 0x99, hi: 0x99}, + {value: 0x6552, lo: 0xa1, hi: 0xaf}, + {value: 0x3012, lo: 0xb0, hi: 0xbf}, + // Block 0xd, offset 0x59 + {value: 0x6852, lo: 0x80, hi: 0x86}, + {value: 0x198a, lo: 0x87, hi: 0x87}, + {value: 0x0034, lo: 0x91, hi: 0x91}, + {value: 0x0024, lo: 0x92, hi: 0x95}, + {value: 0x0034, lo: 0x96, hi: 0x96}, + {value: 0x0024, lo: 0x97, hi: 0x99}, + {value: 0x0034, lo: 0x9a, hi: 0x9b}, + {value: 0x0024, lo: 0x9c, hi: 0xa1}, + {value: 0x0034, lo: 0xa2, hi: 0xa7}, + {value: 0x0024, lo: 0xa8, hi: 0xa9}, + {value: 0x0034, lo: 0xaa, hi: 0xaa}, + {value: 0x0024, lo: 0xab, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xae}, + {value: 0x0024, lo: 0xaf, hi: 0xaf}, + {value: 0x0034, lo: 0xb0, hi: 0xbd}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xe, offset 0x69 + {value: 0x0034, lo: 0x81, hi: 0x82}, + {value: 0x0024, lo: 0x84, hi: 0x84}, + {value: 0x0034, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0x87, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0xaa}, + {value: 0x0010, lo: 0xb0, hi: 0xb3}, + {value: 0x0054, lo: 0xb4, hi: 0xb4}, + // Block 0xf, offset 0x70 + {value: 0x0014, lo: 0x80, hi: 0x85}, + {value: 0x0024, lo: 0x90, hi: 0x97}, + {value: 0x0034, lo: 0x98, hi: 0x9a}, + {value: 0x0014, lo: 0x9c, hi: 0x9c}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x10, offset 0x75 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x8a}, + {value: 0x0034, lo: 0x8b, hi: 0x92}, + {value: 0x0024, lo: 0x93, hi: 0x94}, + {value: 0x0034, lo: 0x95, hi: 0x96}, + {value: 0x0024, lo: 0x97, hi: 0x9b}, + {value: 0x0034, lo: 0x9c, hi: 0x9c}, + {value: 0x0024, lo: 0x9d, hi: 0x9e}, + {value: 0x0034, lo: 0x9f, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0x0010, lo: 0xab, hi: 0xab}, + {value: 0x0010, lo: 0xae, hi: 0xaf}, + {value: 0x0034, lo: 0xb0, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xbf}, + // Block 0x11, offset 0x83 + {value: 0x0010, lo: 0x80, hi: 0xbf}, + // Block 0x12, offset 0x84 + {value: 0x0010, lo: 0x80, hi: 0x93}, + {value: 0x0010, lo: 0x95, hi: 0x95}, + {value: 0x0024, lo: 0x96, hi: 0x9c}, + {value: 0x0014, lo: 0x9d, hi: 0x9d}, + {value: 0x0024, lo: 0x9f, hi: 0xa2}, + {value: 0x0034, lo: 0xa3, hi: 0xa3}, + {value: 0x0024, lo: 0xa4, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xa6}, + {value: 0x0024, lo: 0xa7, hi: 0xa8}, + {value: 0x0034, lo: 0xaa, hi: 0xaa}, + {value: 0x0024, lo: 0xab, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xbc}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x13, offset 0x92 + {value: 0x0014, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0034, lo: 0x91, hi: 0x91}, + {value: 0x0010, lo: 0x92, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb0}, + {value: 0x0034, lo: 0xb1, hi: 0xb1}, + {value: 0x0024, lo: 0xb2, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0024, lo: 0xb5, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb9}, + {value: 0x0024, lo: 0xba, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbc}, + {value: 0x0024, lo: 0xbd, hi: 0xbd}, + {value: 0x0034, lo: 0xbe, hi: 0xbe}, + {value: 0x0024, lo: 0xbf, hi: 0xbf}, + // Block 0x14, offset 0xa1 + {value: 0x0024, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0024, lo: 0x83, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x84}, + {value: 0x0024, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0024, lo: 0x87, hi: 0x87}, + {value: 0x0034, lo: 0x88, hi: 0x88}, + {value: 0x0024, lo: 0x89, hi: 0x8a}, + {value: 0x0010, lo: 0x8d, hi: 0xbf}, + // Block 0x15, offset 0xab + {value: 0x0010, lo: 0x80, hi: 0xa5}, + {value: 0x0014, lo: 0xa6, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + // Block 0x16, offset 0xae + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0024, lo: 0xab, hi: 0xb1}, + {value: 0x0034, lo: 0xb2, hi: 0xb2}, + {value: 0x0024, lo: 0xb3, hi: 0xb3}, + {value: 0x0014, lo: 0xb4, hi: 0xb5}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + // Block 0x17, offset 0xb4 + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0024, lo: 0x96, hi: 0x99}, + {value: 0x0014, lo: 0x9a, hi: 0x9a}, + {value: 0x0024, lo: 0x9b, hi: 0xa3}, + {value: 0x0014, lo: 0xa4, hi: 0xa4}, + {value: 0x0024, lo: 0xa5, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa8}, + {value: 0x0024, lo: 0xa9, hi: 0xad}, + // Block 0x18, offset 0xbc + {value: 0x0010, lo: 0x80, hi: 0x98}, + {value: 0x0034, lo: 0x99, hi: 0x9b}, + // Block 0x19, offset 0xbe + {value: 0x0010, lo: 0xa0, hi: 0xb4}, + {value: 0x0010, lo: 0xb6, hi: 0xbd}, + // Block 0x1a, offset 0xc0 + {value: 0x0024, lo: 0x94, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa2}, + {value: 0x0034, lo: 0xa3, hi: 0xa3}, + {value: 0x0024, lo: 0xa4, hi: 0xa5}, + {value: 0x0034, lo: 0xa6, hi: 0xa6}, + {value: 0x0024, lo: 0xa7, hi: 0xa8}, + {value: 0x0034, lo: 0xa9, hi: 0xa9}, + {value: 0x0024, lo: 0xaa, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xb2}, + {value: 0x0024, lo: 0xb3, hi: 0xb5}, + {value: 0x0034, lo: 0xb6, hi: 0xb6}, + {value: 0x0024, lo: 0xb7, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0024, lo: 0xbb, hi: 0xbf}, + // Block 0x1b, offset 0xce + {value: 0x0014, lo: 0x80, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0xb9}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x1c, offset 0xd4 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x88}, + {value: 0x0010, lo: 0x89, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0024, lo: 0x91, hi: 0x91}, + {value: 0x0034, lo: 0x92, hi: 0x92}, + {value: 0x0024, lo: 0x93, hi: 0x94}, + {value: 0x0014, lo: 0x95, hi: 0x97}, + {value: 0x0010, lo: 0x98, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0014, lo: 0xb1, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xbf}, + // Block 0x1d, offset 0xe2 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb2}, + {value: 0x0010, lo: 0xb6, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x1e, offset 0xed + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8e, hi: 0x8e}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0x9c, hi: 0x9d}, + {value: 0x0010, lo: 0x9f, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xb1}, + // Block 0x1f, offset 0xf8 + {value: 0x0014, lo: 0x81, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8a}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb6}, + {value: 0x0010, lo: 0xb8, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x20, offset 0x103 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x82}, + {value: 0x0014, lo: 0x87, hi: 0x88}, + {value: 0x0014, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0014, lo: 0x91, hi: 0x91}, + {value: 0x0010, lo: 0x99, hi: 0x9c}, + {value: 0x0010, lo: 0x9e, hi: 0x9e}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb5}, + // Block 0x21, offset 0x10f + {value: 0x0014, lo: 0x81, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8d}, + {value: 0x0010, lo: 0x8f, hi: 0x91}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x22, offset 0x119 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x85}, + {value: 0x0014, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x89, hi: 0x89}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb9, hi: 0xb9}, + // Block 0x23, offset 0x124 + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbe}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x24, offset 0x12f + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0014, lo: 0x96, hi: 0x96}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0x9c, hi: 0x9d}, + {value: 0x0010, lo: 0x9f, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + // Block 0x25, offset 0x13b + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8a}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0x95}, + {value: 0x0010, lo: 0x99, hi: 0x9a}, + {value: 0x0010, lo: 0x9c, hi: 0x9c}, + {value: 0x0010, lo: 0x9e, hi: 0x9f}, + {value: 0x0010, lo: 0xa3, hi: 0xa4}, + {value: 0x0010, lo: 0xa8, hi: 0xaa}, + {value: 0x0010, lo: 0xae, hi: 0xb9}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x26, offset 0x147 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x82}, + {value: 0x0010, lo: 0x86, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + // Block 0x27, offset 0x14f + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb9}, + {value: 0x0010, lo: 0xbd, hi: 0xbd}, + {value: 0x0014, lo: 0xbe, hi: 0xbf}, + // Block 0x28, offset 0x157 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x84}, + {value: 0x0014, lo: 0x86, hi: 0x88}, + {value: 0x0014, lo: 0x8a, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0034, lo: 0x95, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x9a}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + // Block 0x29, offset 0x161 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbe}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x2a, offset 0x16c + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0014, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x95, hi: 0x96}, + {value: 0x0010, lo: 0x9e, hi: 0x9e}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb1, hi: 0xb2}, + // Block 0x2b, offset 0x178 + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0xba}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x2c, offset 0x17e + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x86, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8e, hi: 0x8e}, + {value: 0x0010, lo: 0x94, hi: 0x97}, + {value: 0x0010, lo: 0x9f, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa3}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xba, hi: 0xbf}, + // Block 0x2d, offset 0x189 + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x96}, + {value: 0x0010, lo: 0x9a, hi: 0xb1}, + {value: 0x0010, lo: 0xb3, hi: 0xbb}, + {value: 0x0010, lo: 0xbd, hi: 0xbd}, + // Block 0x2e, offset 0x18e + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0010, lo: 0x8f, hi: 0x91}, + {value: 0x0014, lo: 0x92, hi: 0x94}, + {value: 0x0014, lo: 0x96, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x9f}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + // Block 0x2f, offset 0x196 + {value: 0x0014, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb4, hi: 0xb7}, + {value: 0x0034, lo: 0xb8, hi: 0xba}, + // Block 0x30, offset 0x199 + {value: 0x0004, lo: 0x86, hi: 0x86}, + {value: 0x0014, lo: 0x87, hi: 0x87}, + {value: 0x0034, lo: 0x88, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8e}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x31, offset 0x19e + {value: 0x0014, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb4, hi: 0xb7}, + {value: 0x0034, lo: 0xb8, hi: 0xb9}, + {value: 0x0014, lo: 0xbb, hi: 0xbc}, + // Block 0x32, offset 0x1a2 + {value: 0x0004, lo: 0x86, hi: 0x86}, + {value: 0x0034, lo: 0x88, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x33, offset 0x1a6 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0034, lo: 0x98, hi: 0x99}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0x0034, lo: 0xb5, hi: 0xb5}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + {value: 0x0034, lo: 0xb9, hi: 0xb9}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x34, offset 0x1ad + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0010, lo: 0x89, hi: 0xac}, + {value: 0x0034, lo: 0xb1, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xba, hi: 0xbd}, + {value: 0x0014, lo: 0xbe, hi: 0xbe}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x35, offset 0x1b6 + {value: 0x0034, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0024, lo: 0x82, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x84}, + {value: 0x0024, lo: 0x86, hi: 0x87}, + {value: 0x0010, lo: 0x88, hi: 0x8c}, + {value: 0x0014, lo: 0x8d, hi: 0x97}, + {value: 0x0014, lo: 0x99, hi: 0xbc}, + // Block 0x36, offset 0x1be + {value: 0x0034, lo: 0x86, hi: 0x86}, + // Block 0x37, offset 0x1bf + {value: 0x0010, lo: 0xab, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + {value: 0x0010, lo: 0xb8, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbc}, + {value: 0x0014, lo: 0xbd, hi: 0xbe}, + // Block 0x38, offset 0x1c8 + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x96, hi: 0x97}, + {value: 0x0014, lo: 0x98, hi: 0x99}, + {value: 0x0014, lo: 0x9e, hi: 0xa0}, + {value: 0x0010, lo: 0xa2, hi: 0xa4}, + {value: 0x0010, lo: 0xa7, hi: 0xad}, + {value: 0x0014, lo: 0xb1, hi: 0xb4}, + // Block 0x39, offset 0x1cf + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x84}, + {value: 0x0014, lo: 0x85, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x8f, hi: 0x9c}, + {value: 0x0014, lo: 0x9d, hi: 0x9d}, + {value: 0x6c53, lo: 0xa0, hi: 0xbf}, + // Block 0x3a, offset 0x1d7 + {value: 0x7053, lo: 0x80, hi: 0x85}, + {value: 0x7053, lo: 0x87, hi: 0x87}, + {value: 0x7053, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0xba}, + {value: 0x0014, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x3b, offset 0x1dd + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x98}, + {value: 0x0010, lo: 0x9a, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x3c, offset 0x1e3 + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb5}, + {value: 0x0010, lo: 0xb8, hi: 0xbe}, + // Block 0x3d, offset 0x1e8 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x82, hi: 0x85}, + {value: 0x0010, lo: 0x88, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0xbf}, + // Block 0x3e, offset 0x1ec + {value: 0x0010, lo: 0x80, hi: 0x90}, + {value: 0x0010, lo: 0x92, hi: 0x95}, + {value: 0x0010, lo: 0x98, hi: 0xbf}, + // Block 0x3f, offset 0x1ef + {value: 0x0010, lo: 0x80, hi: 0x9a}, + {value: 0x0024, lo: 0x9d, hi: 0x9f}, + // Block 0x40, offset 0x1f1 + {value: 0x0010, lo: 0x80, hi: 0x8f}, + {value: 0x7453, lo: 0xa0, hi: 0xaf}, + {value: 0x7853, lo: 0xb0, hi: 0xbf}, + // Block 0x41, offset 0x1f4 + {value: 0x7c53, lo: 0x80, hi: 0x8f}, + {value: 0x8053, lo: 0x90, hi: 0x9f}, + {value: 0x7c53, lo: 0xa0, hi: 0xaf}, + {value: 0x0813, lo: 0xb0, hi: 0xb5}, + {value: 0x0892, lo: 0xb8, hi: 0xbd}, + // Block 0x42, offset 0x1f9 + {value: 0x0010, lo: 0x81, hi: 0xbf}, + // Block 0x43, offset 0x1fa + {value: 0x0010, lo: 0x80, hi: 0xac}, + {value: 0x0010, lo: 0xaf, hi: 0xbf}, + // Block 0x44, offset 0x1fc + {value: 0x0010, lo: 0x81, hi: 0x9a}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x45, offset 0x1fe + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0010, lo: 0xae, hi: 0xb8}, + // Block 0x46, offset 0x200 + {value: 0x0010, lo: 0x80, hi: 0x8c}, + {value: 0x0010, lo: 0x8e, hi: 0x91}, + {value: 0x0014, lo: 0x92, hi: 0x93}, + {value: 0x0034, lo: 0x94, hi: 0x94}, + {value: 0x0010, lo: 0xa0, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + // Block 0x47, offset 0x207 + {value: 0x0010, lo: 0x80, hi: 0x91}, + {value: 0x0014, lo: 0x92, hi: 0x93}, + {value: 0x0010, lo: 0xa0, hi: 0xac}, + {value: 0x0010, lo: 0xae, hi: 0xb0}, + {value: 0x0014, lo: 0xb2, hi: 0xb3}, + // Block 0x48, offset 0x20c + {value: 0x0014, lo: 0xb4, hi: 0xb5}, + {value: 0x0010, lo: 0xb6, hi: 0xb6}, + {value: 0x0014, lo: 0xb7, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0x49, offset 0x210 + {value: 0x0010, lo: 0x80, hi: 0x85}, + {value: 0x0014, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0014, lo: 0x89, hi: 0x91}, + {value: 0x0034, lo: 0x92, hi: 0x92}, + {value: 0x0014, lo: 0x93, hi: 0x93}, + {value: 0x0004, lo: 0x97, hi: 0x97}, + {value: 0x0024, lo: 0x9d, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + // Block 0x4a, offset 0x219 + {value: 0x0014, lo: 0x8b, hi: 0x8e}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x4b, offset 0x21c + {value: 0x0010, lo: 0x80, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0xb7}, + // Block 0x4c, offset 0x21f + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0014, lo: 0x85, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0xa8}, + {value: 0x0034, lo: 0xa9, hi: 0xa9}, + {value: 0x0010, lo: 0xaa, hi: 0xaa}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x4d, offset 0x225 + {value: 0x0010, lo: 0x80, hi: 0xb5}, + // Block 0x4e, offset 0x226 + {value: 0x0010, lo: 0x80, hi: 0x9e}, + {value: 0x0014, lo: 0xa0, hi: 0xa2}, + {value: 0x0010, lo: 0xa3, hi: 0xa6}, + {value: 0x0014, lo: 0xa7, hi: 0xa8}, + {value: 0x0010, lo: 0xa9, hi: 0xab}, + {value: 0x0010, lo: 0xb0, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb2}, + {value: 0x0010, lo: 0xb3, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xb9}, + {value: 0x0024, lo: 0xba, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbb}, + // Block 0x4f, offset 0x231 + {value: 0x0010, lo: 0x86, hi: 0x8f}, + // Block 0x50, offset 0x232 + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x51, offset 0x233 + {value: 0x0010, lo: 0x80, hi: 0x96}, + {value: 0x0024, lo: 0x97, hi: 0x97}, + {value: 0x0034, lo: 0x98, hi: 0x98}, + {value: 0x0010, lo: 0x99, hi: 0x9a}, + {value: 0x0014, lo: 0x9b, hi: 0x9b}, + // Block 0x52, offset 0x238 + {value: 0x0010, lo: 0x95, hi: 0x95}, + {value: 0x0014, lo: 0x96, hi: 0x96}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0014, lo: 0x98, hi: 0x9e}, + {value: 0x0034, lo: 0xa0, hi: 0xa0}, + {value: 0x0010, lo: 0xa1, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa2}, + {value: 0x0010, lo: 0xa3, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xac}, + {value: 0x0010, lo: 0xad, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb4}, + {value: 0x0024, lo: 0xb5, hi: 0xbc}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0x53, offset 0x245 + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0004, lo: 0xa7, hi: 0xa7}, + {value: 0x0024, lo: 0xb0, hi: 0xb4}, + {value: 0x0034, lo: 0xb5, hi: 0xba}, + {value: 0x0024, lo: 0xbb, hi: 0xbc}, + {value: 0x0034, lo: 0xbd, hi: 0xbd}, + {value: 0x0014, lo: 0xbe, hi: 0xbe}, + // Block 0x54, offset 0x24d + {value: 0x0014, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x55, offset 0x255 + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x83}, + {value: 0x0030, lo: 0x84, hi: 0x84}, + {value: 0x0010, lo: 0x85, hi: 0x8b}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0024, lo: 0xab, hi: 0xab}, + {value: 0x0034, lo: 0xac, hi: 0xac}, + {value: 0x0024, lo: 0xad, hi: 0xb3}, + // Block 0x56, offset 0x25e + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa5}, + {value: 0x0010, lo: 0xa6, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa9}, + {value: 0x0030, lo: 0xaa, hi: 0xaa}, + {value: 0x0034, lo: 0xab, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xbf}, + // Block 0x57, offset 0x267 + {value: 0x0010, lo: 0x80, hi: 0xa5}, + {value: 0x0034, lo: 0xa6, hi: 0xa6}, + {value: 0x0010, lo: 0xa7, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa9}, + {value: 0x0010, lo: 0xaa, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xae}, + {value: 0x0014, lo: 0xaf, hi: 0xb1}, + {value: 0x0030, lo: 0xb2, hi: 0xb3}, + // Block 0x58, offset 0x270 + {value: 0x0010, lo: 0x80, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xb3}, + {value: 0x0010, lo: 0xb4, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + // Block 0x59, offset 0x275 + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x8d, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbd}, + // Block 0x5a, offset 0x278 + {value: 0x1a6a, lo: 0x80, hi: 0x80}, + {value: 0x1aea, lo: 0x81, hi: 0x81}, + {value: 0x1b6a, lo: 0x82, hi: 0x82}, + {value: 0x1bea, lo: 0x83, hi: 0x83}, + {value: 0x1c6a, lo: 0x84, hi: 0x84}, + {value: 0x1cea, lo: 0x85, hi: 0x85}, + {value: 0x1d6a, lo: 0x86, hi: 0x86}, + {value: 0x1dea, lo: 0x87, hi: 0x87}, + {value: 0x1e6a, lo: 0x88, hi: 0x88}, + // Block 0x5b, offset 0x281 + {value: 0x0024, lo: 0x90, hi: 0x92}, + {value: 0x0034, lo: 0x94, hi: 0x99}, + {value: 0x0024, lo: 0x9a, hi: 0x9b}, + {value: 0x0034, lo: 0x9c, hi: 0x9f}, + {value: 0x0024, lo: 0xa0, hi: 0xa0}, + {value: 0x0010, lo: 0xa1, hi: 0xa1}, + {value: 0x0034, lo: 0xa2, hi: 0xa8}, + {value: 0x0010, lo: 0xa9, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xb3}, + {value: 0x0024, lo: 0xb4, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb6}, + {value: 0x0024, lo: 0xb8, hi: 0xb9}, + // Block 0x5c, offset 0x28e + {value: 0x0012, lo: 0x80, hi: 0xab}, + {value: 0x0015, lo: 0xac, hi: 0xbf}, + // Block 0x5d, offset 0x290 + {value: 0x0015, lo: 0x80, hi: 0xaa}, + {value: 0x0012, lo: 0xab, hi: 0xb7}, + {value: 0x0015, lo: 0xb8, hi: 0xb8}, + {value: 0x8452, lo: 0xb9, hi: 0xb9}, + {value: 0x0012, lo: 0xba, hi: 0xbc}, + {value: 0x8852, lo: 0xbd, hi: 0xbd}, + {value: 0x0012, lo: 0xbe, hi: 0xbf}, + // Block 0x5e, offset 0x297 + {value: 0x0012, lo: 0x80, hi: 0x9a}, + {value: 0x0015, lo: 0x9b, hi: 0xbf}, + // Block 0x5f, offset 0x299 + {value: 0x0024, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0024, lo: 0x83, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0024, lo: 0x8b, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x90}, + {value: 0x0024, lo: 0x91, hi: 0xb5}, + {value: 0x0024, lo: 0xbb, hi: 0xbb}, + {value: 0x0034, lo: 0xbc, hi: 0xbd}, + {value: 0x0024, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0x60, offset 0x2a4 + {value: 0x0117, lo: 0x80, hi: 0xbf}, + // Block 0x61, offset 0x2a5 + {value: 0x0117, lo: 0x80, hi: 0x95}, + {value: 0x1f1a, lo: 0x96, hi: 0x96}, + {value: 0x1fca, lo: 0x97, hi: 0x97}, + {value: 0x207a, lo: 0x98, hi: 0x98}, + {value: 0x212a, lo: 0x99, hi: 0x99}, + {value: 0x21da, lo: 0x9a, hi: 0x9a}, + {value: 0x228a, lo: 0x9b, hi: 0x9b}, + {value: 0x0012, lo: 0x9c, hi: 0x9d}, + {value: 0x233b, lo: 0x9e, hi: 0x9e}, + {value: 0x0012, lo: 0x9f, hi: 0x9f}, + {value: 0x0117, lo: 0xa0, hi: 0xbf}, + // Block 0x62, offset 0x2b0 + {value: 0x0812, lo: 0x80, hi: 0x87}, + {value: 0x0813, lo: 0x88, hi: 0x8f}, + {value: 0x0812, lo: 0x90, hi: 0x95}, + {value: 0x0813, lo: 0x98, hi: 0x9d}, + {value: 0x0812, lo: 0xa0, hi: 0xa7}, + {value: 0x0813, lo: 0xa8, hi: 0xaf}, + {value: 0x0812, lo: 0xb0, hi: 0xb7}, + {value: 0x0813, lo: 0xb8, hi: 0xbf}, + // Block 0x63, offset 0x2b8 + {value: 0x0004, lo: 0x8b, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8f}, + {value: 0x0054, lo: 0x98, hi: 0x99}, + {value: 0x0054, lo: 0xa4, hi: 0xa4}, + {value: 0x0054, lo: 0xa7, hi: 0xa7}, + {value: 0x0014, lo: 0xaa, hi: 0xae}, + {value: 0x0010, lo: 0xaf, hi: 0xaf}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x64, offset 0x2c0 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x94, hi: 0x94}, + {value: 0x0014, lo: 0xa0, hi: 0xa4}, + {value: 0x0014, lo: 0xa6, hi: 0xaf}, + {value: 0x0015, lo: 0xb1, hi: 0xb1}, + {value: 0x0015, lo: 0xbf, hi: 0xbf}, + // Block 0x65, offset 0x2c6 + {value: 0x0015, lo: 0x90, hi: 0x9c}, + // Block 0x66, offset 0x2c7 + {value: 0x0024, lo: 0x90, hi: 0x91}, + {value: 0x0034, lo: 0x92, hi: 0x93}, + {value: 0x0024, lo: 0x94, hi: 0x97}, + {value: 0x0034, lo: 0x98, hi: 0x9a}, + {value: 0x0024, lo: 0x9b, hi: 0x9c}, + {value: 0x0014, lo: 0x9d, hi: 0xa0}, + {value: 0x0024, lo: 0xa1, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa4}, + {value: 0x0034, lo: 0xa5, hi: 0xa6}, + {value: 0x0024, lo: 0xa7, hi: 0xa7}, + {value: 0x0034, lo: 0xa8, hi: 0xa8}, + {value: 0x0024, lo: 0xa9, hi: 0xa9}, + {value: 0x0034, lo: 0xaa, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb0}, + // Block 0x67, offset 0x2d5 + {value: 0x0016, lo: 0x85, hi: 0x86}, + {value: 0x0012, lo: 0x87, hi: 0x89}, + {value: 0x9d52, lo: 0x8e, hi: 0x8e}, + {value: 0x1013, lo: 0xa0, hi: 0xaf}, + {value: 0x1012, lo: 0xb0, hi: 0xbf}, + // Block 0x68, offset 0x2da + {value: 0x0010, lo: 0x80, hi: 0x82}, + {value: 0x0716, lo: 0x83, hi: 0x84}, + {value: 0x0010, lo: 0x85, hi: 0x88}, + // Block 0x69, offset 0x2dd + {value: 0xa053, lo: 0xb6, hi: 0xb7}, + {value: 0xa353, lo: 0xb8, hi: 0xb9}, + {value: 0xa653, lo: 0xba, hi: 0xbb}, + {value: 0xa353, lo: 0xbc, hi: 0xbd}, + {value: 0xa053, lo: 0xbe, hi: 0xbf}, + // Block 0x6a, offset 0x2e2 + {value: 0x3013, lo: 0x80, hi: 0x8f}, + {value: 0x6553, lo: 0x90, hi: 0x9f}, + {value: 0xa953, lo: 0xa0, hi: 0xae}, + {value: 0x3012, lo: 0xb0, hi: 0xbf}, + // Block 0x6b, offset 0x2e6 + {value: 0x0117, lo: 0x80, hi: 0xa3}, + {value: 0x0012, lo: 0xa4, hi: 0xa4}, + {value: 0x0716, lo: 0xab, hi: 0xac}, + {value: 0x0316, lo: 0xad, hi: 0xae}, + {value: 0x0024, lo: 0xaf, hi: 0xb1}, + {value: 0x0117, lo: 0xb2, hi: 0xb3}, + // Block 0x6c, offset 0x2ec + {value: 0x6c52, lo: 0x80, hi: 0x9f}, + {value: 0x7052, lo: 0xa0, hi: 0xa5}, + {value: 0x7052, lo: 0xa7, hi: 0xa7}, + {value: 0x7052, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x6d, offset 0x2f1 + {value: 0x0010, lo: 0x80, hi: 0xa7}, + {value: 0x0014, lo: 0xaf, hi: 0xaf}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0x6e, offset 0x2f4 + {value: 0x0010, lo: 0x80, hi: 0x96}, + {value: 0x0010, lo: 0xa0, hi: 0xa6}, + {value: 0x0010, lo: 0xa8, hi: 0xae}, + {value: 0x0010, lo: 0xb0, hi: 0xb6}, + {value: 0x0010, lo: 0xb8, hi: 0xbe}, + // Block 0x6f, offset 0x2f9 + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x88, hi: 0x8e}, + {value: 0x0010, lo: 0x90, hi: 0x96}, + {value: 0x0010, lo: 0x98, hi: 0x9e}, + {value: 0x0024, lo: 0xa0, hi: 0xbf}, + // Block 0x70, offset 0x2fe + {value: 0x0014, lo: 0xaf, hi: 0xaf}, + // Block 0x71, offset 0x2ff + {value: 0x0014, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0xaa, hi: 0xad}, + {value: 0x0030, lo: 0xae, hi: 0xaf}, + {value: 0x0004, lo: 0xb1, hi: 0xb5}, + {value: 0x0014, lo: 0xbb, hi: 0xbb}, + {value: 0x0010, lo: 0xbc, hi: 0xbc}, + // Block 0x72, offset 0x305 + {value: 0x0034, lo: 0x99, hi: 0x9a}, + {value: 0x0004, lo: 0x9b, hi: 0x9e}, + // Block 0x73, offset 0x307 + {value: 0x0004, lo: 0xbc, hi: 0xbe}, + // Block 0x74, offset 0x308 + {value: 0x0010, lo: 0x85, hi: 0xad}, + {value: 0x0010, lo: 0xb1, hi: 0xbf}, + // Block 0x75, offset 0x30a + {value: 0x0010, lo: 0x80, hi: 0x8e}, + {value: 0x0010, lo: 0xa0, hi: 0xba}, + // Block 0x76, offset 0x30c + {value: 0x0010, lo: 0x80, hi: 0x94}, + {value: 0x0014, lo: 0x95, hi: 0x95}, + {value: 0x0010, lo: 0x96, hi: 0xbf}, + // Block 0x77, offset 0x30f + {value: 0x0010, lo: 0x80, hi: 0x8c}, + // Block 0x78, offset 0x310 + {value: 0x0010, lo: 0x90, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbd}, + // Block 0x79, offset 0x312 + {value: 0x0010, lo: 0x80, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0010, lo: 0x90, hi: 0xab}, + // Block 0x7a, offset 0x315 + {value: 0x0117, lo: 0x80, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xae}, + {value: 0x0024, lo: 0xaf, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb2}, + {value: 0x0024, lo: 0xb4, hi: 0xbd}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x7b, offset 0x31b + {value: 0x0117, lo: 0x80, hi: 0x9b}, + {value: 0x0015, lo: 0x9c, hi: 0x9d}, + {value: 0x0024, lo: 0x9e, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0x7c, offset 0x31f + {value: 0x0010, lo: 0x80, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb1}, + // Block 0x7d, offset 0x321 + {value: 0x0004, lo: 0x80, hi: 0x96}, + {value: 0x0014, lo: 0x97, hi: 0x9f}, + {value: 0x0004, lo: 0xa0, hi: 0xa1}, + {value: 0x0117, lo: 0xa2, hi: 0xaf}, + {value: 0x0012, lo: 0xb0, hi: 0xb1}, + {value: 0x0117, lo: 0xb2, hi: 0xbf}, + // Block 0x7e, offset 0x327 + {value: 0x0117, lo: 0x80, hi: 0xaf}, + {value: 0x0015, lo: 0xb0, hi: 0xb0}, + {value: 0x0012, lo: 0xb1, hi: 0xb8}, + {value: 0x0316, lo: 0xb9, hi: 0xba}, + {value: 0x0716, lo: 0xbb, hi: 0xbc}, + {value: 0x8453, lo: 0xbd, hi: 0xbd}, + {value: 0x0117, lo: 0xbe, hi: 0xbf}, + // Block 0x7f, offset 0x32e + {value: 0x0010, lo: 0xb7, hi: 0xb7}, + {value: 0x0015, lo: 0xb8, hi: 0xb9}, + {value: 0x0012, lo: 0xba, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbf}, + // Block 0x80, offset 0x332 + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0014, lo: 0x82, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x8a}, + {value: 0x0014, lo: 0x8b, hi: 0x8b}, + {value: 0x0010, lo: 0x8c, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xa6}, + {value: 0x0010, lo: 0xa7, hi: 0xa7}, + // Block 0x81, offset 0x33b + {value: 0x0010, lo: 0x80, hi: 0xb3}, + // Block 0x82, offset 0x33c + {value: 0x0010, lo: 0x80, hi: 0x83}, + {value: 0x0034, lo: 0x84, hi: 0x84}, + {value: 0x0014, lo: 0x85, hi: 0x85}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0024, lo: 0xa0, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xb7}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0010, lo: 0xbd, hi: 0xbd}, + // Block 0x83, offset 0x344 + {value: 0x0010, lo: 0x80, hi: 0xa5}, + {value: 0x0014, lo: 0xa6, hi: 0xaa}, + {value: 0x0034, lo: 0xab, hi: 0xad}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x84, offset 0x348 + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0014, lo: 0x87, hi: 0x91}, + {value: 0x0010, lo: 0x92, hi: 0x92}, + {value: 0x0030, lo: 0x93, hi: 0x93}, + {value: 0x0010, lo: 0xa0, hi: 0xbc}, + // Block 0x85, offset 0x34d + {value: 0x0014, lo: 0x80, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0xb2}, + {value: 0x0034, lo: 0xb3, hi: 0xb3}, + {value: 0x0010, lo: 0xb4, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xb9}, + {value: 0x0010, lo: 0xba, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0x86, offset 0x355 + {value: 0x0030, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0014, lo: 0xa5, hi: 0xa5}, + {value: 0x0004, lo: 0xa6, hi: 0xa6}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0x87, offset 0x35b + {value: 0x0010, lo: 0x80, hi: 0xa8}, + {value: 0x0014, lo: 0xa9, hi: 0xae}, + {value: 0x0010, lo: 0xaf, hi: 0xb0}, + {value: 0x0014, lo: 0xb1, hi: 0xb2}, + {value: 0x0010, lo: 0xb3, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb6}, + // Block 0x88, offset 0x361 + {value: 0x0010, lo: 0x80, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0x8b}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0010, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0004, lo: 0xb0, hi: 0xb0}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbd}, + // Block 0x89, offset 0x36b + {value: 0x0024, lo: 0xb0, hi: 0xb0}, + {value: 0x0024, lo: 0xb2, hi: 0xb3}, + {value: 0x0034, lo: 0xb4, hi: 0xb4}, + {value: 0x0024, lo: 0xb7, hi: 0xb8}, + {value: 0x0024, lo: 0xbe, hi: 0xbf}, + // Block 0x8a, offset 0x370 + {value: 0x0024, lo: 0x81, hi: 0x81}, + {value: 0x0004, lo: 0x9d, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xab}, + {value: 0x0014, lo: 0xac, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xaf}, + {value: 0x0010, lo: 0xb2, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb4}, + {value: 0x0010, lo: 0xb5, hi: 0xb5}, + {value: 0x0034, lo: 0xb6, hi: 0xb6}, + // Block 0x8b, offset 0x379 + {value: 0x0010, lo: 0x81, hi: 0x86}, + {value: 0x0010, lo: 0x89, hi: 0x8e}, + {value: 0x0010, lo: 0x91, hi: 0x96}, + {value: 0x0010, lo: 0xa0, hi: 0xa6}, + {value: 0x0010, lo: 0xa8, hi: 0xae}, + {value: 0x0012, lo: 0xb0, hi: 0xbf}, + // Block 0x8c, offset 0x37f + {value: 0x0012, lo: 0x80, hi: 0x92}, + {value: 0xac52, lo: 0x93, hi: 0x93}, + {value: 0x0012, lo: 0x94, hi: 0x9a}, + {value: 0x0004, lo: 0x9b, hi: 0x9b}, + {value: 0x0015, lo: 0x9c, hi: 0x9f}, + {value: 0x0012, lo: 0xa0, hi: 0xa5}, + {value: 0x74d2, lo: 0xb0, hi: 0xbf}, + // Block 0x8d, offset 0x386 + {value: 0x78d2, lo: 0x80, hi: 0x8f}, + {value: 0x7cd2, lo: 0x90, hi: 0x9f}, + {value: 0x80d2, lo: 0xa0, hi: 0xaf}, + {value: 0x7cd2, lo: 0xb0, hi: 0xbf}, + // Block 0x8e, offset 0x38a + {value: 0x0010, lo: 0x80, hi: 0xa4}, + {value: 0x0014, lo: 0xa5, hi: 0xa5}, + {value: 0x0010, lo: 0xa6, hi: 0xa7}, + {value: 0x0014, lo: 0xa8, hi: 0xa8}, + {value: 0x0010, lo: 0xa9, hi: 0xaa}, + {value: 0x0010, lo: 0xac, hi: 0xac}, + {value: 0x0034, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0x8f, offset 0x392 + {value: 0x0010, lo: 0x80, hi: 0xa3}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0x90, offset 0x394 + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x8b, hi: 0xbb}, + // Block 0x91, offset 0x396 + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x83, hi: 0x84}, + {value: 0x0010, lo: 0x86, hi: 0xbf}, + // Block 0x92, offset 0x399 + {value: 0x0010, lo: 0x80, hi: 0xb1}, + {value: 0x0004, lo: 0xb2, hi: 0xbf}, + // Block 0x93, offset 0x39b + {value: 0x0004, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x93, hi: 0xbf}, + // Block 0x94, offset 0x39d + {value: 0x0010, lo: 0x80, hi: 0xbd}, + // Block 0x95, offset 0x39e + {value: 0x0010, lo: 0x90, hi: 0xbf}, + // Block 0x96, offset 0x39f + {value: 0x0010, lo: 0x80, hi: 0x8f}, + {value: 0x0010, lo: 0x92, hi: 0xbf}, + // Block 0x97, offset 0x3a1 + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0010, lo: 0xb0, hi: 0xbb}, + // Block 0x98, offset 0x3a3 + {value: 0x0014, lo: 0x80, hi: 0x8f}, + {value: 0x0054, lo: 0x93, hi: 0x93}, + {value: 0x0024, lo: 0xa0, hi: 0xa6}, + {value: 0x0034, lo: 0xa7, hi: 0xad}, + {value: 0x0024, lo: 0xae, hi: 0xaf}, + {value: 0x0010, lo: 0xb3, hi: 0xb4}, + // Block 0x99, offset 0x3a9 + {value: 0x0010, lo: 0x8d, hi: 0x8f}, + {value: 0x0054, lo: 0x92, hi: 0x92}, + {value: 0x0054, lo: 0x95, hi: 0x95}, + {value: 0x0010, lo: 0xb0, hi: 0xb4}, + {value: 0x0010, lo: 0xb6, hi: 0xbf}, + // Block 0x9a, offset 0x3ae + {value: 0x0010, lo: 0x80, hi: 0xbc}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0x9b, offset 0x3b0 + {value: 0x0054, lo: 0x87, hi: 0x87}, + {value: 0x0054, lo: 0x8e, hi: 0x8e}, + {value: 0x0054, lo: 0x9a, hi: 0x9a}, + {value: 0x5f53, lo: 0xa1, hi: 0xba}, + {value: 0x0004, lo: 0xbe, hi: 0xbe}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0x9c, offset 0x3b6 + {value: 0x0004, lo: 0x80, hi: 0x80}, + {value: 0x5f52, lo: 0x81, hi: 0x9a}, + {value: 0x0004, lo: 0xb0, hi: 0xb0}, + // Block 0x9d, offset 0x3b9 + {value: 0x0014, lo: 0x9e, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xbe}, + // Block 0x9e, offset 0x3bb + {value: 0x0010, lo: 0x82, hi: 0x87}, + {value: 0x0010, lo: 0x8a, hi: 0x8f}, + {value: 0x0010, lo: 0x92, hi: 0x97}, + {value: 0x0010, lo: 0x9a, hi: 0x9c}, + {value: 0x0004, lo: 0xa3, hi: 0xa3}, + {value: 0x0014, lo: 0xb9, hi: 0xbb}, + // Block 0x9f, offset 0x3c1 + {value: 0x0010, lo: 0x80, hi: 0x8b}, + {value: 0x0010, lo: 0x8d, hi: 0xa6}, + {value: 0x0010, lo: 0xa8, hi: 0xba}, + {value: 0x0010, lo: 0xbc, hi: 0xbd}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xa0, offset 0x3c6 + {value: 0x0010, lo: 0x80, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x9d}, + // Block 0xa1, offset 0x3c8 + {value: 0x0010, lo: 0x80, hi: 0xba}, + // Block 0xa2, offset 0x3c9 + {value: 0x0010, lo: 0x80, hi: 0xb4}, + // Block 0xa3, offset 0x3ca + {value: 0x0034, lo: 0xbd, hi: 0xbd}, + // Block 0xa4, offset 0x3cb + {value: 0x0010, lo: 0x80, hi: 0x9c}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0xa5, offset 0x3cd + {value: 0x0010, lo: 0x80, hi: 0x90}, + {value: 0x0034, lo: 0xa0, hi: 0xa0}, + // Block 0xa6, offset 0x3cf + {value: 0x0010, lo: 0x80, hi: 0x9f}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0xa7, offset 0x3d1 + {value: 0x0010, lo: 0x80, hi: 0x8a}, + {value: 0x0010, lo: 0x90, hi: 0xb5}, + {value: 0x0024, lo: 0xb6, hi: 0xba}, + // Block 0xa8, offset 0x3d4 + {value: 0x0010, lo: 0x80, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xbf}, + // Block 0xa9, offset 0x3d6 + {value: 0x0010, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x88, hi: 0x8f}, + {value: 0x0010, lo: 0x91, hi: 0x95}, + // Block 0xaa, offset 0x3d9 + {value: 0x2813, lo: 0x80, hi: 0x87}, + {value: 0x3813, lo: 0x88, hi: 0x8f}, + {value: 0x2813, lo: 0x90, hi: 0x97}, + {value: 0xaf53, lo: 0x98, hi: 0x9f}, + {value: 0xb253, lo: 0xa0, hi: 0xa7}, + {value: 0x2812, lo: 0xa8, hi: 0xaf}, + {value: 0x3812, lo: 0xb0, hi: 0xb7}, + {value: 0x2812, lo: 0xb8, hi: 0xbf}, + // Block 0xab, offset 0x3e1 + {value: 0xaf52, lo: 0x80, hi: 0x87}, + {value: 0xb252, lo: 0x88, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0xbf}, + // Block 0xac, offset 0x3e4 + {value: 0x0010, lo: 0x80, hi: 0x9d}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0xb253, lo: 0xb0, hi: 0xb7}, + {value: 0xaf53, lo: 0xb8, hi: 0xbf}, + // Block 0xad, offset 0x3e8 + {value: 0x2813, lo: 0x80, hi: 0x87}, + {value: 0x3813, lo: 0x88, hi: 0x8f}, + {value: 0x2813, lo: 0x90, hi: 0x93}, + {value: 0xb252, lo: 0x98, hi: 0x9f}, + {value: 0xaf52, lo: 0xa0, hi: 0xa7}, + {value: 0x2812, lo: 0xa8, hi: 0xaf}, + {value: 0x3812, lo: 0xb0, hi: 0xb7}, + {value: 0x2812, lo: 0xb8, hi: 0xbb}, + // Block 0xae, offset 0x3f0 + {value: 0x0010, lo: 0x80, hi: 0xa7}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0xaf, offset 0x3f2 + {value: 0x0010, lo: 0x80, hi: 0xa3}, + // Block 0xb0, offset 0x3f3 + {value: 0x0010, lo: 0x80, hi: 0xb6}, + // Block 0xb1, offset 0x3f4 + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xa7}, + // Block 0xb2, offset 0x3f6 + {value: 0x0010, lo: 0x80, hi: 0x85}, + {value: 0x0010, lo: 0x88, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0xb5}, + {value: 0x0010, lo: 0xb7, hi: 0xb8}, + {value: 0x0010, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xb3, offset 0x3fc + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xb6}, + // Block 0xb4, offset 0x3fe + {value: 0x0010, lo: 0x80, hi: 0x9e}, + // Block 0xb5, offset 0x3ff + {value: 0x0010, lo: 0xa0, hi: 0xb2}, + {value: 0x0010, lo: 0xb4, hi: 0xb5}, + // Block 0xb6, offset 0x401 + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xb9}, + // Block 0xb7, offset 0x403 + {value: 0x0010, lo: 0x80, hi: 0xb7}, + {value: 0x0010, lo: 0xbe, hi: 0xbf}, + // Block 0xb8, offset 0x405 + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x83}, + {value: 0x0014, lo: 0x85, hi: 0x86}, + {value: 0x0014, lo: 0x8c, hi: 0x8c}, + {value: 0x0034, lo: 0x8d, hi: 0x8d}, + {value: 0x0014, lo: 0x8e, hi: 0x8e}, + {value: 0x0024, lo: 0x8f, hi: 0x8f}, + {value: 0x0010, lo: 0x90, hi: 0x93}, + {value: 0x0010, lo: 0x95, hi: 0x97}, + {value: 0x0010, lo: 0x99, hi: 0xb3}, + {value: 0x0024, lo: 0xb8, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xb9, offset 0x412 + {value: 0x0010, lo: 0xa0, hi: 0xbc}, + // Block 0xba, offset 0x413 + {value: 0x0010, lo: 0x80, hi: 0x9c}, + // Block 0xbb, offset 0x414 + {value: 0x0010, lo: 0x80, hi: 0x87}, + {value: 0x0010, lo: 0x89, hi: 0xa4}, + {value: 0x0024, lo: 0xa5, hi: 0xa5}, + {value: 0x0034, lo: 0xa6, hi: 0xa6}, + // Block 0xbc, offset 0x418 + {value: 0x0010, lo: 0x80, hi: 0x95}, + {value: 0x0010, lo: 0xa0, hi: 0xb2}, + // Block 0xbd, offset 0x41a + {value: 0x0010, lo: 0x80, hi: 0x91}, + // Block 0xbe, offset 0x41b + {value: 0x0010, lo: 0x80, hi: 0x88}, + // Block 0xbf, offset 0x41c + {value: 0x5653, lo: 0x80, hi: 0xb2}, + // Block 0xc0, offset 0x41d + {value: 0x5652, lo: 0x80, hi: 0xb2}, + // Block 0xc1, offset 0x41e + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbf}, + // Block 0xc2, offset 0x422 + {value: 0x0014, lo: 0x80, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0xa6, hi: 0xaf}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xc3, offset 0x426 + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb6}, + {value: 0x0010, lo: 0xb7, hi: 0xb8}, + {value: 0x0034, lo: 0xb9, hi: 0xba}, + {value: 0x0014, lo: 0xbd, hi: 0xbd}, + // Block 0xc4, offset 0x42c + {value: 0x0010, lo: 0x90, hi: 0xa8}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0xc5, offset 0x42e + {value: 0x0024, lo: 0x80, hi: 0x82}, + {value: 0x0010, lo: 0x83, hi: 0xa6}, + {value: 0x0014, lo: 0xa7, hi: 0xab}, + {value: 0x0010, lo: 0xac, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xb2}, + {value: 0x0034, lo: 0xb3, hi: 0xb4}, + {value: 0x0010, lo: 0xb6, hi: 0xbf}, + // Block 0xc6, offset 0x435 + {value: 0x0010, lo: 0x90, hi: 0xb2}, + {value: 0x0034, lo: 0xb3, hi: 0xb3}, + {value: 0x0010, lo: 0xb6, hi: 0xb6}, + // Block 0xc7, offset 0x438 + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0xb5}, + {value: 0x0014, lo: 0xb6, hi: 0xbe}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xc8, offset 0x43c + {value: 0x0030, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x84}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0014, lo: 0x8b, hi: 0x8c}, + {value: 0x0010, lo: 0x90, hi: 0x9a}, + {value: 0x0010, lo: 0x9c, hi: 0x9c}, + // Block 0xc9, offset 0x442 + {value: 0x0010, lo: 0x80, hi: 0x91}, + {value: 0x0010, lo: 0x93, hi: 0xae}, + {value: 0x0014, lo: 0xaf, hi: 0xb1}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0014, lo: 0xb4, hi: 0xb4}, + {value: 0x0030, lo: 0xb5, hi: 0xb5}, + {value: 0x0034, lo: 0xb6, hi: 0xb6}, + {value: 0x0014, lo: 0xb7, hi: 0xb7}, + {value: 0x0014, lo: 0xbe, hi: 0xbe}, + // Block 0xca, offset 0x44b + {value: 0x0010, lo: 0x80, hi: 0x86}, + {value: 0x0010, lo: 0x88, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0x8d}, + {value: 0x0010, lo: 0x8f, hi: 0x9d}, + {value: 0x0010, lo: 0x9f, hi: 0xa8}, + {value: 0x0010, lo: 0xb0, hi: 0xbf}, + // Block 0xcb, offset 0x451 + {value: 0x0010, lo: 0x80, hi: 0x9e}, + {value: 0x0014, lo: 0x9f, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa2}, + {value: 0x0014, lo: 0xa3, hi: 0xa8}, + {value: 0x0034, lo: 0xa9, hi: 0xaa}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0xcc, offset 0x457 + {value: 0x0014, lo: 0x80, hi: 0x81}, + {value: 0x0010, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x8c}, + {value: 0x0010, lo: 0x8f, hi: 0x90}, + {value: 0x0010, lo: 0x93, hi: 0xa8}, + {value: 0x0010, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb5, hi: 0xb9}, + {value: 0x0034, lo: 0xbc, hi: 0xbc}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0xcd, offset 0x461 + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x84}, + {value: 0x0010, lo: 0x87, hi: 0x88}, + {value: 0x0010, lo: 0x8b, hi: 0x8c}, + {value: 0x0030, lo: 0x8d, hi: 0x8d}, + {value: 0x0010, lo: 0x90, hi: 0x90}, + {value: 0x0010, lo: 0x97, hi: 0x97}, + {value: 0x0010, lo: 0x9d, hi: 0xa3}, + {value: 0x0024, lo: 0xa6, hi: 0xac}, + {value: 0x0024, lo: 0xb0, hi: 0xb4}, + // Block 0xce, offset 0x46b + {value: 0x0010, lo: 0x80, hi: 0xb7}, + {value: 0x0014, lo: 0xb8, hi: 0xbf}, + // Block 0xcf, offset 0x46d + {value: 0x0010, lo: 0x80, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x82}, + {value: 0x0014, lo: 0x83, hi: 0x84}, + {value: 0x0010, lo: 0x85, hi: 0x85}, + {value: 0x0034, lo: 0x86, hi: 0x86}, + {value: 0x0010, lo: 0x87, hi: 0x8a}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0xd0, offset 0x474 + {value: 0x0010, lo: 0x80, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xb8}, + {value: 0x0010, lo: 0xb9, hi: 0xb9}, + {value: 0x0014, lo: 0xba, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbe}, + {value: 0x0014, lo: 0xbf, hi: 0xbf}, + // Block 0xd1, offset 0x47a + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x81, hi: 0x81}, + {value: 0x0034, lo: 0x82, hi: 0x83}, + {value: 0x0010, lo: 0x84, hi: 0x85}, + {value: 0x0010, lo: 0x87, hi: 0x87}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0xd2, offset 0x480 + {value: 0x0010, lo: 0x80, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb5}, + {value: 0x0010, lo: 0xb8, hi: 0xbb}, + {value: 0x0014, lo: 0xbc, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xd3, offset 0x486 + {value: 0x0034, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x98, hi: 0x9b}, + {value: 0x0014, lo: 0x9c, hi: 0x9d}, + // Block 0xd4, offset 0x489 + {value: 0x0010, lo: 0x80, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xba}, + {value: 0x0010, lo: 0xbb, hi: 0xbc}, + {value: 0x0014, lo: 0xbd, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xd5, offset 0x48f + {value: 0x0014, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x84, hi: 0x84}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0xd6, offset 0x492 + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0014, lo: 0xab, hi: 0xab}, + {value: 0x0010, lo: 0xac, hi: 0xac}, + {value: 0x0014, lo: 0xad, hi: 0xad}, + {value: 0x0010, lo: 0xae, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb5}, + {value: 0x0030, lo: 0xb6, hi: 0xb6}, + {value: 0x0034, lo: 0xb7, hi: 0xb7}, + // Block 0xd7, offset 0x49a + {value: 0x0010, lo: 0x80, hi: 0x89}, + // Block 0xd8, offset 0x49b + {value: 0x0014, lo: 0x9d, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa1}, + {value: 0x0014, lo: 0xa2, hi: 0xa5}, + {value: 0x0010, lo: 0xa6, hi: 0xa6}, + {value: 0x0014, lo: 0xa7, hi: 0xaa}, + {value: 0x0034, lo: 0xab, hi: 0xab}, + {value: 0x0010, lo: 0xb0, hi: 0xb9}, + // Block 0xd9, offset 0x4a2 + {value: 0x5f53, lo: 0xa0, hi: 0xbf}, + // Block 0xda, offset 0x4a3 + {value: 0x5f52, lo: 0x80, hi: 0x9f}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + {value: 0x0010, lo: 0xbf, hi: 0xbf}, + // Block 0xdb, offset 0x4a6 + {value: 0x0010, lo: 0x80, hi: 0xb8}, + // Block 0xdc, offset 0x4a7 + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x8a, hi: 0xaf}, + {value: 0x0014, lo: 0xb0, hi: 0xb6}, + {value: 0x0014, lo: 0xb8, hi: 0xbd}, + {value: 0x0010, lo: 0xbe, hi: 0xbe}, + {value: 0x0034, lo: 0xbf, hi: 0xbf}, + // Block 0xdd, offset 0x4ad + {value: 0x0010, lo: 0x80, hi: 0x80}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0010, lo: 0xb2, hi: 0xbf}, + // Block 0xde, offset 0x4b0 + {value: 0x0010, lo: 0x80, hi: 0x8f}, + {value: 0x0014, lo: 0x92, hi: 0xa7}, + {value: 0x0010, lo: 0xa9, hi: 0xa9}, + {value: 0x0014, lo: 0xaa, hi: 0xb0}, + {value: 0x0010, lo: 0xb1, hi: 0xb1}, + {value: 0x0014, lo: 0xb2, hi: 0xb3}, + {value: 0x0010, lo: 0xb4, hi: 0xb4}, + {value: 0x0014, lo: 0xb5, hi: 0xb6}, + // Block 0xdf, offset 0x4b8 + {value: 0x0010, lo: 0x80, hi: 0x99}, + // Block 0xe0, offset 0x4b9 + {value: 0x0010, lo: 0x80, hi: 0xae}, + // Block 0xe1, offset 0x4ba + {value: 0x0010, lo: 0x80, hi: 0x83}, + // Block 0xe2, offset 0x4bb + {value: 0x0010, lo: 0x80, hi: 0x86}, + // Block 0xe3, offset 0x4bc + {value: 0x0010, lo: 0x80, hi: 0x9e}, + {value: 0x0010, lo: 0xa0, hi: 0xa9}, + // Block 0xe4, offset 0x4be + {value: 0x0010, lo: 0x90, hi: 0xad}, + {value: 0x0034, lo: 0xb0, hi: 0xb4}, + // Block 0xe5, offset 0x4c0 + {value: 0x0010, lo: 0x80, hi: 0xaf}, + {value: 0x0024, lo: 0xb0, hi: 0xb6}, + // Block 0xe6, offset 0x4c2 + {value: 0x0014, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0010, lo: 0xa3, hi: 0xb7}, + {value: 0x0010, lo: 0xbd, hi: 0xbf}, + // Block 0xe7, offset 0x4c6 + {value: 0x0010, lo: 0x80, hi: 0x8f}, + // Block 0xe8, offset 0x4c7 + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0010, lo: 0x90, hi: 0xbe}, + // Block 0xe9, offset 0x4c9 + {value: 0x0014, lo: 0x8f, hi: 0x9f}, + // Block 0xea, offset 0x4ca + {value: 0x0014, lo: 0xa0, hi: 0xa0}, + // Block 0xeb, offset 0x4cb + {value: 0x0010, lo: 0x80, hi: 0xaa}, + {value: 0x0010, lo: 0xb0, hi: 0xbc}, + // Block 0xec, offset 0x4cd + {value: 0x0010, lo: 0x80, hi: 0x88}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + {value: 0x0014, lo: 0x9d, hi: 0x9d}, + {value: 0x0034, lo: 0x9e, hi: 0x9e}, + {value: 0x0014, lo: 0xa0, hi: 0xa3}, + // Block 0xed, offset 0x4d2 + {value: 0x0030, lo: 0xa5, hi: 0xa6}, + {value: 0x0034, lo: 0xa7, hi: 0xa9}, + {value: 0x0030, lo: 0xad, hi: 0xb2}, + {value: 0x0014, lo: 0xb3, hi: 0xba}, + {value: 0x0034, lo: 0xbb, hi: 0xbf}, + // Block 0xee, offset 0x4d7 + {value: 0x0034, lo: 0x80, hi: 0x82}, + {value: 0x0024, lo: 0x85, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8b}, + {value: 0x0024, lo: 0xaa, hi: 0xad}, + // Block 0xef, offset 0x4db + {value: 0x0024, lo: 0x82, hi: 0x84}, + // Block 0xf0, offset 0x4dc + {value: 0x0013, lo: 0x80, hi: 0x99}, + {value: 0x0012, lo: 0x9a, hi: 0xb3}, + {value: 0x0013, lo: 0xb4, hi: 0xbf}, + // Block 0xf1, offset 0x4df + {value: 0x0013, lo: 0x80, hi: 0x8d}, + {value: 0x0012, lo: 0x8e, hi: 0x94}, + {value: 0x0012, lo: 0x96, hi: 0xa7}, + {value: 0x0013, lo: 0xa8, hi: 0xbf}, + // Block 0xf2, offset 0x4e3 + {value: 0x0013, lo: 0x80, hi: 0x81}, + {value: 0x0012, lo: 0x82, hi: 0x9b}, + {value: 0x0013, lo: 0x9c, hi: 0x9c}, + {value: 0x0013, lo: 0x9e, hi: 0x9f}, + {value: 0x0013, lo: 0xa2, hi: 0xa2}, + {value: 0x0013, lo: 0xa5, hi: 0xa6}, + {value: 0x0013, lo: 0xa9, hi: 0xac}, + {value: 0x0013, lo: 0xae, hi: 0xb5}, + {value: 0x0012, lo: 0xb6, hi: 0xb9}, + {value: 0x0012, lo: 0xbb, hi: 0xbb}, + {value: 0x0012, lo: 0xbd, hi: 0xbf}, + // Block 0xf3, offset 0x4ee + {value: 0x0012, lo: 0x80, hi: 0x83}, + {value: 0x0012, lo: 0x85, hi: 0x8f}, + {value: 0x0013, lo: 0x90, hi: 0xa9}, + {value: 0x0012, lo: 0xaa, hi: 0xbf}, + // Block 0xf4, offset 0x4f2 + {value: 0x0012, lo: 0x80, hi: 0x83}, + {value: 0x0013, lo: 0x84, hi: 0x85}, + {value: 0x0013, lo: 0x87, hi: 0x8a}, + {value: 0x0013, lo: 0x8d, hi: 0x94}, + {value: 0x0013, lo: 0x96, hi: 0x9c}, + {value: 0x0012, lo: 0x9e, hi: 0xb7}, + {value: 0x0013, lo: 0xb8, hi: 0xb9}, + {value: 0x0013, lo: 0xbb, hi: 0xbe}, + // Block 0xf5, offset 0x4fa + {value: 0x0013, lo: 0x80, hi: 0x84}, + {value: 0x0013, lo: 0x86, hi: 0x86}, + {value: 0x0013, lo: 0x8a, hi: 0x90}, + {value: 0x0012, lo: 0x92, hi: 0xab}, + {value: 0x0013, lo: 0xac, hi: 0xbf}, + // Block 0xf6, offset 0x4ff + {value: 0x0013, lo: 0x80, hi: 0x85}, + {value: 0x0012, lo: 0x86, hi: 0x9f}, + {value: 0x0013, lo: 0xa0, hi: 0xb9}, + {value: 0x0012, lo: 0xba, hi: 0xbf}, + // Block 0xf7, offset 0x503 + {value: 0x0012, lo: 0x80, hi: 0x93}, + {value: 0x0013, lo: 0x94, hi: 0xad}, + {value: 0x0012, lo: 0xae, hi: 0xbf}, + // Block 0xf8, offset 0x506 + {value: 0x0012, lo: 0x80, hi: 0x87}, + {value: 0x0013, lo: 0x88, hi: 0xa1}, + {value: 0x0012, lo: 0xa2, hi: 0xbb}, + {value: 0x0013, lo: 0xbc, hi: 0xbf}, + // Block 0xf9, offset 0x50a + {value: 0x0013, lo: 0x80, hi: 0x95}, + {value: 0x0012, lo: 0x96, hi: 0xaf}, + {value: 0x0013, lo: 0xb0, hi: 0xbf}, + // Block 0xfa, offset 0x50d + {value: 0x0013, lo: 0x80, hi: 0x89}, + {value: 0x0012, lo: 0x8a, hi: 0xa5}, + {value: 0x0013, lo: 0xa8, hi: 0xbf}, + // Block 0xfb, offset 0x510 + {value: 0x0013, lo: 0x80, hi: 0x80}, + {value: 0x0012, lo: 0x82, hi: 0x9a}, + {value: 0x0012, lo: 0x9c, hi: 0xa1}, + {value: 0x0013, lo: 0xa2, hi: 0xba}, + {value: 0x0012, lo: 0xbc, hi: 0xbf}, + // Block 0xfc, offset 0x515 + {value: 0x0012, lo: 0x80, hi: 0x94}, + {value: 0x0012, lo: 0x96, hi: 0x9b}, + {value: 0x0013, lo: 0x9c, hi: 0xb4}, + {value: 0x0012, lo: 0xb6, hi: 0xbf}, + // Block 0xfd, offset 0x519 + {value: 0x0012, lo: 0x80, hi: 0x8e}, + {value: 0x0012, lo: 0x90, hi: 0x95}, + {value: 0x0013, lo: 0x96, hi: 0xae}, + {value: 0x0012, lo: 0xb0, hi: 0xbf}, + // Block 0xfe, offset 0x51d + {value: 0x0012, lo: 0x80, hi: 0x88}, + {value: 0x0012, lo: 0x8a, hi: 0x8f}, + {value: 0x0013, lo: 0x90, hi: 0xa8}, + {value: 0x0012, lo: 0xaa, hi: 0xbf}, + // Block 0xff, offset 0x521 + {value: 0x0012, lo: 0x80, hi: 0x82}, + {value: 0x0012, lo: 0x84, hi: 0x89}, + {value: 0x0017, lo: 0x8a, hi: 0x8b}, + {value: 0x0010, lo: 0x8e, hi: 0xbf}, + // Block 0x100, offset 0x525 + {value: 0x0014, lo: 0x80, hi: 0xb6}, + {value: 0x0014, lo: 0xbb, hi: 0xbf}, + // Block 0x101, offset 0x527 + {value: 0x0014, lo: 0x80, hi: 0xac}, + {value: 0x0014, lo: 0xb5, hi: 0xb5}, + // Block 0x102, offset 0x529 + {value: 0x0014, lo: 0x84, hi: 0x84}, + {value: 0x0014, lo: 0x9b, hi: 0x9f}, + {value: 0x0014, lo: 0xa1, hi: 0xaf}, + // Block 0x103, offset 0x52c + {value: 0x0024, lo: 0x80, hi: 0x86}, + {value: 0x0024, lo: 0x88, hi: 0x98}, + {value: 0x0024, lo: 0x9b, hi: 0xa1}, + {value: 0x0024, lo: 0xa3, hi: 0xa4}, + {value: 0x0024, lo: 0xa6, hi: 0xaa}, + // Block 0x104, offset 0x531 + {value: 0x0010, lo: 0x80, hi: 0x84}, + {value: 0x0034, lo: 0x90, hi: 0x96}, + // Block 0x105, offset 0x533 + {value: 0xb552, lo: 0x80, hi: 0x81}, + {value: 0xb852, lo: 0x82, hi: 0x83}, + {value: 0x0024, lo: 0x84, hi: 0x89}, + {value: 0x0034, lo: 0x8a, hi: 0x8a}, + {value: 0x0010, lo: 0x90, hi: 0x99}, + // Block 0x106, offset 0x538 + {value: 0x0010, lo: 0x80, hi: 0x83}, + {value: 0x0010, lo: 0x85, hi: 0x9f}, + {value: 0x0010, lo: 0xa1, hi: 0xa2}, + {value: 0x0010, lo: 0xa4, hi: 0xa4}, + {value: 0x0010, lo: 0xa7, hi: 0xa7}, + {value: 0x0010, lo: 0xa9, hi: 0xb2}, + {value: 0x0010, lo: 0xb4, hi: 0xb7}, + {value: 0x0010, lo: 0xb9, hi: 0xb9}, + {value: 0x0010, lo: 0xbb, hi: 0xbb}, + // Block 0x107, offset 0x541 + {value: 0x0010, lo: 0x80, hi: 0x89}, + {value: 0x0010, lo: 0x8b, hi: 0x9b}, + {value: 0x0010, lo: 0xa1, hi: 0xa3}, + {value: 0x0010, lo: 0xa5, hi: 0xa9}, + {value: 0x0010, lo: 0xab, hi: 0xbb}, + // Block 0x108, offset 0x546 + {value: 0x0013, lo: 0xb0, hi: 0xbf}, + // Block 0x109, offset 0x547 + {value: 0x0013, lo: 0x80, hi: 0x89}, + {value: 0x0013, lo: 0x90, hi: 0xa9}, + {value: 0x0013, lo: 0xb0, hi: 0xbf}, + // Block 0x10a, offset 0x54a + {value: 0x0013, lo: 0x80, hi: 0x89}, + // Block 0x10b, offset 0x54b + {value: 0x0004, lo: 0xbb, hi: 0xbf}, + // Block 0x10c, offset 0x54c + {value: 0x0014, lo: 0x81, hi: 0x81}, + {value: 0x0014, lo: 0xa0, hi: 0xbf}, + // Block 0x10d, offset 0x54e + {value: 0x0014, lo: 0x80, hi: 0xbf}, + // Block 0x10e, offset 0x54f + {value: 0x0014, lo: 0x80, hi: 0xaf}, +} + +// Total table size 14027 bytes (13KiB); checksum: F17D40E8 diff --git a/vendor/golang.org/x/text/cases/trieval.go b/vendor/golang.org/x/text/cases/trieval.go new file mode 100644 index 00000000..4e4d13fe --- /dev/null +++ b/vendor/golang.org/x/text/cases/trieval.go @@ -0,0 +1,217 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +package cases + +// This file contains definitions for interpreting the trie value of the case +// trie generated by "go run gen*.go". It is shared by both the generator +// program and the resultant package. Sharing is achieved by the generator +// copying gen_trieval.go to trieval.go and changing what's above this comment. + +// info holds case information for a single rune. It is the value returned +// by a trie lookup. Most mapping information can be stored in a single 16-bit +// value. If not, for example when a rune is mapped to multiple runes, the value +// stores some basic case data and an index into an array with additional data. +// +// The per-rune values have the following format: +// +// if (exception) { +// 15..4 unsigned exception index +// } else { +// 15..8 XOR pattern or index to XOR pattern for case mapping +// Only 13..8 are used for XOR patterns. +// 7 inverseFold (fold to upper, not to lower) +// 6 index: interpret the XOR pattern as an index +// or isMid if case mode is cIgnorableUncased. +// 5..4 CCC: zero (normal or break), above or other +// } +// 3 exception: interpret this value as an exception index +// (TODO: is this bit necessary? Probably implied from case mode.) +// 2..0 case mode +// +// For the non-exceptional cases, a rune must be either uncased, lowercase or +// uppercase. If the rune is cased, the XOR pattern maps either a lowercase +// rune to uppercase or an uppercase rune to lowercase (applied to the 10 +// least-significant bits of the rune). +// +// See the definitions below for a more detailed description of the various +// bits. +type info uint16 + +const ( + casedMask = 0x0003 + fullCasedMask = 0x0007 + ignorableMask = 0x0006 + ignorableValue = 0x0004 + + inverseFoldBit = 1 << 7 + isMidBit = 1 << 6 + + exceptionBit = 1 << 3 + exceptionShift = 4 + numExceptionBits = 12 + + xorIndexBit = 1 << 6 + xorShift = 8 + + // There is no mapping if all xor bits and the exception bit are zero. + hasMappingMask = 0xff80 | exceptionBit +) + +// The case mode bits encodes the case type of a rune. This includes uncased, +// title, upper and lower case and case ignorable. (For a definition of these +// terms see Chapter 3 of The Unicode Standard Core Specification.) In some rare +// cases, a rune can be both cased and case-ignorable. This is encoded by +// cIgnorableCased. A rune of this type is always lower case. Some runes are +// cased while not having a mapping. +// +// A common pattern for scripts in the Unicode standard is for upper and lower +// case runes to alternate for increasing rune values (e.g. the accented Latin +// ranges starting from U+0100 and U+1E00 among others and some Cyrillic +// characters). We use this property by defining a cXORCase mode, where the case +// mode (always upper or lower case) is derived from the rune value. As the XOR +// pattern for case mappings is often identical for successive runes, using +// cXORCase can result in large series of identical trie values. This, in turn, +// allows us to better compress the trie blocks. +const ( + cUncased info = iota // 000 + cTitle // 001 + cLower // 010 + cUpper // 011 + cIgnorableUncased // 100 + cIgnorableCased // 101 // lower case if mappings exist + cXORCase // 11x // case is cLower | ((rune&1) ^ x) + + maxCaseMode = cUpper +) + +func (c info) isCased() bool { + return c&casedMask != 0 +} + +func (c info) isCaseIgnorable() bool { + return c&ignorableMask == ignorableValue +} + +func (c info) isNotCasedAndNotCaseIgnorable() bool { + return c&fullCasedMask == 0 +} + +func (c info) isCaseIgnorableAndNotCased() bool { + return c&fullCasedMask == cIgnorableUncased +} + +func (c info) isMid() bool { + return c&(fullCasedMask|isMidBit) == isMidBit|cIgnorableUncased +} + +// The case mapping implementation will need to know about various Canonical +// Combining Class (CCC) values. We encode two of these in the trie value: +// cccZero (0) and cccAbove (230). If the value is cccOther, it means that +// CCC(r) > 0, but not 230. A value of cccBreak means that CCC(r) == 0 and that +// the rune also has the break category Break (see below). +const ( + cccBreak info = iota << 4 + cccZero + cccAbove + cccOther + + cccMask = cccBreak | cccZero | cccAbove | cccOther +) + +const ( + starter = 0 + above = 230 + iotaSubscript = 240 +) + +// The exceptions slice holds data that does not fit in a normal info entry. +// The entry is pointed to by the exception index in an entry. It has the +// following format: +// +// Header: +// +// byte 0: +// 7..6 unused +// 5..4 CCC type (same bits as entry) +// 3 unused +// 2..0 length of fold +// +// byte 1: +// 7..6 unused +// 5..3 length of 1st mapping of case type +// 2..0 length of 2nd mapping of case type +// +// case 1st 2nd +// lower -> upper, title +// upper -> lower, title +// title -> lower, upper +// +// Lengths with the value 0x7 indicate no value and implies no change. +// A length of 0 indicates a mapping to zero-length string. +// +// Body bytes: +// +// case folding bytes +// lowercase mapping bytes +// uppercase mapping bytes +// titlecase mapping bytes +// closure mapping bytes (for NFKC_Casefold). (TODO) +// +// Fallbacks: +// +// missing fold -> lower +// missing title -> upper +// all missing -> original rune +// +// exceptions starts with a dummy byte to enforce that there is no zero index +// value. +const ( + lengthMask = 0x07 + lengthBits = 3 + noChange = 0 +) + +// References to generated trie. + +var trie = newCaseTrie(0) + +var sparse = sparseBlocks{ + values: sparseValues[:], + offsets: sparseOffsets[:], +} + +// Sparse block lookup code. + +// valueRange is an entry in a sparse block. +type valueRange struct { + value uint16 + lo, hi byte +} + +type sparseBlocks struct { + values []valueRange + offsets []uint16 +} + +// lookup returns the value from values block n for byte b using binary search. +func (s *sparseBlocks) lookup(n uint32, b byte) uint16 { + lo := s.offsets[n] + hi := s.offsets[n+1] + for lo < hi { + m := lo + (hi-lo)/2 + r := s.values[m] + if r.lo <= b && b <= r.hi { + return r.value + } + if b < r.lo { + hi = m + } else { + lo = m + 1 + } + } + return 0 +} + +// lastRuneForTesting is the last rune used for testing. Everything after this +// is boring. +const lastRuneForTesting = rune(0x1FFFF) diff --git a/vendor/golang.org/x/text/internal/internal.go b/vendor/golang.org/x/text/internal/internal.go new file mode 100644 index 00000000..3cddbbdd --- /dev/null +++ b/vendor/golang.org/x/text/internal/internal.go @@ -0,0 +1,49 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Package internal contains non-exported functionality that are used by +// packages in the text repository. +package internal // import "golang.org/x/text/internal" + +import ( + "sort" + + "golang.org/x/text/language" +) + +// SortTags sorts tags in place. +func SortTags(tags []language.Tag) { + sort.Sort(sorter(tags)) +} + +type sorter []language.Tag + +func (s sorter) Len() int { + return len(s) +} + +func (s sorter) Swap(i, j int) { + s[i], s[j] = s[j], s[i] +} + +func (s sorter) Less(i, j int) bool { + return s[i].String() < s[j].String() +} + +// UniqueTags sorts and filters duplicate tags in place and returns a slice with +// only unique tags. +func UniqueTags(tags []language.Tag) []language.Tag { + if len(tags) <= 1 { + return tags + } + SortTags(tags) + k := 0 + for i := 1; i < len(tags); i++ { + if tags[k].String() < tags[i].String() { + k++ + tags[k] = tags[i] + } + } + return tags[:k+1] +} diff --git a/vendor/golang.org/x/text/internal/language/common.go b/vendor/golang.org/x/text/internal/language/common.go new file mode 100644 index 00000000..cdfdb749 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/common.go @@ -0,0 +1,16 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +package language + +// This file contains code common to the maketables.go and the package code. + +// AliasType is the type of an alias in AliasMap. +type AliasType int8 + +const ( + Deprecated AliasType = iota + Macro + Legacy + + AliasTypeUnknown AliasType = -1 +) diff --git a/vendor/golang.org/x/text/internal/language/compact.go b/vendor/golang.org/x/text/internal/language/compact.go new file mode 100644 index 00000000..46a00150 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compact.go @@ -0,0 +1,29 @@ +// Copyright 2018 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +// CompactCoreInfo is a compact integer with the three core tags encoded. +type CompactCoreInfo uint32 + +// GetCompactCore generates a uint32 value that is guaranteed to be unique for +// different language, region, and script values. +func GetCompactCore(t Tag) (cci CompactCoreInfo, ok bool) { + if t.LangID > langNoIndexOffset { + return 0, false + } + cci |= CompactCoreInfo(t.LangID) << (8 + 12) + cci |= CompactCoreInfo(t.ScriptID) << 12 + cci |= CompactCoreInfo(t.RegionID) + return cci, true +} + +// Tag generates a tag from c. +func (c CompactCoreInfo) Tag() Tag { + return Tag{ + LangID: Language(c >> 20), + RegionID: Region(c & 0x3ff), + ScriptID: Script(c>>12) & 0xff, + } +} diff --git a/vendor/golang.org/x/text/internal/language/compact/compact.go b/vendor/golang.org/x/text/internal/language/compact/compact.go new file mode 100644 index 00000000..1b36935e --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compact/compact.go @@ -0,0 +1,61 @@ +// Copyright 2018 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Package compact defines a compact representation of language tags. +// +// Common language tags (at least all for which locale information is defined +// in CLDR) are assigned a unique index. Each Tag is associated with such an +// ID for selecting language-related resources (such as translations) as well +// as one for selecting regional defaults (currency, number formatting, etc.) +// +// It may want to export this functionality at some point, but at this point +// this is only available for use within x/text. +package compact // import "golang.org/x/text/internal/language/compact" + +import ( + "sort" + "strings" + + "golang.org/x/text/internal/language" +) + +// ID is an integer identifying a single tag. +type ID uint16 + +func getCoreIndex(t language.Tag) (id ID, ok bool) { + cci, ok := language.GetCompactCore(t) + if !ok { + return 0, false + } + i := sort.Search(len(coreTags), func(i int) bool { + return cci <= coreTags[i] + }) + if i == len(coreTags) || coreTags[i] != cci { + return 0, false + } + return ID(i), true +} + +// Parent returns the ID of the parent or the root ID if id is already the root. +func (id ID) Parent() ID { + return parents[id] +} + +// Tag converts id to an internal language Tag. +func (id ID) Tag() language.Tag { + if int(id) >= len(coreTags) { + return specialTags[int(id)-len(coreTags)] + } + return coreTags[id].Tag() +} + +var specialTags []language.Tag + +func init() { + tags := strings.Split(specialTagsStr, " ") + specialTags = make([]language.Tag, len(tags)) + for i, t := range tags { + specialTags[i] = language.MustParse(t) + } +} diff --git a/vendor/golang.org/x/text/internal/language/compact/language.go b/vendor/golang.org/x/text/internal/language/compact/language.go new file mode 100644 index 00000000..83816a72 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compact/language.go @@ -0,0 +1,260 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:generate go run gen.go gen_index.go -output tables.go +//go:generate go run gen_parents.go + +package compact + +// TODO: Remove above NOTE after: +// - verifying that tables are dropped correctly (most notably matcher tables). + +import ( + "strings" + + "golang.org/x/text/internal/language" +) + +// Tag represents a BCP 47 language tag. It is used to specify an instance of a +// specific language or locale. All language tag values are guaranteed to be +// well-formed. +type Tag struct { + // NOTE: exported tags will become part of the public API. + language ID + locale ID + full fullTag // always a language.Tag for now. +} + +const _und = 0 + +type fullTag interface { + IsRoot() bool + Parent() language.Tag +} + +// Make a compact Tag from a fully specified internal language Tag. +func Make(t language.Tag) (tag Tag) { + if region := t.TypeForKey("rg"); len(region) == 6 && region[2:] == "zzzz" { + if r, err := language.ParseRegion(region[:2]); err == nil { + tFull := t + t, _ = t.SetTypeForKey("rg", "") + // TODO: should we not consider "va" for the language tag? + var exact1, exact2 bool + tag.language, exact1 = FromTag(t) + t.RegionID = r + tag.locale, exact2 = FromTag(t) + if !exact1 || !exact2 { + tag.full = tFull + } + return tag + } + } + lang, ok := FromTag(t) + tag.language = lang + tag.locale = lang + if !ok { + tag.full = t + } + return tag +} + +// Tag returns an internal language Tag version of this tag. +func (t Tag) Tag() language.Tag { + if t.full != nil { + return t.full.(language.Tag) + } + tag := t.language.Tag() + if t.language != t.locale { + loc := t.locale.Tag() + tag, _ = tag.SetTypeForKey("rg", strings.ToLower(loc.RegionID.String())+"zzzz") + } + return tag +} + +// IsCompact reports whether this tag is fully defined in terms of ID. +func (t *Tag) IsCompact() bool { + return t.full == nil +} + +// MayHaveVariants reports whether a tag may have variants. If it returns false +// it is guaranteed the tag does not have variants. +func (t Tag) MayHaveVariants() bool { + return t.full != nil || int(t.language) >= len(coreTags) +} + +// MayHaveExtensions reports whether a tag may have extensions. If it returns +// false it is guaranteed the tag does not have them. +func (t Tag) MayHaveExtensions() bool { + return t.full != nil || + int(t.language) >= len(coreTags) || + t.language != t.locale +} + +// IsRoot returns true if t is equal to language "und". +func (t Tag) IsRoot() bool { + if t.full != nil { + return t.full.IsRoot() + } + return t.language == _und +} + +// Parent returns the CLDR parent of t. In CLDR, missing fields in data for a +// specific language are substituted with fields from the parent language. +// The parent for a language may change for newer versions of CLDR. +func (t Tag) Parent() Tag { + if t.full != nil { + return Make(t.full.Parent()) + } + if t.language != t.locale { + // Simulate stripping -u-rg-xxxxxx + return Tag{language: t.language, locale: t.language} + } + // TODO: use parent lookup table once cycle from internal package is + // removed. Probably by internalizing the table and declaring this fast + // enough. + // lang := compactID(internal.Parent(uint16(t.language))) + lang, _ := FromTag(t.language.Tag().Parent()) + return Tag{language: lang, locale: lang} +} + +// returns token t and the rest of the string. +func nextToken(s string) (t, tail string) { + p := strings.Index(s[1:], "-") + if p == -1 { + return s[1:], "" + } + p++ + return s[1:p], s[p:] +} + +// LanguageID returns an index, where 0 <= index < NumCompactTags, for tags +// for which data exists in the text repository.The index will change over time +// and should not be stored in persistent storage. If t does not match a compact +// index, exact will be false and the compact index will be returned for the +// first match after repeatedly taking the Parent of t. +func LanguageID(t Tag) (id ID, exact bool) { + return t.language, t.full == nil +} + +// RegionalID returns the ID for the regional variant of this tag. This index is +// used to indicate region-specific overrides, such as default currency, default +// calendar and week data, default time cycle, and default measurement system +// and unit preferences. +// +// For instance, the tag en-GB-u-rg-uszzzz specifies British English with US +// settings for currency, number formatting, etc. The CompactIndex for this tag +// will be that for en-GB, while the RegionalID will be the one corresponding to +// en-US. +func RegionalID(t Tag) (id ID, exact bool) { + return t.locale, t.full == nil +} + +// LanguageTag returns t stripped of regional variant indicators. +// +// At the moment this means it is stripped of a regional and variant subtag "rg" +// and "va" in the "u" extension. +func (t Tag) LanguageTag() Tag { + if t.full == nil { + return Tag{language: t.language, locale: t.language} + } + tt := t.Tag() + tt.SetTypeForKey("rg", "") + tt.SetTypeForKey("va", "") + return Make(tt) +} + +// RegionalTag returns the regional variant of the tag. +// +// At the moment this means that the region is set from the regional subtag +// "rg" in the "u" extension. +func (t Tag) RegionalTag() Tag { + rt := Tag{language: t.locale, locale: t.locale} + if t.full == nil { + return rt + } + b := language.Builder{} + tag := t.Tag() + // tag, _ = tag.SetTypeForKey("rg", "") + b.SetTag(t.locale.Tag()) + if v := tag.Variants(); v != "" { + for _, v := range strings.Split(v, "-") { + b.AddVariant(v) + } + } + for _, e := range tag.Extensions() { + b.AddExt(e) + } + return t +} + +// FromTag reports closest matching ID for an internal language Tag. +func FromTag(t language.Tag) (id ID, exact bool) { + // TODO: perhaps give more frequent tags a lower index. + // TODO: we could make the indexes stable. This will excluded some + // possibilities for optimization, so don't do this quite yet. + exact = true + + b, s, r := t.Raw() + if t.HasString() { + if t.IsPrivateUse() { + // We have no entries for user-defined tags. + return 0, false + } + hasExtra := false + if t.HasVariants() { + if t.HasExtensions() { + build := language.Builder{} + build.SetTag(language.Tag{LangID: b, ScriptID: s, RegionID: r}) + build.AddVariant(t.Variants()) + exact = false + t = build.Make() + } + hasExtra = true + } else if _, ok := t.Extension('u'); ok { + // TODO: va may mean something else. Consider not considering it. + // Strip all but the 'va' entry. + old := t + variant := t.TypeForKey("va") + t = language.Tag{LangID: b, ScriptID: s, RegionID: r} + if variant != "" { + t, _ = t.SetTypeForKey("va", variant) + hasExtra = true + } + exact = old == t + } else { + exact = false + } + if hasExtra { + // We have some variants. + for i, s := range specialTags { + if s == t { + return ID(i + len(coreTags)), exact + } + } + exact = false + } + } + if x, ok := getCoreIndex(t); ok { + return x, exact + } + exact = false + if r != 0 && s == 0 { + // Deal with cases where an extra script is inserted for the region. + t, _ := t.Maximize() + if x, ok := getCoreIndex(t); ok { + return x, exact + } + } + for t = t.Parent(); t != root; t = t.Parent() { + // No variants specified: just compare core components. + // The key has the form lllssrrr, where l, s, and r are nibbles for + // respectively the langID, scriptID, and regionID. + if x, ok := getCoreIndex(t); ok { + return x, exact + } + } + return 0, exact +} + +var root = language.Tag{} diff --git a/vendor/golang.org/x/text/internal/language/compact/parents.go b/vendor/golang.org/x/text/internal/language/compact/parents.go new file mode 100644 index 00000000..8d810723 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compact/parents.go @@ -0,0 +1,120 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +package compact + +// parents maps a compact index of a tag to the compact index of the parent of +// this tag. +var parents = []ID{ // 775 elements + // Entry 0 - 3F + 0x0000, 0x0000, 0x0001, 0x0001, 0x0000, 0x0004, 0x0000, 0x0006, + 0x0000, 0x0008, 0x0000, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, + 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, + 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, + 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x0000, + 0x0000, 0x0028, 0x0000, 0x002a, 0x0000, 0x002c, 0x0000, 0x0000, + 0x002f, 0x002e, 0x002e, 0x0000, 0x0033, 0x0000, 0x0035, 0x0000, + 0x0037, 0x0000, 0x0039, 0x0000, 0x003b, 0x0000, 0x0000, 0x003e, + // Entry 40 - 7F + 0x0000, 0x0040, 0x0040, 0x0000, 0x0043, 0x0043, 0x0000, 0x0046, + 0x0000, 0x0048, 0x0000, 0x0000, 0x004b, 0x004a, 0x004a, 0x0000, + 0x004f, 0x004f, 0x004f, 0x004f, 0x0000, 0x0054, 0x0054, 0x0000, + 0x0057, 0x0000, 0x0059, 0x0000, 0x005b, 0x0000, 0x005d, 0x005d, + 0x0000, 0x0060, 0x0000, 0x0062, 0x0000, 0x0064, 0x0000, 0x0066, + 0x0066, 0x0000, 0x0069, 0x0000, 0x006b, 0x006b, 0x006b, 0x006b, + 0x006b, 0x006b, 0x006b, 0x0000, 0x0073, 0x0000, 0x0075, 0x0000, + 0x0077, 0x0000, 0x0000, 0x007a, 0x0000, 0x007c, 0x0000, 0x007e, + // Entry 80 - BF + 0x0000, 0x0080, 0x0080, 0x0000, 0x0083, 0x0083, 0x0000, 0x0086, + 0x0087, 0x0087, 0x0087, 0x0086, 0x0088, 0x0087, 0x0087, 0x0087, + 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0088, + 0x0087, 0x0087, 0x0087, 0x0087, 0x0088, 0x0087, 0x0088, 0x0087, + 0x0087, 0x0088, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, + 0x0087, 0x0087, 0x0087, 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, + 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, + 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0086, 0x0087, 0x0086, + // Entry C0 - FF + 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, + 0x0088, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, + 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0088, 0x0087, + 0x0087, 0x0088, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, + 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0086, 0x0086, 0x0087, + 0x0087, 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0000, + 0x00ef, 0x0000, 0x00f1, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f2, + 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f1, 0x00f2, 0x00f1, 0x00f1, + // Entry 100 - 13F + 0x00f2, 0x00f2, 0x00f1, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f1, + 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x0000, 0x010e, + 0x0000, 0x0110, 0x0000, 0x0112, 0x0000, 0x0114, 0x0114, 0x0000, + 0x0117, 0x0117, 0x0117, 0x0117, 0x0000, 0x011c, 0x0000, 0x011e, + 0x0000, 0x0120, 0x0120, 0x0000, 0x0123, 0x0123, 0x0123, 0x0123, + 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, + 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, + 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, + // Entry 140 - 17F + 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, + 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, + 0x0123, 0x0123, 0x0000, 0x0152, 0x0000, 0x0154, 0x0000, 0x0156, + 0x0000, 0x0158, 0x0000, 0x015a, 0x0000, 0x015c, 0x015c, 0x015c, + 0x0000, 0x0160, 0x0000, 0x0000, 0x0163, 0x0000, 0x0165, 0x0000, + 0x0167, 0x0167, 0x0167, 0x0000, 0x016b, 0x0000, 0x016d, 0x0000, + 0x016f, 0x0000, 0x0171, 0x0171, 0x0000, 0x0174, 0x0000, 0x0176, + 0x0000, 0x0178, 0x0000, 0x017a, 0x0000, 0x017c, 0x0000, 0x017e, + // Entry 180 - 1BF + 0x0000, 0x0000, 0x0000, 0x0182, 0x0000, 0x0184, 0x0184, 0x0184, + 0x0184, 0x0000, 0x0000, 0x0000, 0x018b, 0x0000, 0x0000, 0x018e, + 0x0000, 0x0000, 0x0191, 0x0000, 0x0000, 0x0000, 0x0195, 0x0000, + 0x0197, 0x0000, 0x0000, 0x019a, 0x0000, 0x0000, 0x019d, 0x0000, + 0x019f, 0x0000, 0x01a1, 0x0000, 0x01a3, 0x0000, 0x01a5, 0x0000, + 0x01a7, 0x0000, 0x01a9, 0x0000, 0x01ab, 0x0000, 0x01ad, 0x0000, + 0x01af, 0x0000, 0x01b1, 0x01b1, 0x0000, 0x01b4, 0x0000, 0x01b6, + 0x0000, 0x01b8, 0x0000, 0x01ba, 0x0000, 0x01bc, 0x0000, 0x0000, + // Entry 1C0 - 1FF + 0x01bf, 0x0000, 0x01c1, 0x0000, 0x01c3, 0x0000, 0x01c5, 0x0000, + 0x01c7, 0x0000, 0x01c9, 0x0000, 0x01cb, 0x01cb, 0x01cb, 0x01cb, + 0x0000, 0x01d0, 0x0000, 0x01d2, 0x01d2, 0x0000, 0x01d5, 0x0000, + 0x01d7, 0x0000, 0x01d9, 0x0000, 0x01db, 0x0000, 0x01dd, 0x0000, + 0x01df, 0x01df, 0x0000, 0x01e2, 0x0000, 0x01e4, 0x0000, 0x01e6, + 0x0000, 0x01e8, 0x0000, 0x01ea, 0x0000, 0x01ec, 0x0000, 0x01ee, + 0x0000, 0x01f0, 0x0000, 0x0000, 0x01f3, 0x0000, 0x01f5, 0x01f5, + 0x01f5, 0x0000, 0x01f9, 0x0000, 0x01fb, 0x0000, 0x01fd, 0x0000, + // Entry 200 - 23F + 0x01ff, 0x0000, 0x0000, 0x0202, 0x0000, 0x0204, 0x0204, 0x0000, + 0x0207, 0x0000, 0x0209, 0x0209, 0x0000, 0x020c, 0x020c, 0x0000, + 0x020f, 0x020f, 0x020f, 0x020f, 0x020f, 0x020f, 0x020f, 0x0000, + 0x0217, 0x0000, 0x0219, 0x0000, 0x021b, 0x0000, 0x0000, 0x0000, + 0x0000, 0x0000, 0x0221, 0x0000, 0x0000, 0x0224, 0x0000, 0x0226, + 0x0226, 0x0000, 0x0229, 0x0000, 0x022b, 0x022b, 0x0000, 0x0000, + 0x022f, 0x022e, 0x022e, 0x0000, 0x0000, 0x0234, 0x0000, 0x0236, + 0x0000, 0x0238, 0x0000, 0x0244, 0x023a, 0x0244, 0x0244, 0x0244, + // Entry 240 - 27F + 0x0244, 0x0244, 0x0244, 0x0244, 0x023a, 0x0244, 0x0244, 0x0000, + 0x0247, 0x0247, 0x0247, 0x0000, 0x024b, 0x0000, 0x024d, 0x0000, + 0x024f, 0x024f, 0x0000, 0x0252, 0x0000, 0x0254, 0x0254, 0x0254, + 0x0254, 0x0254, 0x0254, 0x0000, 0x025b, 0x0000, 0x025d, 0x0000, + 0x025f, 0x0000, 0x0261, 0x0000, 0x0263, 0x0000, 0x0265, 0x0000, + 0x0000, 0x0268, 0x0268, 0x0268, 0x0000, 0x026c, 0x0000, 0x026e, + 0x0000, 0x0270, 0x0000, 0x0000, 0x0000, 0x0274, 0x0273, 0x0273, + 0x0000, 0x0278, 0x0000, 0x027a, 0x0000, 0x027c, 0x0000, 0x0000, + // Entry 280 - 2BF + 0x0000, 0x0000, 0x0281, 0x0000, 0x0000, 0x0284, 0x0000, 0x0286, + 0x0286, 0x0286, 0x0286, 0x0000, 0x028b, 0x028b, 0x028b, 0x0000, + 0x028f, 0x028f, 0x028f, 0x028f, 0x028f, 0x0000, 0x0295, 0x0295, + 0x0295, 0x0295, 0x0000, 0x0000, 0x0000, 0x0000, 0x029d, 0x029d, + 0x029d, 0x0000, 0x02a1, 0x02a1, 0x02a1, 0x02a1, 0x0000, 0x0000, + 0x02a7, 0x02a7, 0x02a7, 0x02a7, 0x0000, 0x02ac, 0x0000, 0x02ae, + 0x02ae, 0x0000, 0x02b1, 0x0000, 0x02b3, 0x0000, 0x02b5, 0x02b5, + 0x0000, 0x0000, 0x02b9, 0x0000, 0x0000, 0x0000, 0x02bd, 0x0000, + // Entry 2C0 - 2FF + 0x02bf, 0x02bf, 0x0000, 0x0000, 0x02c3, 0x0000, 0x02c5, 0x0000, + 0x02c7, 0x0000, 0x02c9, 0x0000, 0x02cb, 0x0000, 0x02cd, 0x02cd, + 0x0000, 0x0000, 0x02d1, 0x0000, 0x02d3, 0x02d0, 0x02d0, 0x0000, + 0x0000, 0x02d8, 0x02d7, 0x02d7, 0x0000, 0x0000, 0x02dd, 0x0000, + 0x02df, 0x0000, 0x02e1, 0x0000, 0x0000, 0x02e4, 0x0000, 0x02e6, + 0x0000, 0x0000, 0x02e9, 0x0000, 0x02eb, 0x0000, 0x02ed, 0x0000, + 0x02ef, 0x02ef, 0x0000, 0x0000, 0x02f3, 0x02f2, 0x02f2, 0x0000, + 0x02f7, 0x0000, 0x02f9, 0x02f9, 0x02f9, 0x02f9, 0x02f9, 0x0000, + // Entry 300 - 33F + 0x02ff, 0x0300, 0x02ff, 0x0000, 0x0303, 0x0051, 0x00e6, +} // Size: 1574 bytes + +// Total table size 1574 bytes (1KiB); checksum: 895AAF0B diff --git a/vendor/golang.org/x/text/internal/language/compact/tables.go b/vendor/golang.org/x/text/internal/language/compact/tables.go new file mode 100644 index 00000000..32af9de5 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compact/tables.go @@ -0,0 +1,1015 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +package compact + +import "golang.org/x/text/internal/language" + +// CLDRVersion is the CLDR version from which the tables in this package are derived. +const CLDRVersion = "32" + +// NumCompactTags is the number of common tags. The maximum tag is +// NumCompactTags-1. +const NumCompactTags = 775 +const ( + undIndex ID = 0 + afIndex ID = 1 + afNAIndex ID = 2 + afZAIndex ID = 3 + agqIndex ID = 4 + agqCMIndex ID = 5 + akIndex ID = 6 + akGHIndex ID = 7 + amIndex ID = 8 + amETIndex ID = 9 + arIndex ID = 10 + ar001Index ID = 11 + arAEIndex ID = 12 + arBHIndex ID = 13 + arDJIndex ID = 14 + arDZIndex ID = 15 + arEGIndex ID = 16 + arEHIndex ID = 17 + arERIndex ID = 18 + arILIndex ID = 19 + arIQIndex ID = 20 + arJOIndex ID = 21 + arKMIndex ID = 22 + arKWIndex ID = 23 + arLBIndex ID = 24 + arLYIndex ID = 25 + arMAIndex ID = 26 + arMRIndex ID = 27 + arOMIndex ID = 28 + arPSIndex ID = 29 + arQAIndex ID = 30 + arSAIndex ID = 31 + arSDIndex ID = 32 + arSOIndex ID = 33 + arSSIndex ID = 34 + arSYIndex ID = 35 + arTDIndex ID = 36 + arTNIndex ID = 37 + arYEIndex ID = 38 + arsIndex ID = 39 + asIndex ID = 40 + asINIndex ID = 41 + asaIndex ID = 42 + asaTZIndex ID = 43 + astIndex ID = 44 + astESIndex ID = 45 + azIndex ID = 46 + azCyrlIndex ID = 47 + azCyrlAZIndex ID = 48 + azLatnIndex ID = 49 + azLatnAZIndex ID = 50 + basIndex ID = 51 + basCMIndex ID = 52 + beIndex ID = 53 + beBYIndex ID = 54 + bemIndex ID = 55 + bemZMIndex ID = 56 + bezIndex ID = 57 + bezTZIndex ID = 58 + bgIndex ID = 59 + bgBGIndex ID = 60 + bhIndex ID = 61 + bmIndex ID = 62 + bmMLIndex ID = 63 + bnIndex ID = 64 + bnBDIndex ID = 65 + bnINIndex ID = 66 + boIndex ID = 67 + boCNIndex ID = 68 + boINIndex ID = 69 + brIndex ID = 70 + brFRIndex ID = 71 + brxIndex ID = 72 + brxINIndex ID = 73 + bsIndex ID = 74 + bsCyrlIndex ID = 75 + bsCyrlBAIndex ID = 76 + bsLatnIndex ID = 77 + bsLatnBAIndex ID = 78 + caIndex ID = 79 + caADIndex ID = 80 + caESIndex ID = 81 + caFRIndex ID = 82 + caITIndex ID = 83 + ccpIndex ID = 84 + ccpBDIndex ID = 85 + ccpINIndex ID = 86 + ceIndex ID = 87 + ceRUIndex ID = 88 + cggIndex ID = 89 + cggUGIndex ID = 90 + chrIndex ID = 91 + chrUSIndex ID = 92 + ckbIndex ID = 93 + ckbIQIndex ID = 94 + ckbIRIndex ID = 95 + csIndex ID = 96 + csCZIndex ID = 97 + cuIndex ID = 98 + cuRUIndex ID = 99 + cyIndex ID = 100 + cyGBIndex ID = 101 + daIndex ID = 102 + daDKIndex ID = 103 + daGLIndex ID = 104 + davIndex ID = 105 + davKEIndex ID = 106 + deIndex ID = 107 + deATIndex ID = 108 + deBEIndex ID = 109 + deCHIndex ID = 110 + deDEIndex ID = 111 + deITIndex ID = 112 + deLIIndex ID = 113 + deLUIndex ID = 114 + djeIndex ID = 115 + djeNEIndex ID = 116 + dsbIndex ID = 117 + dsbDEIndex ID = 118 + duaIndex ID = 119 + duaCMIndex ID = 120 + dvIndex ID = 121 + dyoIndex ID = 122 + dyoSNIndex ID = 123 + dzIndex ID = 124 + dzBTIndex ID = 125 + ebuIndex ID = 126 + ebuKEIndex ID = 127 + eeIndex ID = 128 + eeGHIndex ID = 129 + eeTGIndex ID = 130 + elIndex ID = 131 + elCYIndex ID = 132 + elGRIndex ID = 133 + enIndex ID = 134 + en001Index ID = 135 + en150Index ID = 136 + enAGIndex ID = 137 + enAIIndex ID = 138 + enASIndex ID = 139 + enATIndex ID = 140 + enAUIndex ID = 141 + enBBIndex ID = 142 + enBEIndex ID = 143 + enBIIndex ID = 144 + enBMIndex ID = 145 + enBSIndex ID = 146 + enBWIndex ID = 147 + enBZIndex ID = 148 + enCAIndex ID = 149 + enCCIndex ID = 150 + enCHIndex ID = 151 + enCKIndex ID = 152 + enCMIndex ID = 153 + enCXIndex ID = 154 + enCYIndex ID = 155 + enDEIndex ID = 156 + enDGIndex ID = 157 + enDKIndex ID = 158 + enDMIndex ID = 159 + enERIndex ID = 160 + enFIIndex ID = 161 + enFJIndex ID = 162 + enFKIndex ID = 163 + enFMIndex ID = 164 + enGBIndex ID = 165 + enGDIndex ID = 166 + enGGIndex ID = 167 + enGHIndex ID = 168 + enGIIndex ID = 169 + enGMIndex ID = 170 + enGUIndex ID = 171 + enGYIndex ID = 172 + enHKIndex ID = 173 + enIEIndex ID = 174 + enILIndex ID = 175 + enIMIndex ID = 176 + enINIndex ID = 177 + enIOIndex ID = 178 + enJEIndex ID = 179 + enJMIndex ID = 180 + enKEIndex ID = 181 + enKIIndex ID = 182 + enKNIndex ID = 183 + enKYIndex ID = 184 + enLCIndex ID = 185 + enLRIndex ID = 186 + enLSIndex ID = 187 + enMGIndex ID = 188 + enMHIndex ID = 189 + enMOIndex ID = 190 + enMPIndex ID = 191 + enMSIndex ID = 192 + enMTIndex ID = 193 + enMUIndex ID = 194 + enMWIndex ID = 195 + enMYIndex ID = 196 + enNAIndex ID = 197 + enNFIndex ID = 198 + enNGIndex ID = 199 + enNLIndex ID = 200 + enNRIndex ID = 201 + enNUIndex ID = 202 + enNZIndex ID = 203 + enPGIndex ID = 204 + enPHIndex ID = 205 + enPKIndex ID = 206 + enPNIndex ID = 207 + enPRIndex ID = 208 + enPWIndex ID = 209 + enRWIndex ID = 210 + enSBIndex ID = 211 + enSCIndex ID = 212 + enSDIndex ID = 213 + enSEIndex ID = 214 + enSGIndex ID = 215 + enSHIndex ID = 216 + enSIIndex ID = 217 + enSLIndex ID = 218 + enSSIndex ID = 219 + enSXIndex ID = 220 + enSZIndex ID = 221 + enTCIndex ID = 222 + enTKIndex ID = 223 + enTOIndex ID = 224 + enTTIndex ID = 225 + enTVIndex ID = 226 + enTZIndex ID = 227 + enUGIndex ID = 228 + enUMIndex ID = 229 + enUSIndex ID = 230 + enVCIndex ID = 231 + enVGIndex ID = 232 + enVIIndex ID = 233 + enVUIndex ID = 234 + enWSIndex ID = 235 + enZAIndex ID = 236 + enZMIndex ID = 237 + enZWIndex ID = 238 + eoIndex ID = 239 + eo001Index ID = 240 + esIndex ID = 241 + es419Index ID = 242 + esARIndex ID = 243 + esBOIndex ID = 244 + esBRIndex ID = 245 + esBZIndex ID = 246 + esCLIndex ID = 247 + esCOIndex ID = 248 + esCRIndex ID = 249 + esCUIndex ID = 250 + esDOIndex ID = 251 + esEAIndex ID = 252 + esECIndex ID = 253 + esESIndex ID = 254 + esGQIndex ID = 255 + esGTIndex ID = 256 + esHNIndex ID = 257 + esICIndex ID = 258 + esMXIndex ID = 259 + esNIIndex ID = 260 + esPAIndex ID = 261 + esPEIndex ID = 262 + esPHIndex ID = 263 + esPRIndex ID = 264 + esPYIndex ID = 265 + esSVIndex ID = 266 + esUSIndex ID = 267 + esUYIndex ID = 268 + esVEIndex ID = 269 + etIndex ID = 270 + etEEIndex ID = 271 + euIndex ID = 272 + euESIndex ID = 273 + ewoIndex ID = 274 + ewoCMIndex ID = 275 + faIndex ID = 276 + faAFIndex ID = 277 + faIRIndex ID = 278 + ffIndex ID = 279 + ffCMIndex ID = 280 + ffGNIndex ID = 281 + ffMRIndex ID = 282 + ffSNIndex ID = 283 + fiIndex ID = 284 + fiFIIndex ID = 285 + filIndex ID = 286 + filPHIndex ID = 287 + foIndex ID = 288 + foDKIndex ID = 289 + foFOIndex ID = 290 + frIndex ID = 291 + frBEIndex ID = 292 + frBFIndex ID = 293 + frBIIndex ID = 294 + frBJIndex ID = 295 + frBLIndex ID = 296 + frCAIndex ID = 297 + frCDIndex ID = 298 + frCFIndex ID = 299 + frCGIndex ID = 300 + frCHIndex ID = 301 + frCIIndex ID = 302 + frCMIndex ID = 303 + frDJIndex ID = 304 + frDZIndex ID = 305 + frFRIndex ID = 306 + frGAIndex ID = 307 + frGFIndex ID = 308 + frGNIndex ID = 309 + frGPIndex ID = 310 + frGQIndex ID = 311 + frHTIndex ID = 312 + frKMIndex ID = 313 + frLUIndex ID = 314 + frMAIndex ID = 315 + frMCIndex ID = 316 + frMFIndex ID = 317 + frMGIndex ID = 318 + frMLIndex ID = 319 + frMQIndex ID = 320 + frMRIndex ID = 321 + frMUIndex ID = 322 + frNCIndex ID = 323 + frNEIndex ID = 324 + frPFIndex ID = 325 + frPMIndex ID = 326 + frREIndex ID = 327 + frRWIndex ID = 328 + frSCIndex ID = 329 + frSNIndex ID = 330 + frSYIndex ID = 331 + frTDIndex ID = 332 + frTGIndex ID = 333 + frTNIndex ID = 334 + frVUIndex ID = 335 + frWFIndex ID = 336 + frYTIndex ID = 337 + furIndex ID = 338 + furITIndex ID = 339 + fyIndex ID = 340 + fyNLIndex ID = 341 + gaIndex ID = 342 + gaIEIndex ID = 343 + gdIndex ID = 344 + gdGBIndex ID = 345 + glIndex ID = 346 + glESIndex ID = 347 + gswIndex ID = 348 + gswCHIndex ID = 349 + gswFRIndex ID = 350 + gswLIIndex ID = 351 + guIndex ID = 352 + guINIndex ID = 353 + guwIndex ID = 354 + guzIndex ID = 355 + guzKEIndex ID = 356 + gvIndex ID = 357 + gvIMIndex ID = 358 + haIndex ID = 359 + haGHIndex ID = 360 + haNEIndex ID = 361 + haNGIndex ID = 362 + hawIndex ID = 363 + hawUSIndex ID = 364 + heIndex ID = 365 + heILIndex ID = 366 + hiIndex ID = 367 + hiINIndex ID = 368 + hrIndex ID = 369 + hrBAIndex ID = 370 + hrHRIndex ID = 371 + hsbIndex ID = 372 + hsbDEIndex ID = 373 + huIndex ID = 374 + huHUIndex ID = 375 + hyIndex ID = 376 + hyAMIndex ID = 377 + idIndex ID = 378 + idIDIndex ID = 379 + igIndex ID = 380 + igNGIndex ID = 381 + iiIndex ID = 382 + iiCNIndex ID = 383 + inIndex ID = 384 + ioIndex ID = 385 + isIndex ID = 386 + isISIndex ID = 387 + itIndex ID = 388 + itCHIndex ID = 389 + itITIndex ID = 390 + itSMIndex ID = 391 + itVAIndex ID = 392 + iuIndex ID = 393 + iwIndex ID = 394 + jaIndex ID = 395 + jaJPIndex ID = 396 + jboIndex ID = 397 + jgoIndex ID = 398 + jgoCMIndex ID = 399 + jiIndex ID = 400 + jmcIndex ID = 401 + jmcTZIndex ID = 402 + jvIndex ID = 403 + jwIndex ID = 404 + kaIndex ID = 405 + kaGEIndex ID = 406 + kabIndex ID = 407 + kabDZIndex ID = 408 + kajIndex ID = 409 + kamIndex ID = 410 + kamKEIndex ID = 411 + kcgIndex ID = 412 + kdeIndex ID = 413 + kdeTZIndex ID = 414 + keaIndex ID = 415 + keaCVIndex ID = 416 + khqIndex ID = 417 + khqMLIndex ID = 418 + kiIndex ID = 419 + kiKEIndex ID = 420 + kkIndex ID = 421 + kkKZIndex ID = 422 + kkjIndex ID = 423 + kkjCMIndex ID = 424 + klIndex ID = 425 + klGLIndex ID = 426 + klnIndex ID = 427 + klnKEIndex ID = 428 + kmIndex ID = 429 + kmKHIndex ID = 430 + knIndex ID = 431 + knINIndex ID = 432 + koIndex ID = 433 + koKPIndex ID = 434 + koKRIndex ID = 435 + kokIndex ID = 436 + kokINIndex ID = 437 + ksIndex ID = 438 + ksINIndex ID = 439 + ksbIndex ID = 440 + ksbTZIndex ID = 441 + ksfIndex ID = 442 + ksfCMIndex ID = 443 + kshIndex ID = 444 + kshDEIndex ID = 445 + kuIndex ID = 446 + kwIndex ID = 447 + kwGBIndex ID = 448 + kyIndex ID = 449 + kyKGIndex ID = 450 + lagIndex ID = 451 + lagTZIndex ID = 452 + lbIndex ID = 453 + lbLUIndex ID = 454 + lgIndex ID = 455 + lgUGIndex ID = 456 + lktIndex ID = 457 + lktUSIndex ID = 458 + lnIndex ID = 459 + lnAOIndex ID = 460 + lnCDIndex ID = 461 + lnCFIndex ID = 462 + lnCGIndex ID = 463 + loIndex ID = 464 + loLAIndex ID = 465 + lrcIndex ID = 466 + lrcIQIndex ID = 467 + lrcIRIndex ID = 468 + ltIndex ID = 469 + ltLTIndex ID = 470 + luIndex ID = 471 + luCDIndex ID = 472 + luoIndex ID = 473 + luoKEIndex ID = 474 + luyIndex ID = 475 + luyKEIndex ID = 476 + lvIndex ID = 477 + lvLVIndex ID = 478 + masIndex ID = 479 + masKEIndex ID = 480 + masTZIndex ID = 481 + merIndex ID = 482 + merKEIndex ID = 483 + mfeIndex ID = 484 + mfeMUIndex ID = 485 + mgIndex ID = 486 + mgMGIndex ID = 487 + mghIndex ID = 488 + mghMZIndex ID = 489 + mgoIndex ID = 490 + mgoCMIndex ID = 491 + mkIndex ID = 492 + mkMKIndex ID = 493 + mlIndex ID = 494 + mlINIndex ID = 495 + mnIndex ID = 496 + mnMNIndex ID = 497 + moIndex ID = 498 + mrIndex ID = 499 + mrINIndex ID = 500 + msIndex ID = 501 + msBNIndex ID = 502 + msMYIndex ID = 503 + msSGIndex ID = 504 + mtIndex ID = 505 + mtMTIndex ID = 506 + muaIndex ID = 507 + muaCMIndex ID = 508 + myIndex ID = 509 + myMMIndex ID = 510 + mznIndex ID = 511 + mznIRIndex ID = 512 + nahIndex ID = 513 + naqIndex ID = 514 + naqNAIndex ID = 515 + nbIndex ID = 516 + nbNOIndex ID = 517 + nbSJIndex ID = 518 + ndIndex ID = 519 + ndZWIndex ID = 520 + ndsIndex ID = 521 + ndsDEIndex ID = 522 + ndsNLIndex ID = 523 + neIndex ID = 524 + neINIndex ID = 525 + neNPIndex ID = 526 + nlIndex ID = 527 + nlAWIndex ID = 528 + nlBEIndex ID = 529 + nlBQIndex ID = 530 + nlCWIndex ID = 531 + nlNLIndex ID = 532 + nlSRIndex ID = 533 + nlSXIndex ID = 534 + nmgIndex ID = 535 + nmgCMIndex ID = 536 + nnIndex ID = 537 + nnNOIndex ID = 538 + nnhIndex ID = 539 + nnhCMIndex ID = 540 + noIndex ID = 541 + nqoIndex ID = 542 + nrIndex ID = 543 + nsoIndex ID = 544 + nusIndex ID = 545 + nusSSIndex ID = 546 + nyIndex ID = 547 + nynIndex ID = 548 + nynUGIndex ID = 549 + omIndex ID = 550 + omETIndex ID = 551 + omKEIndex ID = 552 + orIndex ID = 553 + orINIndex ID = 554 + osIndex ID = 555 + osGEIndex ID = 556 + osRUIndex ID = 557 + paIndex ID = 558 + paArabIndex ID = 559 + paArabPKIndex ID = 560 + paGuruIndex ID = 561 + paGuruINIndex ID = 562 + papIndex ID = 563 + plIndex ID = 564 + plPLIndex ID = 565 + prgIndex ID = 566 + prg001Index ID = 567 + psIndex ID = 568 + psAFIndex ID = 569 + ptIndex ID = 570 + ptAOIndex ID = 571 + ptBRIndex ID = 572 + ptCHIndex ID = 573 + ptCVIndex ID = 574 + ptGQIndex ID = 575 + ptGWIndex ID = 576 + ptLUIndex ID = 577 + ptMOIndex ID = 578 + ptMZIndex ID = 579 + ptPTIndex ID = 580 + ptSTIndex ID = 581 + ptTLIndex ID = 582 + quIndex ID = 583 + quBOIndex ID = 584 + quECIndex ID = 585 + quPEIndex ID = 586 + rmIndex ID = 587 + rmCHIndex ID = 588 + rnIndex ID = 589 + rnBIIndex ID = 590 + roIndex ID = 591 + roMDIndex ID = 592 + roROIndex ID = 593 + rofIndex ID = 594 + rofTZIndex ID = 595 + ruIndex ID = 596 + ruBYIndex ID = 597 + ruKGIndex ID = 598 + ruKZIndex ID = 599 + ruMDIndex ID = 600 + ruRUIndex ID = 601 + ruUAIndex ID = 602 + rwIndex ID = 603 + rwRWIndex ID = 604 + rwkIndex ID = 605 + rwkTZIndex ID = 606 + sahIndex ID = 607 + sahRUIndex ID = 608 + saqIndex ID = 609 + saqKEIndex ID = 610 + sbpIndex ID = 611 + sbpTZIndex ID = 612 + sdIndex ID = 613 + sdPKIndex ID = 614 + sdhIndex ID = 615 + seIndex ID = 616 + seFIIndex ID = 617 + seNOIndex ID = 618 + seSEIndex ID = 619 + sehIndex ID = 620 + sehMZIndex ID = 621 + sesIndex ID = 622 + sesMLIndex ID = 623 + sgIndex ID = 624 + sgCFIndex ID = 625 + shIndex ID = 626 + shiIndex ID = 627 + shiLatnIndex ID = 628 + shiLatnMAIndex ID = 629 + shiTfngIndex ID = 630 + shiTfngMAIndex ID = 631 + siIndex ID = 632 + siLKIndex ID = 633 + skIndex ID = 634 + skSKIndex ID = 635 + slIndex ID = 636 + slSIIndex ID = 637 + smaIndex ID = 638 + smiIndex ID = 639 + smjIndex ID = 640 + smnIndex ID = 641 + smnFIIndex ID = 642 + smsIndex ID = 643 + snIndex ID = 644 + snZWIndex ID = 645 + soIndex ID = 646 + soDJIndex ID = 647 + soETIndex ID = 648 + soKEIndex ID = 649 + soSOIndex ID = 650 + sqIndex ID = 651 + sqALIndex ID = 652 + sqMKIndex ID = 653 + sqXKIndex ID = 654 + srIndex ID = 655 + srCyrlIndex ID = 656 + srCyrlBAIndex ID = 657 + srCyrlMEIndex ID = 658 + srCyrlRSIndex ID = 659 + srCyrlXKIndex ID = 660 + srLatnIndex ID = 661 + srLatnBAIndex ID = 662 + srLatnMEIndex ID = 663 + srLatnRSIndex ID = 664 + srLatnXKIndex ID = 665 + ssIndex ID = 666 + ssyIndex ID = 667 + stIndex ID = 668 + svIndex ID = 669 + svAXIndex ID = 670 + svFIIndex ID = 671 + svSEIndex ID = 672 + swIndex ID = 673 + swCDIndex ID = 674 + swKEIndex ID = 675 + swTZIndex ID = 676 + swUGIndex ID = 677 + syrIndex ID = 678 + taIndex ID = 679 + taINIndex ID = 680 + taLKIndex ID = 681 + taMYIndex ID = 682 + taSGIndex ID = 683 + teIndex ID = 684 + teINIndex ID = 685 + teoIndex ID = 686 + teoKEIndex ID = 687 + teoUGIndex ID = 688 + tgIndex ID = 689 + tgTJIndex ID = 690 + thIndex ID = 691 + thTHIndex ID = 692 + tiIndex ID = 693 + tiERIndex ID = 694 + tiETIndex ID = 695 + tigIndex ID = 696 + tkIndex ID = 697 + tkTMIndex ID = 698 + tlIndex ID = 699 + tnIndex ID = 700 + toIndex ID = 701 + toTOIndex ID = 702 + trIndex ID = 703 + trCYIndex ID = 704 + trTRIndex ID = 705 + tsIndex ID = 706 + ttIndex ID = 707 + ttRUIndex ID = 708 + twqIndex ID = 709 + twqNEIndex ID = 710 + tzmIndex ID = 711 + tzmMAIndex ID = 712 + ugIndex ID = 713 + ugCNIndex ID = 714 + ukIndex ID = 715 + ukUAIndex ID = 716 + urIndex ID = 717 + urINIndex ID = 718 + urPKIndex ID = 719 + uzIndex ID = 720 + uzArabIndex ID = 721 + uzArabAFIndex ID = 722 + uzCyrlIndex ID = 723 + uzCyrlUZIndex ID = 724 + uzLatnIndex ID = 725 + uzLatnUZIndex ID = 726 + vaiIndex ID = 727 + vaiLatnIndex ID = 728 + vaiLatnLRIndex ID = 729 + vaiVaiiIndex ID = 730 + vaiVaiiLRIndex ID = 731 + veIndex ID = 732 + viIndex ID = 733 + viVNIndex ID = 734 + voIndex ID = 735 + vo001Index ID = 736 + vunIndex ID = 737 + vunTZIndex ID = 738 + waIndex ID = 739 + waeIndex ID = 740 + waeCHIndex ID = 741 + woIndex ID = 742 + woSNIndex ID = 743 + xhIndex ID = 744 + xogIndex ID = 745 + xogUGIndex ID = 746 + yavIndex ID = 747 + yavCMIndex ID = 748 + yiIndex ID = 749 + yi001Index ID = 750 + yoIndex ID = 751 + yoBJIndex ID = 752 + yoNGIndex ID = 753 + yueIndex ID = 754 + yueHansIndex ID = 755 + yueHansCNIndex ID = 756 + yueHantIndex ID = 757 + yueHantHKIndex ID = 758 + zghIndex ID = 759 + zghMAIndex ID = 760 + zhIndex ID = 761 + zhHansIndex ID = 762 + zhHansCNIndex ID = 763 + zhHansHKIndex ID = 764 + zhHansMOIndex ID = 765 + zhHansSGIndex ID = 766 + zhHantIndex ID = 767 + zhHantHKIndex ID = 768 + zhHantMOIndex ID = 769 + zhHantTWIndex ID = 770 + zuIndex ID = 771 + zuZAIndex ID = 772 + caESvalenciaIndex ID = 773 + enUSuvaposixIndex ID = 774 +) + +var coreTags = []language.CompactCoreInfo{ // 773 elements + // Entry 0 - 1F + 0x00000000, 0x01600000, 0x016000d2, 0x01600161, + 0x01c00000, 0x01c00052, 0x02100000, 0x02100080, + 0x02700000, 0x0270006f, 0x03a00000, 0x03a00001, + 0x03a00023, 0x03a00039, 0x03a00062, 0x03a00067, + 0x03a0006b, 0x03a0006c, 0x03a0006d, 0x03a00097, + 0x03a0009b, 0x03a000a1, 0x03a000a8, 0x03a000ac, + 0x03a000b0, 0x03a000b9, 0x03a000ba, 0x03a000c9, + 0x03a000e1, 0x03a000ed, 0x03a000f3, 0x03a00108, + // Entry 20 - 3F + 0x03a0010b, 0x03a00115, 0x03a00117, 0x03a0011c, + 0x03a00120, 0x03a00128, 0x03a0015e, 0x04000000, + 0x04300000, 0x04300099, 0x04400000, 0x0440012f, + 0x04800000, 0x0480006e, 0x05800000, 0x05820000, + 0x05820032, 0x0585a000, 0x0585a032, 0x05e00000, + 0x05e00052, 0x07100000, 0x07100047, 0x07500000, + 0x07500162, 0x07900000, 0x0790012f, 0x07e00000, + 0x07e00038, 0x08200000, 0x0a000000, 0x0a0000c3, + // Entry 40 - 5F + 0x0a500000, 0x0a500035, 0x0a500099, 0x0a900000, + 0x0a900053, 0x0a900099, 0x0b200000, 0x0b200078, + 0x0b500000, 0x0b500099, 0x0b700000, 0x0b720000, + 0x0b720033, 0x0b75a000, 0x0b75a033, 0x0d700000, + 0x0d700022, 0x0d70006e, 0x0d700078, 0x0d70009e, + 0x0db00000, 0x0db00035, 0x0db00099, 0x0dc00000, + 0x0dc00106, 0x0df00000, 0x0df00131, 0x0e500000, + 0x0e500135, 0x0e900000, 0x0e90009b, 0x0e90009c, + // Entry 60 - 7F + 0x0fa00000, 0x0fa0005e, 0x0fe00000, 0x0fe00106, + 0x10000000, 0x1000007b, 0x10100000, 0x10100063, + 0x10100082, 0x10800000, 0x108000a4, 0x10d00000, + 0x10d0002e, 0x10d00036, 0x10d0004e, 0x10d00060, + 0x10d0009e, 0x10d000b2, 0x10d000b7, 0x11700000, + 0x117000d4, 0x11f00000, 0x11f00060, 0x12400000, + 0x12400052, 0x12800000, 0x12b00000, 0x12b00114, + 0x12d00000, 0x12d00043, 0x12f00000, 0x12f000a4, + // Entry 80 - 9F + 0x13000000, 0x13000080, 0x13000122, 0x13600000, + 0x1360005d, 0x13600087, 0x13900000, 0x13900001, + 0x1390001a, 0x13900025, 0x13900026, 0x1390002d, + 0x1390002e, 0x1390002f, 0x13900034, 0x13900036, + 0x1390003a, 0x1390003d, 0x13900042, 0x13900046, + 0x13900048, 0x13900049, 0x1390004a, 0x1390004e, + 0x13900050, 0x13900052, 0x1390005c, 0x1390005d, + 0x13900060, 0x13900061, 0x13900063, 0x13900064, + // Entry A0 - BF + 0x1390006d, 0x13900072, 0x13900073, 0x13900074, + 0x13900075, 0x1390007b, 0x1390007c, 0x1390007f, + 0x13900080, 0x13900081, 0x13900083, 0x1390008a, + 0x1390008c, 0x1390008d, 0x13900096, 0x13900097, + 0x13900098, 0x13900099, 0x1390009a, 0x1390009f, + 0x139000a0, 0x139000a4, 0x139000a7, 0x139000a9, + 0x139000ad, 0x139000b1, 0x139000b4, 0x139000b5, + 0x139000bf, 0x139000c0, 0x139000c6, 0x139000c7, + // Entry C0 - DF + 0x139000ca, 0x139000cb, 0x139000cc, 0x139000ce, + 0x139000d0, 0x139000d2, 0x139000d5, 0x139000d6, + 0x139000d9, 0x139000dd, 0x139000df, 0x139000e0, + 0x139000e6, 0x139000e7, 0x139000e8, 0x139000eb, + 0x139000ec, 0x139000f0, 0x13900107, 0x13900109, + 0x1390010a, 0x1390010b, 0x1390010c, 0x1390010d, + 0x1390010e, 0x1390010f, 0x13900112, 0x13900117, + 0x1390011b, 0x1390011d, 0x1390011f, 0x13900125, + // Entry E0 - FF + 0x13900129, 0x1390012c, 0x1390012d, 0x1390012f, + 0x13900131, 0x13900133, 0x13900135, 0x13900139, + 0x1390013c, 0x1390013d, 0x1390013f, 0x13900142, + 0x13900161, 0x13900162, 0x13900164, 0x13c00000, + 0x13c00001, 0x13e00000, 0x13e0001f, 0x13e0002c, + 0x13e0003f, 0x13e00041, 0x13e00048, 0x13e00051, + 0x13e00054, 0x13e00056, 0x13e00059, 0x13e00065, + 0x13e00068, 0x13e00069, 0x13e0006e, 0x13e00086, + // Entry 100 - 11F + 0x13e00089, 0x13e0008f, 0x13e00094, 0x13e000cf, + 0x13e000d8, 0x13e000e2, 0x13e000e4, 0x13e000e7, + 0x13e000ec, 0x13e000f1, 0x13e0011a, 0x13e00135, + 0x13e00136, 0x13e0013b, 0x14000000, 0x1400006a, + 0x14500000, 0x1450006e, 0x14600000, 0x14600052, + 0x14800000, 0x14800024, 0x1480009c, 0x14e00000, + 0x14e00052, 0x14e00084, 0x14e000c9, 0x14e00114, + 0x15100000, 0x15100072, 0x15300000, 0x153000e7, + // Entry 120 - 13F + 0x15800000, 0x15800063, 0x15800076, 0x15e00000, + 0x15e00036, 0x15e00037, 0x15e0003a, 0x15e0003b, + 0x15e0003c, 0x15e00049, 0x15e0004b, 0x15e0004c, + 0x15e0004d, 0x15e0004e, 0x15e0004f, 0x15e00052, + 0x15e00062, 0x15e00067, 0x15e00078, 0x15e0007a, + 0x15e0007e, 0x15e00084, 0x15e00085, 0x15e00086, + 0x15e00091, 0x15e000a8, 0x15e000b7, 0x15e000ba, + 0x15e000bb, 0x15e000be, 0x15e000bf, 0x15e000c3, + // Entry 140 - 15F + 0x15e000c8, 0x15e000c9, 0x15e000cc, 0x15e000d3, + 0x15e000d4, 0x15e000e5, 0x15e000ea, 0x15e00102, + 0x15e00107, 0x15e0010a, 0x15e00114, 0x15e0011c, + 0x15e00120, 0x15e00122, 0x15e00128, 0x15e0013f, + 0x15e00140, 0x15e0015f, 0x16900000, 0x1690009e, + 0x16d00000, 0x16d000d9, 0x16e00000, 0x16e00096, + 0x17e00000, 0x17e0007b, 0x19000000, 0x1900006e, + 0x1a300000, 0x1a30004e, 0x1a300078, 0x1a3000b2, + // Entry 160 - 17F + 0x1a400000, 0x1a400099, 0x1a900000, 0x1ab00000, + 0x1ab000a4, 0x1ac00000, 0x1ac00098, 0x1b400000, + 0x1b400080, 0x1b4000d4, 0x1b4000d6, 0x1b800000, + 0x1b800135, 0x1bc00000, 0x1bc00097, 0x1be00000, + 0x1be00099, 0x1d100000, 0x1d100033, 0x1d100090, + 0x1d200000, 0x1d200060, 0x1d500000, 0x1d500092, + 0x1d700000, 0x1d700028, 0x1e100000, 0x1e100095, + 0x1e700000, 0x1e7000d6, 0x1ea00000, 0x1ea00053, + // Entry 180 - 19F + 0x1f300000, 0x1f500000, 0x1f800000, 0x1f80009d, + 0x1f900000, 0x1f90004e, 0x1f90009e, 0x1f900113, + 0x1f900138, 0x1fa00000, 0x1fb00000, 0x20000000, + 0x200000a2, 0x20300000, 0x20700000, 0x20700052, + 0x20800000, 0x20a00000, 0x20a0012f, 0x20e00000, + 0x20f00000, 0x21000000, 0x2100007d, 0x21200000, + 0x21200067, 0x21600000, 0x21700000, 0x217000a4, + 0x21f00000, 0x22300000, 0x2230012f, 0x22700000, + // Entry 1A0 - 1BF + 0x2270005a, 0x23400000, 0x234000c3, 0x23900000, + 0x239000a4, 0x24200000, 0x242000ae, 0x24400000, + 0x24400052, 0x24500000, 0x24500082, 0x24600000, + 0x246000a4, 0x24a00000, 0x24a000a6, 0x25100000, + 0x25100099, 0x25400000, 0x254000aa, 0x254000ab, + 0x25600000, 0x25600099, 0x26a00000, 0x26a00099, + 0x26b00000, 0x26b0012f, 0x26d00000, 0x26d00052, + 0x26e00000, 0x26e00060, 0x27400000, 0x28100000, + // Entry 1C0 - 1DF + 0x2810007b, 0x28a00000, 0x28a000a5, 0x29100000, + 0x2910012f, 0x29500000, 0x295000b7, 0x2a300000, + 0x2a300131, 0x2af00000, 0x2af00135, 0x2b500000, + 0x2b50002a, 0x2b50004b, 0x2b50004c, 0x2b50004d, + 0x2b800000, 0x2b8000af, 0x2bf00000, 0x2bf0009b, + 0x2bf0009c, 0x2c000000, 0x2c0000b6, 0x2c200000, + 0x2c20004b, 0x2c400000, 0x2c4000a4, 0x2c500000, + 0x2c5000a4, 0x2c700000, 0x2c7000b8, 0x2d100000, + // Entry 1E0 - 1FF + 0x2d1000a4, 0x2d10012f, 0x2e900000, 0x2e9000a4, + 0x2ed00000, 0x2ed000cc, 0x2f100000, 0x2f1000bf, + 0x2f200000, 0x2f2000d1, 0x2f400000, 0x2f400052, + 0x2ff00000, 0x2ff000c2, 0x30400000, 0x30400099, + 0x30b00000, 0x30b000c5, 0x31000000, 0x31b00000, + 0x31b00099, 0x31f00000, 0x31f0003e, 0x31f000d0, + 0x31f0010d, 0x32000000, 0x320000cb, 0x32500000, + 0x32500052, 0x33100000, 0x331000c4, 0x33a00000, + // Entry 200 - 21F + 0x33a0009c, 0x34100000, 0x34500000, 0x345000d2, + 0x34700000, 0x347000da, 0x34700110, 0x34e00000, + 0x34e00164, 0x35000000, 0x35000060, 0x350000d9, + 0x35100000, 0x35100099, 0x351000db, 0x36700000, + 0x36700030, 0x36700036, 0x36700040, 0x3670005b, + 0x367000d9, 0x36700116, 0x3670011b, 0x36800000, + 0x36800052, 0x36a00000, 0x36a000da, 0x36c00000, + 0x36c00052, 0x36f00000, 0x37500000, 0x37600000, + // Entry 220 - 23F + 0x37a00000, 0x38000000, 0x38000117, 0x38700000, + 0x38900000, 0x38900131, 0x39000000, 0x3900006f, + 0x390000a4, 0x39500000, 0x39500099, 0x39800000, + 0x3980007d, 0x39800106, 0x39d00000, 0x39d05000, + 0x39d050e8, 0x39d36000, 0x39d36099, 0x3a100000, + 0x3b300000, 0x3b3000e9, 0x3bd00000, 0x3bd00001, + 0x3be00000, 0x3be00024, 0x3c000000, 0x3c00002a, + 0x3c000041, 0x3c00004e, 0x3c00005a, 0x3c000086, + // Entry 240 - 25F + 0x3c00008b, 0x3c0000b7, 0x3c0000c6, 0x3c0000d1, + 0x3c0000ee, 0x3c000118, 0x3c000126, 0x3c400000, + 0x3c40003f, 0x3c400069, 0x3c4000e4, 0x3d400000, + 0x3d40004e, 0x3d900000, 0x3d90003a, 0x3dc00000, + 0x3dc000bc, 0x3dc00104, 0x3de00000, 0x3de0012f, + 0x3e200000, 0x3e200047, 0x3e2000a5, 0x3e2000ae, + 0x3e2000bc, 0x3e200106, 0x3e200130, 0x3e500000, + 0x3e500107, 0x3e600000, 0x3e60012f, 0x3eb00000, + // Entry 260 - 27F + 0x3eb00106, 0x3ec00000, 0x3ec000a4, 0x3f300000, + 0x3f30012f, 0x3fa00000, 0x3fa000e8, 0x3fc00000, + 0x3fd00000, 0x3fd00072, 0x3fd000da, 0x3fd0010c, + 0x3ff00000, 0x3ff000d1, 0x40100000, 0x401000c3, + 0x40200000, 0x4020004c, 0x40700000, 0x40800000, + 0x4085a000, 0x4085a0ba, 0x408e8000, 0x408e80ba, + 0x40c00000, 0x40c000b3, 0x41200000, 0x41200111, + 0x41600000, 0x4160010f, 0x41c00000, 0x41d00000, + // Entry 280 - 29F + 0x41e00000, 0x41f00000, 0x41f00072, 0x42200000, + 0x42300000, 0x42300164, 0x42900000, 0x42900062, + 0x4290006f, 0x429000a4, 0x42900115, 0x43100000, + 0x43100027, 0x431000c2, 0x4310014d, 0x43200000, + 0x43220000, 0x43220033, 0x432200bd, 0x43220105, + 0x4322014d, 0x4325a000, 0x4325a033, 0x4325a0bd, + 0x4325a105, 0x4325a14d, 0x43700000, 0x43a00000, + 0x43b00000, 0x44400000, 0x44400031, 0x44400072, + // Entry 2A0 - 2BF + 0x4440010c, 0x44500000, 0x4450004b, 0x445000a4, + 0x4450012f, 0x44500131, 0x44e00000, 0x45000000, + 0x45000099, 0x450000b3, 0x450000d0, 0x4500010d, + 0x46100000, 0x46100099, 0x46400000, 0x464000a4, + 0x46400131, 0x46700000, 0x46700124, 0x46b00000, + 0x46b00123, 0x46f00000, 0x46f0006d, 0x46f0006f, + 0x47100000, 0x47600000, 0x47600127, 0x47a00000, + 0x48000000, 0x48200000, 0x48200129, 0x48a00000, + // Entry 2C0 - 2DF + 0x48a0005d, 0x48a0012b, 0x48e00000, 0x49400000, + 0x49400106, 0x4a400000, 0x4a4000d4, 0x4a900000, + 0x4a9000ba, 0x4ac00000, 0x4ac00053, 0x4ae00000, + 0x4ae00130, 0x4b400000, 0x4b400099, 0x4b4000e8, + 0x4bc00000, 0x4bc05000, 0x4bc05024, 0x4bc20000, + 0x4bc20137, 0x4bc5a000, 0x4bc5a137, 0x4be00000, + 0x4be5a000, 0x4be5a0b4, 0x4bef1000, 0x4bef10b4, + 0x4c000000, 0x4c300000, 0x4c30013e, 0x4c900000, + // Entry 2E0 - 2FF + 0x4c900001, 0x4cc00000, 0x4cc0012f, 0x4ce00000, + 0x4cf00000, 0x4cf0004e, 0x4e500000, 0x4e500114, + 0x4f200000, 0x4fb00000, 0x4fb00131, 0x50900000, + 0x50900052, 0x51200000, 0x51200001, 0x51800000, + 0x5180003b, 0x518000d6, 0x51f00000, 0x51f3b000, + 0x51f3b053, 0x51f3c000, 0x51f3c08d, 0x52800000, + 0x528000ba, 0x52900000, 0x5293b000, 0x5293b053, + 0x5293b08d, 0x5293b0c6, 0x5293b10d, 0x5293c000, + // Entry 300 - 31F + 0x5293c08d, 0x5293c0c6, 0x5293c12e, 0x52f00000, + 0x52f00161, +} // Size: 3116 bytes + +const specialTagsStr string = "ca-ES-valencia en-US-u-va-posix" + +// Total table size 3147 bytes (3KiB); checksum: 6772C83C diff --git a/vendor/golang.org/x/text/internal/language/compact/tags.go b/vendor/golang.org/x/text/internal/language/compact/tags.go new file mode 100644 index 00000000..ca135d29 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compact/tags.go @@ -0,0 +1,91 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package compact + +var ( + und = Tag{} + + Und Tag = Tag{} + + Afrikaans Tag = Tag{language: afIndex, locale: afIndex} + Amharic Tag = Tag{language: amIndex, locale: amIndex} + Arabic Tag = Tag{language: arIndex, locale: arIndex} + ModernStandardArabic Tag = Tag{language: ar001Index, locale: ar001Index} + Azerbaijani Tag = Tag{language: azIndex, locale: azIndex} + Bulgarian Tag = Tag{language: bgIndex, locale: bgIndex} + Bengali Tag = Tag{language: bnIndex, locale: bnIndex} + Catalan Tag = Tag{language: caIndex, locale: caIndex} + Czech Tag = Tag{language: csIndex, locale: csIndex} + Danish Tag = Tag{language: daIndex, locale: daIndex} + German Tag = Tag{language: deIndex, locale: deIndex} + Greek Tag = Tag{language: elIndex, locale: elIndex} + English Tag = Tag{language: enIndex, locale: enIndex} + AmericanEnglish Tag = Tag{language: enUSIndex, locale: enUSIndex} + BritishEnglish Tag = Tag{language: enGBIndex, locale: enGBIndex} + Spanish Tag = Tag{language: esIndex, locale: esIndex} + EuropeanSpanish Tag = Tag{language: esESIndex, locale: esESIndex} + LatinAmericanSpanish Tag = Tag{language: es419Index, locale: es419Index} + Estonian Tag = Tag{language: etIndex, locale: etIndex} + Persian Tag = Tag{language: faIndex, locale: faIndex} + Finnish Tag = Tag{language: fiIndex, locale: fiIndex} + Filipino Tag = Tag{language: filIndex, locale: filIndex} + French Tag = Tag{language: frIndex, locale: frIndex} + CanadianFrench Tag = Tag{language: frCAIndex, locale: frCAIndex} + Gujarati Tag = Tag{language: guIndex, locale: guIndex} + Hebrew Tag = Tag{language: heIndex, locale: heIndex} + Hindi Tag = Tag{language: hiIndex, locale: hiIndex} + Croatian Tag = Tag{language: hrIndex, locale: hrIndex} + Hungarian Tag = Tag{language: huIndex, locale: huIndex} + Armenian Tag = Tag{language: hyIndex, locale: hyIndex} + Indonesian Tag = Tag{language: idIndex, locale: idIndex} + Icelandic Tag = Tag{language: isIndex, locale: isIndex} + Italian Tag = Tag{language: itIndex, locale: itIndex} + Japanese Tag = Tag{language: jaIndex, locale: jaIndex} + Georgian Tag = Tag{language: kaIndex, locale: kaIndex} + Kazakh Tag = Tag{language: kkIndex, locale: kkIndex} + Khmer Tag = Tag{language: kmIndex, locale: kmIndex} + Kannada Tag = Tag{language: knIndex, locale: knIndex} + Korean Tag = Tag{language: koIndex, locale: koIndex} + Kirghiz Tag = Tag{language: kyIndex, locale: kyIndex} + Lao Tag = Tag{language: loIndex, locale: loIndex} + Lithuanian Tag = Tag{language: ltIndex, locale: ltIndex} + Latvian Tag = Tag{language: lvIndex, locale: lvIndex} + Macedonian Tag = Tag{language: mkIndex, locale: mkIndex} + Malayalam Tag = Tag{language: mlIndex, locale: mlIndex} + Mongolian Tag = Tag{language: mnIndex, locale: mnIndex} + Marathi Tag = Tag{language: mrIndex, locale: mrIndex} + Malay Tag = Tag{language: msIndex, locale: msIndex} + Burmese Tag = Tag{language: myIndex, locale: myIndex} + Nepali Tag = Tag{language: neIndex, locale: neIndex} + Dutch Tag = Tag{language: nlIndex, locale: nlIndex} + Norwegian Tag = Tag{language: noIndex, locale: noIndex} + Punjabi Tag = Tag{language: paIndex, locale: paIndex} + Polish Tag = Tag{language: plIndex, locale: plIndex} + Portuguese Tag = Tag{language: ptIndex, locale: ptIndex} + BrazilianPortuguese Tag = Tag{language: ptBRIndex, locale: ptBRIndex} + EuropeanPortuguese Tag = Tag{language: ptPTIndex, locale: ptPTIndex} + Romanian Tag = Tag{language: roIndex, locale: roIndex} + Russian Tag = Tag{language: ruIndex, locale: ruIndex} + Sinhala Tag = Tag{language: siIndex, locale: siIndex} + Slovak Tag = Tag{language: skIndex, locale: skIndex} + Slovenian Tag = Tag{language: slIndex, locale: slIndex} + Albanian Tag = Tag{language: sqIndex, locale: sqIndex} + Serbian Tag = Tag{language: srIndex, locale: srIndex} + SerbianLatin Tag = Tag{language: srLatnIndex, locale: srLatnIndex} + Swedish Tag = Tag{language: svIndex, locale: svIndex} + Swahili Tag = Tag{language: swIndex, locale: swIndex} + Tamil Tag = Tag{language: taIndex, locale: taIndex} + Telugu Tag = Tag{language: teIndex, locale: teIndex} + Thai Tag = Tag{language: thIndex, locale: thIndex} + Turkish Tag = Tag{language: trIndex, locale: trIndex} + Ukrainian Tag = Tag{language: ukIndex, locale: ukIndex} + Urdu Tag = Tag{language: urIndex, locale: urIndex} + Uzbek Tag = Tag{language: uzIndex, locale: uzIndex} + Vietnamese Tag = Tag{language: viIndex, locale: viIndex} + Chinese Tag = Tag{language: zhIndex, locale: zhIndex} + SimplifiedChinese Tag = Tag{language: zhHansIndex, locale: zhHansIndex} + TraditionalChinese Tag = Tag{language: zhHantIndex, locale: zhHantIndex} + Zulu Tag = Tag{language: zuIndex, locale: zuIndex} +) diff --git a/vendor/golang.org/x/text/internal/language/compose.go b/vendor/golang.org/x/text/internal/language/compose.go new file mode 100644 index 00000000..4ae78e0f --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compose.go @@ -0,0 +1,167 @@ +// Copyright 2018 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import ( + "sort" + "strings" +) + +// A Builder allows constructing a Tag from individual components. +// Its main user is Compose in the top-level language package. +type Builder struct { + Tag Tag + + private string // the x extension + variants []string + extensions []string +} + +// Make returns a new Tag from the current settings. +func (b *Builder) Make() Tag { + t := b.Tag + + if len(b.extensions) > 0 || len(b.variants) > 0 { + sort.Sort(sortVariants(b.variants)) + sort.Strings(b.extensions) + + if b.private != "" { + b.extensions = append(b.extensions, b.private) + } + n := maxCoreSize + tokenLen(b.variants...) + tokenLen(b.extensions...) + buf := make([]byte, n) + p := t.genCoreBytes(buf) + t.pVariant = byte(p) + p += appendTokens(buf[p:], b.variants...) + t.pExt = uint16(p) + p += appendTokens(buf[p:], b.extensions...) + t.str = string(buf[:p]) + // We may not always need to remake the string, but when or when not + // to do so is rather tricky. + scan := makeScanner(buf[:p]) + t, _ = parse(&scan, "") + return t + + } else if b.private != "" { + t.str = b.private + t.RemakeString() + } + return t +} + +// SetTag copies all the settings from a given Tag. Any previously set values +// are discarded. +func (b *Builder) SetTag(t Tag) { + b.Tag.LangID = t.LangID + b.Tag.RegionID = t.RegionID + b.Tag.ScriptID = t.ScriptID + // TODO: optimize + b.variants = b.variants[:0] + if variants := t.Variants(); variants != "" { + for _, vr := range strings.Split(variants[1:], "-") { + b.variants = append(b.variants, vr) + } + } + b.extensions, b.private = b.extensions[:0], "" + for _, e := range t.Extensions() { + b.AddExt(e) + } +} + +// AddExt adds extension e to the tag. e must be a valid extension as returned +// by Tag.Extension. If the extension already exists, it will be discarded, +// except for a -u extension, where non-existing key-type pairs will added. +func (b *Builder) AddExt(e string) { + if e[0] == 'x' { + if b.private == "" { + b.private = e + } + return + } + for i, s := range b.extensions { + if s[0] == e[0] { + if e[0] == 'u' { + b.extensions[i] += e[1:] + } + return + } + } + b.extensions = append(b.extensions, e) +} + +// SetExt sets the extension e to the tag. e must be a valid extension as +// returned by Tag.Extension. If the extension already exists, it will be +// overwritten, except for a -u extension, where the individual key-type pairs +// will be set. +func (b *Builder) SetExt(e string) { + if e[0] == 'x' { + b.private = e + return + } + for i, s := range b.extensions { + if s[0] == e[0] { + if e[0] == 'u' { + b.extensions[i] = e + s[1:] + } else { + b.extensions[i] = e + } + return + } + } + b.extensions = append(b.extensions, e) +} + +// AddVariant adds any number of variants. +func (b *Builder) AddVariant(v ...string) { + for _, v := range v { + if v != "" { + b.variants = append(b.variants, v) + } + } +} + +// ClearVariants removes any variants previously added, including those +// copied from a Tag in SetTag. +func (b *Builder) ClearVariants() { + b.variants = b.variants[:0] +} + +// ClearExtensions removes any extensions previously added, including those +// copied from a Tag in SetTag. +func (b *Builder) ClearExtensions() { + b.private = "" + b.extensions = b.extensions[:0] +} + +func tokenLen(token ...string) (n int) { + for _, t := range token { + n += len(t) + 1 + } + return +} + +func appendTokens(b []byte, token ...string) int { + p := 0 + for _, t := range token { + b[p] = '-' + copy(b[p+1:], t) + p += 1 + len(t) + } + return p +} + +type sortVariants []string + +func (s sortVariants) Len() int { + return len(s) +} + +func (s sortVariants) Swap(i, j int) { + s[j], s[i] = s[i], s[j] +} + +func (s sortVariants) Less(i, j int) bool { + return variantIndex[s[i]] < variantIndex[s[j]] +} diff --git a/vendor/golang.org/x/text/internal/language/coverage.go b/vendor/golang.org/x/text/internal/language/coverage.go new file mode 100644 index 00000000..9b20b88f --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/coverage.go @@ -0,0 +1,28 @@ +// Copyright 2014 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +// BaseLanguages returns the list of all supported base languages. It generates +// the list by traversing the internal structures. +func BaseLanguages() []Language { + base := make([]Language, 0, NumLanguages) + for i := 0; i < langNoIndexOffset; i++ { + // We included "und" already for the value 0. + if i != nonCanonicalUnd { + base = append(base, Language(i)) + } + } + i := langNoIndexOffset + for _, v := range langNoIndex { + for k := 0; k < 8; k++ { + if v&1 == 1 { + base = append(base, Language(i)) + } + v >>= 1 + i++ + } + } + return base +} diff --git a/vendor/golang.org/x/text/internal/language/language.go b/vendor/golang.org/x/text/internal/language/language.go new file mode 100644 index 00000000..6105bc7f --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/language.go @@ -0,0 +1,627 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:generate go run gen.go gen_common.go -output tables.go + +package language // import "golang.org/x/text/internal/language" + +// TODO: Remove above NOTE after: +// - verifying that tables are dropped correctly (most notably matcher tables). + +import ( + "errors" + "fmt" + "strings" +) + +const ( + // maxCoreSize is the maximum size of a BCP 47 tag without variants and + // extensions. Equals max lang (3) + script (4) + max reg (3) + 2 dashes. + maxCoreSize = 12 + + // max99thPercentileSize is a somewhat arbitrary buffer size that presumably + // is large enough to hold at least 99% of the BCP 47 tags. + max99thPercentileSize = 32 + + // maxSimpleUExtensionSize is the maximum size of a -u extension with one + // key-type pair. Equals len("-u-") + key (2) + dash + max value (8). + maxSimpleUExtensionSize = 14 +) + +// Tag represents a BCP 47 language tag. It is used to specify an instance of a +// specific language or locale. All language tag values are guaranteed to be +// well-formed. The zero value of Tag is Und. +type Tag struct { + // TODO: the following fields have the form TagTypeID. This name is chosen + // to allow refactoring the public package without conflicting with its + // Base, Script, and Region methods. Once the transition is fully completed + // the ID can be stripped from the name. + + LangID Language + RegionID Region + // TODO: we will soon run out of positions for ScriptID. Idea: instead of + // storing lang, region, and ScriptID codes, store only the compact index and + // have a lookup table from this code to its expansion. This greatly speeds + // up table lookup, speed up common variant cases. + // This will also immediately free up 3 extra bytes. Also, the pVariant + // field can now be moved to the lookup table, as the compact index uniquely + // determines the offset of a possible variant. + ScriptID Script + pVariant byte // offset in str, includes preceding '-' + pExt uint16 // offset of first extension, includes preceding '-' + + // str is the string representation of the Tag. It will only be used if the + // tag has variants or extensions. + str string +} + +// Make is a convenience wrapper for Parse that omits the error. +// In case of an error, a sensible default is returned. +func Make(s string) Tag { + t, _ := Parse(s) + return t +} + +// Raw returns the raw base language, script and region, without making an +// attempt to infer their values. +// TODO: consider removing +func (t Tag) Raw() (b Language, s Script, r Region) { + return t.LangID, t.ScriptID, t.RegionID +} + +// equalTags compares language, script and region subtags only. +func (t Tag) equalTags(a Tag) bool { + return t.LangID == a.LangID && t.ScriptID == a.ScriptID && t.RegionID == a.RegionID +} + +// IsRoot returns true if t is equal to language "und". +func (t Tag) IsRoot() bool { + if int(t.pVariant) < len(t.str) { + return false + } + return t.equalTags(Und) +} + +// IsPrivateUse reports whether the Tag consists solely of an IsPrivateUse use +// tag. +func (t Tag) IsPrivateUse() bool { + return t.str != "" && t.pVariant == 0 +} + +// RemakeString is used to update t.str in case lang, script or region changed. +// It is assumed that pExt and pVariant still point to the start of the +// respective parts. +func (t *Tag) RemakeString() { + if t.str == "" { + return + } + extra := t.str[t.pVariant:] + if t.pVariant > 0 { + extra = extra[1:] + } + if t.equalTags(Und) && strings.HasPrefix(extra, "x-") { + t.str = extra + t.pVariant = 0 + t.pExt = 0 + return + } + var buf [max99thPercentileSize]byte // avoid extra memory allocation in most cases. + b := buf[:t.genCoreBytes(buf[:])] + if extra != "" { + diff := len(b) - int(t.pVariant) + b = append(b, '-') + b = append(b, extra...) + t.pVariant = uint8(int(t.pVariant) + diff) + t.pExt = uint16(int(t.pExt) + diff) + } else { + t.pVariant = uint8(len(b)) + t.pExt = uint16(len(b)) + } + t.str = string(b) +} + +// genCoreBytes writes a string for the base languages, script and region tags +// to the given buffer and returns the number of bytes written. It will never +// write more than maxCoreSize bytes. +func (t *Tag) genCoreBytes(buf []byte) int { + n := t.LangID.StringToBuf(buf[:]) + if t.ScriptID != 0 { + n += copy(buf[n:], "-") + n += copy(buf[n:], t.ScriptID.String()) + } + if t.RegionID != 0 { + n += copy(buf[n:], "-") + n += copy(buf[n:], t.RegionID.String()) + } + return n +} + +// String returns the canonical string representation of the language tag. +func (t Tag) String() string { + if t.str != "" { + return t.str + } + if t.ScriptID == 0 && t.RegionID == 0 { + return t.LangID.String() + } + buf := [maxCoreSize]byte{} + return string(buf[:t.genCoreBytes(buf[:])]) +} + +// MarshalText implements encoding.TextMarshaler. +func (t Tag) MarshalText() (text []byte, err error) { + if t.str != "" { + text = append(text, t.str...) + } else if t.ScriptID == 0 && t.RegionID == 0 { + text = append(text, t.LangID.String()...) + } else { + buf := [maxCoreSize]byte{} + text = buf[:t.genCoreBytes(buf[:])] + } + return text, nil +} + +// UnmarshalText implements encoding.TextUnmarshaler. +func (t *Tag) UnmarshalText(text []byte) error { + tag, err := Parse(string(text)) + *t = tag + return err +} + +// Variants returns the part of the tag holding all variants or the empty string +// if there are no variants defined. +func (t Tag) Variants() string { + if t.pVariant == 0 { + return "" + } + return t.str[t.pVariant:t.pExt] +} + +// VariantOrPrivateUseTags returns variants or private use tags. +func (t Tag) VariantOrPrivateUseTags() string { + if t.pExt > 0 { + return t.str[t.pVariant:t.pExt] + } + return t.str[t.pVariant:] +} + +// HasString reports whether this tag defines more than just the raw +// components. +func (t Tag) HasString() bool { + return t.str != "" +} + +// Parent returns the CLDR parent of t. In CLDR, missing fields in data for a +// specific language are substituted with fields from the parent language. +// The parent for a language may change for newer versions of CLDR. +func (t Tag) Parent() Tag { + if t.str != "" { + // Strip the variants and extensions. + b, s, r := t.Raw() + t = Tag{LangID: b, ScriptID: s, RegionID: r} + if t.RegionID == 0 && t.ScriptID != 0 && t.LangID != 0 { + base, _ := addTags(Tag{LangID: t.LangID}) + if base.ScriptID == t.ScriptID { + return Tag{LangID: t.LangID} + } + } + return t + } + if t.LangID != 0 { + if t.RegionID != 0 { + maxScript := t.ScriptID + if maxScript == 0 { + max, _ := addTags(t) + maxScript = max.ScriptID + } + + for i := range parents { + if Language(parents[i].lang) == t.LangID && Script(parents[i].maxScript) == maxScript { + for _, r := range parents[i].fromRegion { + if Region(r) == t.RegionID { + return Tag{ + LangID: t.LangID, + ScriptID: Script(parents[i].script), + RegionID: Region(parents[i].toRegion), + } + } + } + } + } + + // Strip the script if it is the default one. + base, _ := addTags(Tag{LangID: t.LangID}) + if base.ScriptID != maxScript { + return Tag{LangID: t.LangID, ScriptID: maxScript} + } + return Tag{LangID: t.LangID} + } else if t.ScriptID != 0 { + // The parent for an base-script pair with a non-default script is + // "und" instead of the base language. + base, _ := addTags(Tag{LangID: t.LangID}) + if base.ScriptID != t.ScriptID { + return Und + } + return Tag{LangID: t.LangID} + } + } + return Und +} + +// ParseExtension parses s as an extension and returns it on success. +func ParseExtension(s string) (ext string, err error) { + defer func() { + if recover() != nil { + ext = "" + err = ErrSyntax + } + }() + + scan := makeScannerString(s) + var end int + if n := len(scan.token); n != 1 { + return "", ErrSyntax + } + scan.toLower(0, len(scan.b)) + end = parseExtension(&scan) + if end != len(s) { + return "", ErrSyntax + } + return string(scan.b), nil +} + +// HasVariants reports whether t has variants. +func (t Tag) HasVariants() bool { + return uint16(t.pVariant) < t.pExt +} + +// HasExtensions reports whether t has extensions. +func (t Tag) HasExtensions() bool { + return int(t.pExt) < len(t.str) +} + +// Extension returns the extension of type x for tag t. It will return +// false for ok if t does not have the requested extension. The returned +// extension will be invalid in this case. +func (t Tag) Extension(x byte) (ext string, ok bool) { + for i := int(t.pExt); i < len(t.str)-1; { + var ext string + i, ext = getExtension(t.str, i) + if ext[0] == x { + return ext, true + } + } + return "", false +} + +// Extensions returns all extensions of t. +func (t Tag) Extensions() []string { + e := []string{} + for i := int(t.pExt); i < len(t.str)-1; { + var ext string + i, ext = getExtension(t.str, i) + e = append(e, ext) + } + return e +} + +// TypeForKey returns the type associated with the given key, where key and type +// are of the allowed values defined for the Unicode locale extension ('u') in +// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +// TypeForKey will traverse the inheritance chain to get the correct value. +// +// If there are multiple types associated with a key, only the first will be +// returned. If there is no type associated with a key, it returns the empty +// string. +func (t Tag) TypeForKey(key string) string { + if _, start, end, _ := t.findTypeForKey(key); end != start { + s := t.str[start:end] + if p := strings.IndexByte(s, '-'); p >= 0 { + s = s[:p] + } + return s + } + return "" +} + +var ( + errPrivateUse = errors.New("cannot set a key on a private use tag") + errInvalidArguments = errors.New("invalid key or type") +) + +// SetTypeForKey returns a new Tag with the key set to type, where key and type +// are of the allowed values defined for the Unicode locale extension ('u') in +// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +// An empty value removes an existing pair with the same key. +func (t Tag) SetTypeForKey(key, value string) (Tag, error) { + if t.IsPrivateUse() { + return t, errPrivateUse + } + if len(key) != 2 { + return t, errInvalidArguments + } + + // Remove the setting if value is "". + if value == "" { + start, sep, end, _ := t.findTypeForKey(key) + if start != sep { + // Remove a possible empty extension. + switch { + case t.str[start-2] != '-': // has previous elements. + case end == len(t.str), // end of string + end+2 < len(t.str) && t.str[end+2] == '-': // end of extension + start -= 2 + } + if start == int(t.pVariant) && end == len(t.str) { + t.str = "" + t.pVariant, t.pExt = 0, 0 + } else { + t.str = fmt.Sprintf("%s%s", t.str[:start], t.str[end:]) + } + } + return t, nil + } + + if len(value) < 3 || len(value) > 8 { + return t, errInvalidArguments + } + + var ( + buf [maxCoreSize + maxSimpleUExtensionSize]byte + uStart int // start of the -u extension. + ) + + // Generate the tag string if needed. + if t.str == "" { + uStart = t.genCoreBytes(buf[:]) + buf[uStart] = '-' + uStart++ + } + + // Create new key-type pair and parse it to verify. + b := buf[uStart:] + copy(b, "u-") + copy(b[2:], key) + b[4] = '-' + b = b[:5+copy(b[5:], value)] + scan := makeScanner(b) + if parseExtensions(&scan); scan.err != nil { + return t, scan.err + } + + // Assemble the replacement string. + if t.str == "" { + t.pVariant, t.pExt = byte(uStart-1), uint16(uStart-1) + t.str = string(buf[:uStart+len(b)]) + } else { + s := t.str + start, sep, end, hasExt := t.findTypeForKey(key) + if start == sep { + if hasExt { + b = b[2:] + } + t.str = fmt.Sprintf("%s-%s%s", s[:sep], b, s[end:]) + } else { + t.str = fmt.Sprintf("%s-%s%s", s[:start+3], value, s[end:]) + } + } + return t, nil +} + +// findKeyAndType returns the start and end position for the type corresponding +// to key or the point at which to insert the key-value pair if the type +// wasn't found. The hasExt return value reports whether an -u extension was present. +// Note: the extensions are typically very small and are likely to contain +// only one key-type pair. +func (t Tag) findTypeForKey(key string) (start, sep, end int, hasExt bool) { + p := int(t.pExt) + if len(key) != 2 || p == len(t.str) || p == 0 { + return p, p, p, false + } + s := t.str + + // Find the correct extension. + for p++; s[p] != 'u'; p++ { + if s[p] > 'u' { + p-- + return p, p, p, false + } + if p = nextExtension(s, p); p == len(s) { + return len(s), len(s), len(s), false + } + } + // Proceed to the hyphen following the extension name. + p++ + + // curKey is the key currently being processed. + curKey := "" + + // Iterate over keys until we get the end of a section. + for { + end = p + for p++; p < len(s) && s[p] != '-'; p++ { + } + n := p - end - 1 + if n <= 2 && curKey == key { + if sep < end { + sep++ + } + return start, sep, end, true + } + switch n { + case 0, // invalid string + 1: // next extension + return end, end, end, true + case 2: + // next key + curKey = s[end+1 : p] + if curKey > key { + return end, end, end, true + } + start = end + sep = p + } + } +} + +// ParseBase parses a 2- or 3-letter ISO 639 code. +// It returns a ValueError if s is a well-formed but unknown language identifier +// or another error if another error occurred. +func ParseBase(s string) (l Language, err error) { + defer func() { + if recover() != nil { + l = 0 + err = ErrSyntax + } + }() + + if n := len(s); n < 2 || 3 < n { + return 0, ErrSyntax + } + var buf [3]byte + return getLangID(buf[:copy(buf[:], s)]) +} + +// ParseScript parses a 4-letter ISO 15924 code. +// It returns a ValueError if s is a well-formed but unknown script identifier +// or another error if another error occurred. +func ParseScript(s string) (scr Script, err error) { + defer func() { + if recover() != nil { + scr = 0 + err = ErrSyntax + } + }() + + if len(s) != 4 { + return 0, ErrSyntax + } + var buf [4]byte + return getScriptID(script, buf[:copy(buf[:], s)]) +} + +// EncodeM49 returns the Region for the given UN M.49 code. +// It returns an error if r is not a valid code. +func EncodeM49(r int) (Region, error) { + return getRegionM49(r) +} + +// ParseRegion parses a 2- or 3-letter ISO 3166-1 or a UN M.49 code. +// It returns a ValueError if s is a well-formed but unknown region identifier +// or another error if another error occurred. +func ParseRegion(s string) (r Region, err error) { + defer func() { + if recover() != nil { + r = 0 + err = ErrSyntax + } + }() + + if n := len(s); n < 2 || 3 < n { + return 0, ErrSyntax + } + var buf [3]byte + return getRegionID(buf[:copy(buf[:], s)]) +} + +// IsCountry returns whether this region is a country or autonomous area. This +// includes non-standard definitions from CLDR. +func (r Region) IsCountry() bool { + if r == 0 || r.IsGroup() || r.IsPrivateUse() && r != _XK { + return false + } + return true +} + +// IsGroup returns whether this region defines a collection of regions. This +// includes non-standard definitions from CLDR. +func (r Region) IsGroup() bool { + if r == 0 { + return false + } + return int(regionInclusion[r]) < len(regionContainment) +} + +// Contains returns whether Region c is contained by Region r. It returns true +// if c == r. +func (r Region) Contains(c Region) bool { + if r == c { + return true + } + g := regionInclusion[r] + if g >= nRegionGroups { + return false + } + m := regionContainment[g] + + d := regionInclusion[c] + b := regionInclusionBits[d] + + // A contained country may belong to multiple disjoint groups. Matching any + // of these indicates containment. If the contained region is a group, it + // must strictly be a subset. + if d >= nRegionGroups { + return b&m != 0 + } + return b&^m == 0 +} + +var errNoTLD = errors.New("language: region is not a valid ccTLD") + +// TLD returns the country code top-level domain (ccTLD). UK is returned for GB. +// In all other cases it returns either the region itself or an error. +// +// This method may return an error for a region for which there exists a +// canonical form with a ccTLD. To get that ccTLD canonicalize r first. The +// region will already be canonicalized it was obtained from a Tag that was +// obtained using any of the default methods. +func (r Region) TLD() (Region, error) { + // See http://en.wikipedia.org/wiki/Country_code_top-level_domain for the + // difference between ISO 3166-1 and IANA ccTLD. + if r == _GB { + r = _UK + } + if (r.typ() & ccTLD) == 0 { + return 0, errNoTLD + } + return r, nil +} + +// Canonicalize returns the region or a possible replacement if the region is +// deprecated. It will not return a replacement for deprecated regions that +// are split into multiple regions. +func (r Region) Canonicalize() Region { + if cr := normRegion(r); cr != 0 { + return cr + } + return r +} + +// Variant represents a registered variant of a language as defined by BCP 47. +type Variant struct { + ID uint8 + str string +} + +// ParseVariant parses and returns a Variant. An error is returned if s is not +// a valid variant. +func ParseVariant(s string) (v Variant, err error) { + defer func() { + if recover() != nil { + v = Variant{} + err = ErrSyntax + } + }() + + s = strings.ToLower(s) + if id, ok := variantIndex[s]; ok { + return Variant{id, s}, nil + } + return Variant{}, NewValueError([]byte(s)) +} + +// String returns the string representation of the variant. +func (v Variant) String() string { + return v.str +} diff --git a/vendor/golang.org/x/text/internal/language/lookup.go b/vendor/golang.org/x/text/internal/language/lookup.go new file mode 100644 index 00000000..231b4fbd --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/lookup.go @@ -0,0 +1,412 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import ( + "bytes" + "fmt" + "sort" + "strconv" + + "golang.org/x/text/internal/tag" +) + +// findIndex tries to find the given tag in idx and returns a standardized error +// if it could not be found. +func findIndex(idx tag.Index, key []byte, form string) (index int, err error) { + if !tag.FixCase(form, key) { + return 0, ErrSyntax + } + i := idx.Index(key) + if i == -1 { + return 0, NewValueError(key) + } + return i, nil +} + +func searchUint(imap []uint16, key uint16) int { + return sort.Search(len(imap), func(i int) bool { + return imap[i] >= key + }) +} + +type Language uint16 + +// getLangID returns the langID of s if s is a canonical subtag +// or langUnknown if s is not a canonical subtag. +func getLangID(s []byte) (Language, error) { + if len(s) == 2 { + return getLangISO2(s) + } + return getLangISO3(s) +} + +// TODO language normalization as well as the AliasMaps could be moved to the +// higher level package, but it is a bit tricky to separate the generation. + +func (id Language) Canonicalize() (Language, AliasType) { + return normLang(id) +} + +// normLang returns the mapped langID of id according to mapping m. +func normLang(id Language) (Language, AliasType) { + k := sort.Search(len(AliasMap), func(i int) bool { + return AliasMap[i].From >= uint16(id) + }) + if k < len(AliasMap) && AliasMap[k].From == uint16(id) { + return Language(AliasMap[k].To), AliasTypes[k] + } + return id, AliasTypeUnknown +} + +// getLangISO2 returns the langID for the given 2-letter ISO language code +// or unknownLang if this does not exist. +func getLangISO2(s []byte) (Language, error) { + if !tag.FixCase("zz", s) { + return 0, ErrSyntax + } + if i := lang.Index(s); i != -1 && lang.Elem(i)[3] != 0 { + return Language(i), nil + } + return 0, NewValueError(s) +} + +const base = 'z' - 'a' + 1 + +func strToInt(s []byte) uint { + v := uint(0) + for i := 0; i < len(s); i++ { + v *= base + v += uint(s[i] - 'a') + } + return v +} + +// converts the given integer to the original ASCII string passed to strToInt. +// len(s) must match the number of characters obtained. +func intToStr(v uint, s []byte) { + for i := len(s) - 1; i >= 0; i-- { + s[i] = byte(v%base) + 'a' + v /= base + } +} + +// getLangISO3 returns the langID for the given 3-letter ISO language code +// or unknownLang if this does not exist. +func getLangISO3(s []byte) (Language, error) { + if tag.FixCase("und", s) { + // first try to match canonical 3-letter entries + for i := lang.Index(s[:2]); i != -1; i = lang.Next(s[:2], i) { + if e := lang.Elem(i); e[3] == 0 && e[2] == s[2] { + // We treat "und" as special and always translate it to "unspecified". + // Note that ZZ and Zzzz are private use and are not treated as + // unspecified by default. + id := Language(i) + if id == nonCanonicalUnd { + return 0, nil + } + return id, nil + } + } + if i := altLangISO3.Index(s); i != -1 { + return Language(altLangIndex[altLangISO3.Elem(i)[3]]), nil + } + n := strToInt(s) + if langNoIndex[n/8]&(1<<(n%8)) != 0 { + return Language(n) + langNoIndexOffset, nil + } + // Check for non-canonical uses of ISO3. + for i := lang.Index(s[:1]); i != -1; i = lang.Next(s[:1], i) { + if e := lang.Elem(i); e[2] == s[1] && e[3] == s[2] { + return Language(i), nil + } + } + return 0, NewValueError(s) + } + return 0, ErrSyntax +} + +// StringToBuf writes the string to b and returns the number of bytes +// written. cap(b) must be >= 3. +func (id Language) StringToBuf(b []byte) int { + if id >= langNoIndexOffset { + intToStr(uint(id)-langNoIndexOffset, b[:3]) + return 3 + } else if id == 0 { + return copy(b, "und") + } + l := lang[id<<2:] + if l[3] == 0 { + return copy(b, l[:3]) + } + return copy(b, l[:2]) +} + +// String returns the BCP 47 representation of the langID. +// Use b as variable name, instead of id, to ensure the variable +// used is consistent with that of Base in which this type is embedded. +func (b Language) String() string { + if b == 0 { + return "und" + } else if b >= langNoIndexOffset { + b -= langNoIndexOffset + buf := [3]byte{} + intToStr(uint(b), buf[:]) + return string(buf[:]) + } + l := lang.Elem(int(b)) + if l[3] == 0 { + return l[:3] + } + return l[:2] +} + +// ISO3 returns the ISO 639-3 language code. +func (b Language) ISO3() string { + if b == 0 || b >= langNoIndexOffset { + return b.String() + } + l := lang.Elem(int(b)) + if l[3] == 0 { + return l[:3] + } else if l[2] == 0 { + return altLangISO3.Elem(int(l[3]))[:3] + } + // This allocation will only happen for 3-letter ISO codes + // that are non-canonical BCP 47 language identifiers. + return l[0:1] + l[2:4] +} + +// IsPrivateUse reports whether this language code is reserved for private use. +func (b Language) IsPrivateUse() bool { + return langPrivateStart <= b && b <= langPrivateEnd +} + +// SuppressScript returns the script marked as SuppressScript in the IANA +// language tag repository, or 0 if there is no such script. +func (b Language) SuppressScript() Script { + if b < langNoIndexOffset { + return Script(suppressScript[b]) + } + return 0 +} + +type Region uint16 + +// getRegionID returns the region id for s if s is a valid 2-letter region code +// or unknownRegion. +func getRegionID(s []byte) (Region, error) { + if len(s) == 3 { + if isAlpha(s[0]) { + return getRegionISO3(s) + } + if i, err := strconv.ParseUint(string(s), 10, 10); err == nil { + return getRegionM49(int(i)) + } + } + return getRegionISO2(s) +} + +// getRegionISO2 returns the regionID for the given 2-letter ISO country code +// or unknownRegion if this does not exist. +func getRegionISO2(s []byte) (Region, error) { + i, err := findIndex(regionISO, s, "ZZ") + if err != nil { + return 0, err + } + return Region(i) + isoRegionOffset, nil +} + +// getRegionISO3 returns the regionID for the given 3-letter ISO country code +// or unknownRegion if this does not exist. +func getRegionISO3(s []byte) (Region, error) { + if tag.FixCase("ZZZ", s) { + for i := regionISO.Index(s[:1]); i != -1; i = regionISO.Next(s[:1], i) { + if e := regionISO.Elem(i); e[2] == s[1] && e[3] == s[2] { + return Region(i) + isoRegionOffset, nil + } + } + for i := 0; i < len(altRegionISO3); i += 3 { + if tag.Compare(altRegionISO3[i:i+3], s) == 0 { + return Region(altRegionIDs[i/3]), nil + } + } + return 0, NewValueError(s) + } + return 0, ErrSyntax +} + +func getRegionM49(n int) (Region, error) { + if 0 < n && n <= 999 { + const ( + searchBits = 7 + regionBits = 9 + regionMask = 1<> searchBits + buf := fromM49[m49Index[idx]:m49Index[idx+1]] + val := uint16(n) << regionBits // we rely on bits shifting out + i := sort.Search(len(buf), func(i int) bool { + return buf[i] >= val + }) + if r := fromM49[int(m49Index[idx])+i]; r&^regionMask == val { + return Region(r & regionMask), nil + } + } + var e ValueError + fmt.Fprint(bytes.NewBuffer([]byte(e.v[:])), n) + return 0, e +} + +// normRegion returns a region if r is deprecated or 0 otherwise. +// TODO: consider supporting BYS (-> BLR), CSK (-> 200 or CZ), PHI (-> PHL) and AFI (-> DJ). +// TODO: consider mapping split up regions to new most populous one (like CLDR). +func normRegion(r Region) Region { + m := regionOldMap + k := sort.Search(len(m), func(i int) bool { + return m[i].From >= uint16(r) + }) + if k < len(m) && m[k].From == uint16(r) { + return Region(m[k].To) + } + return 0 +} + +const ( + iso3166UserAssigned = 1 << iota + ccTLD + bcp47Region +) + +func (r Region) typ() byte { + return regionTypes[r] +} + +// String returns the BCP 47 representation for the region. +// It returns "ZZ" for an unspecified region. +func (r Region) String() string { + if r < isoRegionOffset { + if r == 0 { + return "ZZ" + } + return fmt.Sprintf("%03d", r.M49()) + } + r -= isoRegionOffset + return regionISO.Elem(int(r))[:2] +} + +// ISO3 returns the 3-letter ISO code of r. +// Note that not all regions have a 3-letter ISO code. +// In such cases this method returns "ZZZ". +func (r Region) ISO3() string { + if r < isoRegionOffset { + return "ZZZ" + } + r -= isoRegionOffset + reg := regionISO.Elem(int(r)) + switch reg[2] { + case 0: + return altRegionISO3[reg[3]:][:3] + case ' ': + return "ZZZ" + } + return reg[0:1] + reg[2:4] +} + +// M49 returns the UN M.49 encoding of r, or 0 if this encoding +// is not defined for r. +func (r Region) M49() int { + return int(m49[r]) +} + +// IsPrivateUse reports whether r has the ISO 3166 User-assigned status. This +// may include private-use tags that are assigned by CLDR and used in this +// implementation. So IsPrivateUse and IsCountry can be simultaneously true. +func (r Region) IsPrivateUse() bool { + return r.typ()&iso3166UserAssigned != 0 +} + +type Script uint16 + +// getScriptID returns the script id for string s. It assumes that s +// is of the format [A-Z][a-z]{3}. +func getScriptID(idx tag.Index, s []byte) (Script, error) { + i, err := findIndex(idx, s, "Zzzz") + return Script(i), err +} + +// String returns the script code in title case. +// It returns "Zzzz" for an unspecified script. +func (s Script) String() string { + if s == 0 { + return "Zzzz" + } + return script.Elem(int(s)) +} + +// IsPrivateUse reports whether this script code is reserved for private use. +func (s Script) IsPrivateUse() bool { + return _Qaaa <= s && s <= _Qabx +} + +const ( + maxAltTaglen = len("en-US-POSIX") + maxLen = maxAltTaglen +) + +var ( + // grandfatheredMap holds a mapping from legacy and grandfathered tags to + // their base language or index to more elaborate tag. + grandfatheredMap = map[[maxLen]byte]int16{ + [maxLen]byte{'a', 'r', 't', '-', 'l', 'o', 'j', 'b', 'a', 'n'}: _jbo, // art-lojban + [maxLen]byte{'i', '-', 'a', 'm', 'i'}: _ami, // i-ami + [maxLen]byte{'i', '-', 'b', 'n', 'n'}: _bnn, // i-bnn + [maxLen]byte{'i', '-', 'h', 'a', 'k'}: _hak, // i-hak + [maxLen]byte{'i', '-', 'k', 'l', 'i', 'n', 'g', 'o', 'n'}: _tlh, // i-klingon + [maxLen]byte{'i', '-', 'l', 'u', 'x'}: _lb, // i-lux + [maxLen]byte{'i', '-', 'n', 'a', 'v', 'a', 'j', 'o'}: _nv, // i-navajo + [maxLen]byte{'i', '-', 'p', 'w', 'n'}: _pwn, // i-pwn + [maxLen]byte{'i', '-', 't', 'a', 'o'}: _tao, // i-tao + [maxLen]byte{'i', '-', 't', 'a', 'y'}: _tay, // i-tay + [maxLen]byte{'i', '-', 't', 's', 'u'}: _tsu, // i-tsu + [maxLen]byte{'n', 'o', '-', 'b', 'o', 'k'}: _nb, // no-bok + [maxLen]byte{'n', 'o', '-', 'n', 'y', 'n'}: _nn, // no-nyn + [maxLen]byte{'s', 'g', 'n', '-', 'b', 'e', '-', 'f', 'r'}: _sfb, // sgn-BE-FR + [maxLen]byte{'s', 'g', 'n', '-', 'b', 'e', '-', 'n', 'l'}: _vgt, // sgn-BE-NL + [maxLen]byte{'s', 'g', 'n', '-', 'c', 'h', '-', 'd', 'e'}: _sgg, // sgn-CH-DE + [maxLen]byte{'z', 'h', '-', 'g', 'u', 'o', 'y', 'u'}: _cmn, // zh-guoyu + [maxLen]byte{'z', 'h', '-', 'h', 'a', 'k', 'k', 'a'}: _hak, // zh-hakka + [maxLen]byte{'z', 'h', '-', 'm', 'i', 'n', '-', 'n', 'a', 'n'}: _nan, // zh-min-nan + [maxLen]byte{'z', 'h', '-', 'x', 'i', 'a', 'n', 'g'}: _hsn, // zh-xiang + + // Grandfathered tags with no modern replacement will be converted as + // follows: + [maxLen]byte{'c', 'e', 'l', '-', 'g', 'a', 'u', 'l', 'i', 's', 'h'}: -1, // cel-gaulish + [maxLen]byte{'e', 'n', '-', 'g', 'b', '-', 'o', 'e', 'd'}: -2, // en-GB-oed + [maxLen]byte{'i', '-', 'd', 'e', 'f', 'a', 'u', 'l', 't'}: -3, // i-default + [maxLen]byte{'i', '-', 'e', 'n', 'o', 'c', 'h', 'i', 'a', 'n'}: -4, // i-enochian + [maxLen]byte{'i', '-', 'm', 'i', 'n', 'g', 'o'}: -5, // i-mingo + [maxLen]byte{'z', 'h', '-', 'm', 'i', 'n'}: -6, // zh-min + + // CLDR-specific tag. + [maxLen]byte{'r', 'o', 'o', 't'}: 0, // root + [maxLen]byte{'e', 'n', '-', 'u', 's', '-', 'p', 'o', 's', 'i', 'x'}: -7, // en_US_POSIX" + } + + altTagIndex = [...]uint8{0, 17, 31, 45, 61, 74, 86, 102} + + altTags = "xtg-x-cel-gaulishen-GB-oxendicten-x-i-defaultund-x-i-enochiansee-x-i-mingonan-x-zh-minen-US-u-va-posix" +) + +func grandfathered(s [maxAltTaglen]byte) (t Tag, ok bool) { + if v, ok := grandfatheredMap[s]; ok { + if v < 0 { + return Make(altTags[altTagIndex[-v-1]:altTagIndex[-v]]), true + } + t.LangID = Language(v) + return t, true + } + return t, false +} diff --git a/vendor/golang.org/x/text/internal/language/match.go b/vendor/golang.org/x/text/internal/language/match.go new file mode 100644 index 00000000..75a2dbca --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/match.go @@ -0,0 +1,226 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import "errors" + +type scriptRegionFlags uint8 + +const ( + isList = 1 << iota + scriptInFrom + regionInFrom +) + +func (t *Tag) setUndefinedLang(id Language) { + if t.LangID == 0 { + t.LangID = id + } +} + +func (t *Tag) setUndefinedScript(id Script) { + if t.ScriptID == 0 { + t.ScriptID = id + } +} + +func (t *Tag) setUndefinedRegion(id Region) { + if t.RegionID == 0 || t.RegionID.Contains(id) { + t.RegionID = id + } +} + +// ErrMissingLikelyTagsData indicates no information was available +// to compute likely values of missing tags. +var ErrMissingLikelyTagsData = errors.New("missing likely tags data") + +// addLikelySubtags sets subtags to their most likely value, given the locale. +// In most cases this means setting fields for unknown values, but in some +// cases it may alter a value. It returns an ErrMissingLikelyTagsData error +// if the given locale cannot be expanded. +func (t Tag) addLikelySubtags() (Tag, error) { + id, err := addTags(t) + if err != nil { + return t, err + } else if id.equalTags(t) { + return t, nil + } + id.RemakeString() + return id, nil +} + +// specializeRegion attempts to specialize a group region. +func specializeRegion(t *Tag) bool { + if i := regionInclusion[t.RegionID]; i < nRegionGroups { + x := likelyRegionGroup[i] + if Language(x.lang) == t.LangID && Script(x.script) == t.ScriptID { + t.RegionID = Region(x.region) + } + return true + } + return false +} + +// Maximize returns a new tag with missing tags filled in. +func (t Tag) Maximize() (Tag, error) { + return addTags(t) +} + +func addTags(t Tag) (Tag, error) { + // We leave private use identifiers alone. + if t.IsPrivateUse() { + return t, nil + } + if t.ScriptID != 0 && t.RegionID != 0 { + if t.LangID != 0 { + // already fully specified + specializeRegion(&t) + return t, nil + } + // Search matches for und-script-region. Note that for these cases + // region will never be a group so there is no need to check for this. + list := likelyRegion[t.RegionID : t.RegionID+1] + if x := list[0]; x.flags&isList != 0 { + list = likelyRegionList[x.lang : x.lang+uint16(x.script)] + } + for _, x := range list { + // Deviating from the spec. See match_test.go for details. + if Script(x.script) == t.ScriptID { + t.setUndefinedLang(Language(x.lang)) + return t, nil + } + } + } + if t.LangID != 0 { + // Search matches for lang-script and lang-region, where lang != und. + if t.LangID < langNoIndexOffset { + x := likelyLang[t.LangID] + if x.flags&isList != 0 { + list := likelyLangList[x.region : x.region+uint16(x.script)] + if t.ScriptID != 0 { + for _, x := range list { + if Script(x.script) == t.ScriptID && x.flags&scriptInFrom != 0 { + t.setUndefinedRegion(Region(x.region)) + return t, nil + } + } + } else if t.RegionID != 0 { + count := 0 + goodScript := true + tt := t + for _, x := range list { + // We visit all entries for which the script was not + // defined, including the ones where the region was not + // defined. This allows for proper disambiguation within + // regions. + if x.flags&scriptInFrom == 0 && t.RegionID.Contains(Region(x.region)) { + tt.RegionID = Region(x.region) + tt.setUndefinedScript(Script(x.script)) + goodScript = goodScript && tt.ScriptID == Script(x.script) + count++ + } + } + if count == 1 { + return tt, nil + } + // Even if we fail to find a unique Region, we might have + // an unambiguous script. + if goodScript { + t.ScriptID = tt.ScriptID + } + } + } + } + } else { + // Search matches for und-script. + if t.ScriptID != 0 { + x := likelyScript[t.ScriptID] + if x.region != 0 { + t.setUndefinedRegion(Region(x.region)) + t.setUndefinedLang(Language(x.lang)) + return t, nil + } + } + // Search matches for und-region. If und-script-region exists, it would + // have been found earlier. + if t.RegionID != 0 { + if i := regionInclusion[t.RegionID]; i < nRegionGroups { + x := likelyRegionGroup[i] + if x.region != 0 { + t.setUndefinedLang(Language(x.lang)) + t.setUndefinedScript(Script(x.script)) + t.RegionID = Region(x.region) + } + } else { + x := likelyRegion[t.RegionID] + if x.flags&isList != 0 { + x = likelyRegionList[x.lang] + } + if x.script != 0 && x.flags != scriptInFrom { + t.setUndefinedLang(Language(x.lang)) + t.setUndefinedScript(Script(x.script)) + return t, nil + } + } + } + } + + // Search matches for lang. + if t.LangID < langNoIndexOffset { + x := likelyLang[t.LangID] + if x.flags&isList != 0 { + x = likelyLangList[x.region] + } + if x.region != 0 { + t.setUndefinedScript(Script(x.script)) + t.setUndefinedRegion(Region(x.region)) + } + specializeRegion(&t) + if t.LangID == 0 { + t.LangID = _en // default language + } + return t, nil + } + return t, ErrMissingLikelyTagsData +} + +func (t *Tag) setTagsFrom(id Tag) { + t.LangID = id.LangID + t.ScriptID = id.ScriptID + t.RegionID = id.RegionID +} + +// minimize removes the region or script subtags from t such that +// t.addLikelySubtags() == t.minimize().addLikelySubtags(). +func (t Tag) minimize() (Tag, error) { + t, err := minimizeTags(t) + if err != nil { + return t, err + } + t.RemakeString() + return t, nil +} + +// minimizeTags mimics the behavior of the ICU 51 C implementation. +func minimizeTags(t Tag) (Tag, error) { + if t.equalTags(Und) { + return t, nil + } + max, err := addTags(t) + if err != nil { + return t, err + } + for _, id := range [...]Tag{ + {LangID: t.LangID}, + {LangID: t.LangID, RegionID: t.RegionID}, + {LangID: t.LangID, ScriptID: t.ScriptID}, + } { + if x, err := addTags(id); err == nil && max.equalTags(x) { + t.setTagsFrom(id) + break + } + } + return t, nil +} diff --git a/vendor/golang.org/x/text/internal/language/parse.go b/vendor/golang.org/x/text/internal/language/parse.go new file mode 100644 index 00000000..aad1e0ac --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/parse.go @@ -0,0 +1,608 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import ( + "bytes" + "errors" + "fmt" + "sort" + + "golang.org/x/text/internal/tag" +) + +// isAlpha returns true if the byte is not a digit. +// b must be an ASCII letter or digit. +func isAlpha(b byte) bool { + return b > '9' +} + +// isAlphaNum returns true if the string contains only ASCII letters or digits. +func isAlphaNum(s []byte) bool { + for _, c := range s { + if !('a' <= c && c <= 'z' || 'A' <= c && c <= 'Z' || '0' <= c && c <= '9') { + return false + } + } + return true +} + +// ErrSyntax is returned by any of the parsing functions when the +// input is not well-formed, according to BCP 47. +// TODO: return the position at which the syntax error occurred? +var ErrSyntax = errors.New("language: tag is not well-formed") + +// ErrDuplicateKey is returned when a tag contains the same key twice with +// different values in the -u section. +var ErrDuplicateKey = errors.New("language: different values for same key in -u extension") + +// ValueError is returned by any of the parsing functions when the +// input is well-formed but the respective subtag is not recognized +// as a valid value. +type ValueError struct { + v [8]byte +} + +// NewValueError creates a new ValueError. +func NewValueError(tag []byte) ValueError { + var e ValueError + copy(e.v[:], tag) + return e +} + +func (e ValueError) tag() []byte { + n := bytes.IndexByte(e.v[:], 0) + if n == -1 { + n = 8 + } + return e.v[:n] +} + +// Error implements the error interface. +func (e ValueError) Error() string { + return fmt.Sprintf("language: subtag %q is well-formed but unknown", e.tag()) +} + +// Subtag returns the subtag for which the error occurred. +func (e ValueError) Subtag() string { + return string(e.tag()) +} + +// scanner is used to scan BCP 47 tokens, which are separated by _ or -. +type scanner struct { + b []byte + bytes [max99thPercentileSize]byte + token []byte + start int // start position of the current token + end int // end position of the current token + next int // next point for scan + err error + done bool +} + +func makeScannerString(s string) scanner { + scan := scanner{} + if len(s) <= len(scan.bytes) { + scan.b = scan.bytes[:copy(scan.bytes[:], s)] + } else { + scan.b = []byte(s) + } + scan.init() + return scan +} + +// makeScanner returns a scanner using b as the input buffer. +// b is not copied and may be modified by the scanner routines. +func makeScanner(b []byte) scanner { + scan := scanner{b: b} + scan.init() + return scan +} + +func (s *scanner) init() { + for i, c := range s.b { + if c == '_' { + s.b[i] = '-' + } + } + s.scan() +} + +// restToLower converts the string between start and end to lower case. +func (s *scanner) toLower(start, end int) { + for i := start; i < end; i++ { + c := s.b[i] + if 'A' <= c && c <= 'Z' { + s.b[i] += 'a' - 'A' + } + } +} + +func (s *scanner) setError(e error) { + if s.err == nil || (e == ErrSyntax && s.err != ErrSyntax) { + s.err = e + } +} + +// resizeRange shrinks or grows the array at position oldStart such that +// a new string of size newSize can fit between oldStart and oldEnd. +// Sets the scan point to after the resized range. +func (s *scanner) resizeRange(oldStart, oldEnd, newSize int) { + s.start = oldStart + if end := oldStart + newSize; end != oldEnd { + diff := end - oldEnd + var b []byte + if n := len(s.b) + diff; n > cap(s.b) { + b = make([]byte, n) + copy(b, s.b[:oldStart]) + } else { + b = s.b[:n] + } + copy(b[end:], s.b[oldEnd:]) + s.b = b + s.next = end + (s.next - s.end) + s.end = end + } +} + +// replace replaces the current token with repl. +func (s *scanner) replace(repl string) { + s.resizeRange(s.start, s.end, len(repl)) + copy(s.b[s.start:], repl) +} + +// gobble removes the current token from the input. +// Caller must call scan after calling gobble. +func (s *scanner) gobble(e error) { + s.setError(e) + if s.start == 0 { + s.b = s.b[:+copy(s.b, s.b[s.next:])] + s.end = 0 + } else { + s.b = s.b[:s.start-1+copy(s.b[s.start-1:], s.b[s.end:])] + s.end = s.start - 1 + } + s.next = s.start +} + +// deleteRange removes the given range from s.b before the current token. +func (s *scanner) deleteRange(start, end int) { + s.b = s.b[:start+copy(s.b[start:], s.b[end:])] + diff := end - start + s.next -= diff + s.start -= diff + s.end -= diff +} + +// scan parses the next token of a BCP 47 string. Tokens that are larger +// than 8 characters or include non-alphanumeric characters result in an error +// and are gobbled and removed from the output. +// It returns the end position of the last token consumed. +func (s *scanner) scan() (end int) { + end = s.end + s.token = nil + for s.start = s.next; s.next < len(s.b); { + i := bytes.IndexByte(s.b[s.next:], '-') + if i == -1 { + s.end = len(s.b) + s.next = len(s.b) + i = s.end - s.start + } else { + s.end = s.next + i + s.next = s.end + 1 + } + token := s.b[s.start:s.end] + if i < 1 || i > 8 || !isAlphaNum(token) { + s.gobble(ErrSyntax) + continue + } + s.token = token + return end + } + if n := len(s.b); n > 0 && s.b[n-1] == '-' { + s.setError(ErrSyntax) + s.b = s.b[:len(s.b)-1] + } + s.done = true + return end +} + +// acceptMinSize parses multiple tokens of the given size or greater. +// It returns the end position of the last token consumed. +func (s *scanner) acceptMinSize(min int) (end int) { + end = s.end + s.scan() + for ; len(s.token) >= min; s.scan() { + end = s.end + } + return end +} + +// Parse parses the given BCP 47 string and returns a valid Tag. If parsing +// failed it returns an error and any part of the tag that could be parsed. +// If parsing succeeded but an unknown value was found, it returns +// ValueError. The Tag returned in this case is just stripped of the unknown +// value. All other values are preserved. It accepts tags in the BCP 47 format +// and extensions to this standard defined in +// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +func Parse(s string) (t Tag, err error) { + // TODO: consider supporting old-style locale key-value pairs. + if s == "" { + return Und, ErrSyntax + } + defer func() { + if recover() != nil { + t = Und + err = ErrSyntax + return + } + }() + if len(s) <= maxAltTaglen { + b := [maxAltTaglen]byte{} + for i, c := range s { + // Generating invalid UTF-8 is okay as it won't match. + if 'A' <= c && c <= 'Z' { + c += 'a' - 'A' + } else if c == '_' { + c = '-' + } + b[i] = byte(c) + } + if t, ok := grandfathered(b); ok { + return t, nil + } + } + scan := makeScannerString(s) + return parse(&scan, s) +} + +func parse(scan *scanner, s string) (t Tag, err error) { + t = Und + var end int + if n := len(scan.token); n <= 1 { + scan.toLower(0, len(scan.b)) + if n == 0 || scan.token[0] != 'x' { + return t, ErrSyntax + } + end = parseExtensions(scan) + } else if n >= 4 { + return Und, ErrSyntax + } else { // the usual case + t, end = parseTag(scan, true) + if n := len(scan.token); n == 1 { + t.pExt = uint16(end) + end = parseExtensions(scan) + } else if end < len(scan.b) { + scan.setError(ErrSyntax) + scan.b = scan.b[:end] + } + } + if int(t.pVariant) < len(scan.b) { + if end < len(s) { + s = s[:end] + } + if len(s) > 0 && tag.Compare(s, scan.b) == 0 { + t.str = s + } else { + t.str = string(scan.b) + } + } else { + t.pVariant, t.pExt = 0, 0 + } + return t, scan.err +} + +// parseTag parses language, script, region and variants. +// It returns a Tag and the end position in the input that was parsed. +// If doNorm is true, then - will be normalized to . +func parseTag(scan *scanner, doNorm bool) (t Tag, end int) { + var e error + // TODO: set an error if an unknown lang, script or region is encountered. + t.LangID, e = getLangID(scan.token) + scan.setError(e) + scan.replace(t.LangID.String()) + langStart := scan.start + end = scan.scan() + for len(scan.token) == 3 && isAlpha(scan.token[0]) { + // From http://tools.ietf.org/html/bcp47, - tags are equivalent + // to a tag of the form . + if doNorm { + lang, e := getLangID(scan.token) + if lang != 0 { + t.LangID = lang + langStr := lang.String() + copy(scan.b[langStart:], langStr) + scan.b[langStart+len(langStr)] = '-' + scan.start = langStart + len(langStr) + 1 + } + scan.gobble(e) + } + end = scan.scan() + } + if len(scan.token) == 4 && isAlpha(scan.token[0]) { + t.ScriptID, e = getScriptID(script, scan.token) + if t.ScriptID == 0 { + scan.gobble(e) + } + end = scan.scan() + } + if n := len(scan.token); n >= 2 && n <= 3 { + t.RegionID, e = getRegionID(scan.token) + if t.RegionID == 0 { + scan.gobble(e) + } else { + scan.replace(t.RegionID.String()) + } + end = scan.scan() + } + scan.toLower(scan.start, len(scan.b)) + t.pVariant = byte(end) + end = parseVariants(scan, end, t) + t.pExt = uint16(end) + return t, end +} + +var separator = []byte{'-'} + +// parseVariants scans tokens as long as each token is a valid variant string. +// Duplicate variants are removed. +func parseVariants(scan *scanner, end int, t Tag) int { + start := scan.start + varIDBuf := [4]uint8{} + variantBuf := [4][]byte{} + varID := varIDBuf[:0] + variant := variantBuf[:0] + last := -1 + needSort := false + for ; len(scan.token) >= 4; scan.scan() { + // TODO: measure the impact of needing this conversion and redesign + // the data structure if there is an issue. + v, ok := variantIndex[string(scan.token)] + if !ok { + // unknown variant + // TODO: allow user-defined variants? + scan.gobble(NewValueError(scan.token)) + continue + } + varID = append(varID, v) + variant = append(variant, scan.token) + if !needSort { + if last < int(v) { + last = int(v) + } else { + needSort = true + // There is no legal combinations of more than 7 variants + // (and this is by no means a useful sequence). + const maxVariants = 8 + if len(varID) > maxVariants { + break + } + } + } + end = scan.end + } + if needSort { + sort.Sort(variantsSort{varID, variant}) + k, l := 0, -1 + for i, v := range varID { + w := int(v) + if l == w { + // Remove duplicates. + continue + } + varID[k] = varID[i] + variant[k] = variant[i] + k++ + l = w + } + if str := bytes.Join(variant[:k], separator); len(str) == 0 { + end = start - 1 + } else { + scan.resizeRange(start, end, len(str)) + copy(scan.b[scan.start:], str) + end = scan.end + } + } + return end +} + +type variantsSort struct { + i []uint8 + v [][]byte +} + +func (s variantsSort) Len() int { + return len(s.i) +} + +func (s variantsSort) Swap(i, j int) { + s.i[i], s.i[j] = s.i[j], s.i[i] + s.v[i], s.v[j] = s.v[j], s.v[i] +} + +func (s variantsSort) Less(i, j int) bool { + return s.i[i] < s.i[j] +} + +type bytesSort struct { + b [][]byte + n int // first n bytes to compare +} + +func (b bytesSort) Len() int { + return len(b.b) +} + +func (b bytesSort) Swap(i, j int) { + b.b[i], b.b[j] = b.b[j], b.b[i] +} + +func (b bytesSort) Less(i, j int) bool { + for k := 0; k < b.n; k++ { + if b.b[i][k] == b.b[j][k] { + continue + } + return b.b[i][k] < b.b[j][k] + } + return false +} + +// parseExtensions parses and normalizes the extensions in the buffer. +// It returns the last position of scan.b that is part of any extension. +// It also trims scan.b to remove excess parts accordingly. +func parseExtensions(scan *scanner) int { + start := scan.start + exts := [][]byte{} + private := []byte{} + end := scan.end + for len(scan.token) == 1 { + extStart := scan.start + ext := scan.token[0] + end = parseExtension(scan) + extension := scan.b[extStart:end] + if len(extension) < 3 || (ext != 'x' && len(extension) < 4) { + scan.setError(ErrSyntax) + end = extStart + continue + } else if start == extStart && (ext == 'x' || scan.start == len(scan.b)) { + scan.b = scan.b[:end] + return end + } else if ext == 'x' { + private = extension + break + } + exts = append(exts, extension) + } + sort.Sort(bytesSort{exts, 1}) + if len(private) > 0 { + exts = append(exts, private) + } + scan.b = scan.b[:start] + if len(exts) > 0 { + scan.b = append(scan.b, bytes.Join(exts, separator)...) + } else if start > 0 { + // Strip trailing '-'. + scan.b = scan.b[:start-1] + } + return end +} + +// parseExtension parses a single extension and returns the position of +// the extension end. +func parseExtension(scan *scanner) int { + start, end := scan.start, scan.end + switch scan.token[0] { + case 'u': // https://www.ietf.org/rfc/rfc6067.txt + attrStart := end + scan.scan() + for last := []byte{}; len(scan.token) > 2; scan.scan() { + if bytes.Compare(scan.token, last) != -1 { + // Attributes are unsorted. Start over from scratch. + p := attrStart + 1 + scan.next = p + attrs := [][]byte{} + for scan.scan(); len(scan.token) > 2; scan.scan() { + attrs = append(attrs, scan.token) + end = scan.end + } + sort.Sort(bytesSort{attrs, 3}) + copy(scan.b[p:], bytes.Join(attrs, separator)) + break + } + last = scan.token + end = scan.end + } + // Scan key-type sequences. A key is of length 2 and may be followed + // by 0 or more "type" subtags from 3 to the maximum of 8 letters. + var last, key []byte + for attrEnd := end; len(scan.token) == 2; last = key { + key = scan.token + end = scan.end + for scan.scan(); end < scan.end && len(scan.token) > 2; scan.scan() { + end = scan.end + } + // TODO: check key value validity + if bytes.Compare(key, last) != 1 || scan.err != nil { + // We have an invalid key or the keys are not sorted. + // Start scanning keys from scratch and reorder. + p := attrEnd + 1 + scan.next = p + keys := [][]byte{} + for scan.scan(); len(scan.token) == 2; { + keyStart := scan.start + end = scan.end + for scan.scan(); end < scan.end && len(scan.token) > 2; scan.scan() { + end = scan.end + } + keys = append(keys, scan.b[keyStart:end]) + } + sort.Stable(bytesSort{keys, 2}) + if n := len(keys); n > 0 { + k := 0 + for i := 1; i < n; i++ { + if !bytes.Equal(keys[k][:2], keys[i][:2]) { + k++ + keys[k] = keys[i] + } else if !bytes.Equal(keys[k], keys[i]) { + scan.setError(ErrDuplicateKey) + } + } + keys = keys[:k+1] + } + reordered := bytes.Join(keys, separator) + if e := p + len(reordered); e < end { + scan.deleteRange(e, end) + end = e + } + copy(scan.b[p:], reordered) + break + } + } + case 't': // https://www.ietf.org/rfc/rfc6497.txt + scan.scan() + if n := len(scan.token); n >= 2 && n <= 3 && isAlpha(scan.token[1]) { + _, end = parseTag(scan, false) + scan.toLower(start, end) + } + for len(scan.token) == 2 && !isAlpha(scan.token[1]) { + end = scan.acceptMinSize(3) + } + case 'x': + end = scan.acceptMinSize(1) + default: + end = scan.acceptMinSize(2) + } + return end +} + +// getExtension returns the name, body and end position of the extension. +func getExtension(s string, p int) (end int, ext string) { + if s[p] == '-' { + p++ + } + if s[p] == 'x' { + return len(s), s[p:] + } + end = nextExtension(s, p) + return end, s[p:end] +} + +// nextExtension finds the next extension within the string, searching +// for the -- pattern from position p. +// In the fast majority of cases, language tags will have at most +// one extension and extensions tend to be small. +func nextExtension(s string, p int) int { + for n := len(s) - 3; p < n; { + if s[p] == '-' { + if s[p+2] == '-' { + return p + } + p += 3 + } else { + p++ + } + } + return len(s) +} diff --git a/vendor/golang.org/x/text/internal/language/tables.go b/vendor/golang.org/x/text/internal/language/tables.go new file mode 100644 index 00000000..fb6b5837 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/tables.go @@ -0,0 +1,3472 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +package language + +import "golang.org/x/text/internal/tag" + +// CLDRVersion is the CLDR version from which the tables in this package are derived. +const CLDRVersion = "32" + +const NumLanguages = 8752 + +const NumScripts = 258 + +const NumRegions = 357 + +type FromTo struct { + From uint16 + To uint16 +} + +const nonCanonicalUnd = 1201 +const ( + _af = 22 + _am = 39 + _ar = 58 + _az = 88 + _bg = 126 + _bn = 165 + _ca = 215 + _cs = 250 + _da = 257 + _de = 269 + _el = 310 + _en = 313 + _es = 318 + _et = 320 + _fa = 328 + _fi = 337 + _fil = 339 + _fr = 350 + _gu = 420 + _he = 444 + _hi = 446 + _hr = 465 + _hu = 469 + _hy = 471 + _id = 481 + _is = 504 + _it = 505 + _ja = 512 + _ka = 528 + _kk = 578 + _km = 586 + _kn = 593 + _ko = 596 + _ky = 650 + _lo = 696 + _lt = 704 + _lv = 711 + _mk = 767 + _ml = 772 + _mn = 779 + _mo = 784 + _mr = 795 + _ms = 799 + _mul = 806 + _my = 817 + _nb = 839 + _ne = 849 + _nl = 871 + _no = 879 + _pa = 925 + _pl = 947 + _pt = 960 + _ro = 988 + _ru = 994 + _sh = 1031 + _si = 1036 + _sk = 1042 + _sl = 1046 + _sq = 1073 + _sr = 1074 + _sv = 1092 + _sw = 1093 + _ta = 1104 + _te = 1121 + _th = 1131 + _tl = 1146 + _tn = 1152 + _tr = 1162 + _uk = 1198 + _ur = 1204 + _uz = 1212 + _vi = 1219 + _zh = 1321 + _zu = 1327 + _jbo = 515 + _ami = 1650 + _bnn = 2357 + _hak = 438 + _tlh = 14467 + _lb = 661 + _nv = 899 + _pwn = 12055 + _tao = 14188 + _tay = 14198 + _tsu = 14662 + _nn = 874 + _sfb = 13629 + _vgt = 15701 + _sgg = 13660 + _cmn = 3007 + _nan = 835 + _hsn = 467 +) + +const langPrivateStart = 0x2f72 + +const langPrivateEnd = 0x3179 + +// lang holds an alphabetically sorted list of ISO-639 language identifiers. +// All entries are 4 bytes. The index of the identifier (divided by 4) is the language tag. +// For 2-byte language identifiers, the two successive bytes have the following meaning: +// - if the first letter of the 2- and 3-letter ISO codes are the same: +// the second and third letter of the 3-letter ISO code. +// - otherwise: a 0 and a by 2 bits right-shifted index into altLangISO3. +// +// For 3-byte language identifiers the 4th byte is 0. +const lang tag.Index = "" + // Size: 5324 bytes + "---\x00aaaraai\x00aak\x00aau\x00abbkabi\x00abq\x00abr\x00abt\x00aby\x00a" + + "cd\x00ace\x00ach\x00ada\x00ade\x00adj\x00ady\x00adz\x00aeveaeb\x00aey" + + "\x00affragc\x00agd\x00agg\x00agm\x00ago\x00agq\x00aha\x00ahl\x00aho\x00a" + + "jg\x00akkaakk\x00ala\x00ali\x00aln\x00alt\x00ammhamm\x00amn\x00amo\x00am" + + "p\x00anrganc\x00ank\x00ann\x00any\x00aoj\x00aom\x00aoz\x00apc\x00apd\x00" + + "ape\x00apr\x00aps\x00apz\x00arraarc\x00arh\x00arn\x00aro\x00arq\x00ars" + + "\x00ary\x00arz\x00assmasa\x00ase\x00asg\x00aso\x00ast\x00ata\x00atg\x00a" + + "tj\x00auy\x00avvaavl\x00avn\x00avt\x00avu\x00awa\x00awb\x00awo\x00awx" + + "\x00ayymayb\x00azzebaakbal\x00ban\x00bap\x00bar\x00bas\x00bav\x00bax\x00" + + "bba\x00bbb\x00bbc\x00bbd\x00bbj\x00bbp\x00bbr\x00bcf\x00bch\x00bci\x00bc" + + "m\x00bcn\x00bco\x00bcq\x00bcu\x00bdd\x00beelbef\x00beh\x00bej\x00bem\x00" + + "bet\x00bew\x00bex\x00bez\x00bfd\x00bfq\x00bft\x00bfy\x00bgulbgc\x00bgn" + + "\x00bgx\x00bhihbhb\x00bhg\x00bhi\x00bhk\x00bhl\x00bho\x00bhy\x00biisbib" + + "\x00big\x00bik\x00bim\x00bin\x00bio\x00biq\x00bjh\x00bji\x00bjj\x00bjn" + + "\x00bjo\x00bjr\x00bjt\x00bjz\x00bkc\x00bkm\x00bkq\x00bku\x00bkv\x00blt" + + "\x00bmambmh\x00bmk\x00bmq\x00bmu\x00bnenbng\x00bnm\x00bnp\x00boodboj\x00" + + "bom\x00bon\x00bpy\x00bqc\x00bqi\x00bqp\x00bqv\x00brrebra\x00brh\x00brx" + + "\x00brz\x00bsosbsj\x00bsq\x00bss\x00bst\x00bto\x00btt\x00btv\x00bua\x00b" + + "uc\x00bud\x00bug\x00buk\x00bum\x00buo\x00bus\x00buu\x00bvb\x00bwd\x00bwr" + + "\x00bxh\x00bye\x00byn\x00byr\x00bys\x00byv\x00byx\x00bza\x00bze\x00bzf" + + "\x00bzh\x00bzw\x00caatcan\x00cbj\x00cch\x00ccp\x00ceheceb\x00cfa\x00cgg" + + "\x00chhachk\x00chm\x00cho\x00chp\x00chr\x00cja\x00cjm\x00cjv\x00ckb\x00c" + + "kl\x00cko\x00cky\x00cla\x00cme\x00cmg\x00cooscop\x00cps\x00crrecrh\x00cr" + + "j\x00crk\x00crl\x00crm\x00crs\x00csescsb\x00csw\x00ctd\x00cuhucvhvcyymda" + + "andad\x00daf\x00dag\x00dah\x00dak\x00dar\x00dav\x00dbd\x00dbq\x00dcc\x00" + + "ddn\x00deeuded\x00den\x00dga\x00dgh\x00dgi\x00dgl\x00dgr\x00dgz\x00dia" + + "\x00dje\x00dnj\x00dob\x00doi\x00dop\x00dow\x00dri\x00drs\x00dsb\x00dtm" + + "\x00dtp\x00dts\x00dty\x00dua\x00duc\x00dud\x00dug\x00dvivdva\x00dww\x00d" + + "yo\x00dyu\x00dzzodzg\x00ebu\x00eeweefi\x00egl\x00egy\x00eka\x00eky\x00el" + + "llema\x00emi\x00enngenn\x00enq\x00eopoeri\x00es\x00\x05esu\x00etstetr" + + "\x00ett\x00etu\x00etx\x00euusewo\x00ext\x00faasfaa\x00fab\x00fag\x00fai" + + "\x00fan\x00ffulffi\x00ffm\x00fiinfia\x00fil\x00fit\x00fjijflr\x00fmp\x00" + + "foaofod\x00fon\x00for\x00fpe\x00fqs\x00frrafrc\x00frp\x00frr\x00frs\x00f" + + "ub\x00fud\x00fue\x00fuf\x00fuh\x00fuq\x00fur\x00fuv\x00fuy\x00fvr\x00fyr" + + "ygalegaa\x00gaf\x00gag\x00gah\x00gaj\x00gam\x00gan\x00gaw\x00gay\x00gba" + + "\x00gbf\x00gbm\x00gby\x00gbz\x00gcr\x00gdlagde\x00gdn\x00gdr\x00geb\x00g" + + "ej\x00gel\x00gez\x00gfk\x00ggn\x00ghs\x00gil\x00gim\x00gjk\x00gjn\x00gju" + + "\x00gkn\x00gkp\x00gllgglk\x00gmm\x00gmv\x00gnrngnd\x00gng\x00god\x00gof" + + "\x00goi\x00gom\x00gon\x00gor\x00gos\x00got\x00grb\x00grc\x00grt\x00grw" + + "\x00gsw\x00guujgub\x00guc\x00gud\x00gur\x00guw\x00gux\x00guz\x00gvlvgvf" + + "\x00gvr\x00gvs\x00gwc\x00gwi\x00gwt\x00gyi\x00haauhag\x00hak\x00ham\x00h" + + "aw\x00haz\x00hbb\x00hdy\x00heebhhy\x00hiinhia\x00hif\x00hig\x00hih\x00hi" + + "l\x00hla\x00hlu\x00hmd\x00hmt\x00hnd\x00hne\x00hnj\x00hnn\x00hno\x00homo" + + "hoc\x00hoj\x00hot\x00hrrvhsb\x00hsn\x00htathuunhui\x00hyyehzerianaian" + + "\x00iar\x00iba\x00ibb\x00iby\x00ica\x00ich\x00idndidd\x00idi\x00idu\x00i" + + "eleife\x00igboigb\x00ige\x00iiiiijj\x00ikpkikk\x00ikt\x00ikw\x00ikx\x00i" + + "lo\x00imo\x00inndinh\x00iodoiou\x00iri\x00isslittaiukuiw\x00\x03iwm\x00i" + + "ws\x00izh\x00izi\x00japnjab\x00jam\x00jbo\x00jbu\x00jen\x00jgk\x00jgo" + + "\x00ji\x00\x06jib\x00jmc\x00jml\x00jra\x00jut\x00jvavjwavkaatkaa\x00kab" + + "\x00kac\x00kad\x00kai\x00kaj\x00kam\x00kao\x00kbd\x00kbm\x00kbp\x00kbq" + + "\x00kbx\x00kby\x00kcg\x00kck\x00kcl\x00kct\x00kde\x00kdh\x00kdl\x00kdt" + + "\x00kea\x00ken\x00kez\x00kfo\x00kfr\x00kfy\x00kgonkge\x00kgf\x00kgp\x00k" + + "ha\x00khb\x00khn\x00khq\x00khs\x00kht\x00khw\x00khz\x00kiikkij\x00kiu" + + "\x00kiw\x00kjuakjd\x00kjg\x00kjs\x00kjy\x00kkazkkc\x00kkj\x00klalkln\x00" + + "klq\x00klt\x00klx\x00kmhmkmb\x00kmh\x00kmo\x00kms\x00kmu\x00kmw\x00knank" + + "nf\x00knp\x00koorkoi\x00kok\x00kol\x00kos\x00koz\x00kpe\x00kpf\x00kpo" + + "\x00kpr\x00kpx\x00kqb\x00kqf\x00kqs\x00kqy\x00kraukrc\x00kri\x00krj\x00k" + + "rl\x00krs\x00kru\x00ksasksb\x00ksd\x00ksf\x00ksh\x00ksj\x00ksr\x00ktb" + + "\x00ktm\x00kto\x00kuurkub\x00kud\x00kue\x00kuj\x00kum\x00kun\x00kup\x00k" + + "us\x00kvomkvg\x00kvr\x00kvx\x00kw\x00\x01kwj\x00kwo\x00kxa\x00kxc\x00kxm" + + "\x00kxp\x00kxw\x00kxz\x00kyirkye\x00kyx\x00kzr\x00laatlab\x00lad\x00lag" + + "\x00lah\x00laj\x00las\x00lbtzlbe\x00lbu\x00lbw\x00lcm\x00lcp\x00ldb\x00l" + + "ed\x00lee\x00lem\x00lep\x00leq\x00leu\x00lez\x00lguglgg\x00liimlia\x00li" + + "d\x00lif\x00lig\x00lih\x00lij\x00lis\x00ljp\x00lki\x00lkt\x00lle\x00lln" + + "\x00lmn\x00lmo\x00lmp\x00lninlns\x00lnu\x00loaoloj\x00lok\x00lol\x00lor" + + "\x00los\x00loz\x00lrc\x00ltitltg\x00luublua\x00luo\x00luy\x00luz\x00lvav" + + "lwl\x00lzh\x00lzz\x00mad\x00maf\x00mag\x00mai\x00mak\x00man\x00mas\x00ma" + + "w\x00maz\x00mbh\x00mbo\x00mbq\x00mbu\x00mbw\x00mci\x00mcp\x00mcq\x00mcr" + + "\x00mcu\x00mda\x00mde\x00mdf\x00mdh\x00mdj\x00mdr\x00mdx\x00med\x00mee" + + "\x00mek\x00men\x00mer\x00met\x00meu\x00mfa\x00mfe\x00mfn\x00mfo\x00mfq" + + "\x00mglgmgh\x00mgl\x00mgo\x00mgp\x00mgy\x00mhahmhi\x00mhl\x00mirimif\x00" + + "min\x00mis\x00miw\x00mkkdmki\x00mkl\x00mkp\x00mkw\x00mlalmle\x00mlp\x00m" + + "ls\x00mmo\x00mmu\x00mmx\x00mnonmna\x00mnf\x00mni\x00mnw\x00moolmoa\x00mo" + + "e\x00moh\x00mos\x00mox\x00mpp\x00mps\x00mpt\x00mpx\x00mql\x00mrarmrd\x00" + + "mrj\x00mro\x00mssamtltmtc\x00mtf\x00mti\x00mtr\x00mua\x00mul\x00mur\x00m" + + "us\x00mva\x00mvn\x00mvy\x00mwk\x00mwr\x00mwv\x00mxc\x00mxm\x00myyamyk" + + "\x00mym\x00myv\x00myw\x00myx\x00myz\x00mzk\x00mzm\x00mzn\x00mzp\x00mzw" + + "\x00mzz\x00naaunac\x00naf\x00nah\x00nak\x00nan\x00nap\x00naq\x00nas\x00n" + + "bobnca\x00nce\x00ncf\x00nch\x00nco\x00ncu\x00nddendc\x00nds\x00neepneb" + + "\x00new\x00nex\x00nfr\x00ngdonga\x00ngb\x00ngl\x00nhb\x00nhe\x00nhw\x00n" + + "if\x00nii\x00nij\x00nin\x00niu\x00niy\x00niz\x00njo\x00nkg\x00nko\x00nll" + + "dnmg\x00nmz\x00nnnonnf\x00nnh\x00nnk\x00nnm\x00noornod\x00noe\x00non\x00" + + "nop\x00nou\x00nqo\x00nrblnrb\x00nsk\x00nsn\x00nso\x00nss\x00ntm\x00ntr" + + "\x00nui\x00nup\x00nus\x00nuv\x00nux\x00nvavnwb\x00nxq\x00nxr\x00nyyanym" + + "\x00nyn\x00nzi\x00occiogc\x00ojjiokr\x00okv\x00omrmong\x00onn\x00ons\x00" + + "opm\x00orrioro\x00oru\x00osssosa\x00ota\x00otk\x00ozm\x00paanpag\x00pal" + + "\x00pam\x00pap\x00pau\x00pbi\x00pcd\x00pcm\x00pdc\x00pdt\x00ped\x00peo" + + "\x00pex\x00pfl\x00phl\x00phn\x00pilipil\x00pip\x00pka\x00pko\x00plolpla" + + "\x00pms\x00png\x00pnn\x00pnt\x00pon\x00ppo\x00pra\x00prd\x00prg\x00psusp" + + "ss\x00ptorptp\x00puu\x00pwa\x00quuequc\x00qug\x00rai\x00raj\x00rao\x00rc" + + "f\x00rej\x00rel\x00res\x00rgn\x00rhg\x00ria\x00rif\x00rjs\x00rkt\x00rmoh" + + "rmf\x00rmo\x00rmt\x00rmu\x00rnunrna\x00rng\x00roonrob\x00rof\x00roo\x00r" + + "ro\x00rtm\x00ruusrue\x00rug\x00rw\x00\x04rwk\x00rwo\x00ryu\x00saansaf" + + "\x00sah\x00saq\x00sas\x00sat\x00sav\x00saz\x00sba\x00sbe\x00sbp\x00scrds" + + "ck\x00scl\x00scn\x00sco\x00scs\x00sdndsdc\x00sdh\x00semesef\x00seh\x00se" + + "i\x00ses\x00sgagsga\x00sgs\x00sgw\x00sgz\x00sh\x00\x02shi\x00shk\x00shn" + + "\x00shu\x00siinsid\x00sig\x00sil\x00sim\x00sjr\x00sklkskc\x00skr\x00sks" + + "\x00sllvsld\x00sli\x00sll\x00sly\x00smmosma\x00smi\x00smj\x00smn\x00smp" + + "\x00smq\x00sms\x00snnasnc\x00snk\x00snp\x00snx\x00sny\x00soomsok\x00soq" + + "\x00sou\x00soy\x00spd\x00spl\x00sps\x00sqqisrrpsrb\x00srn\x00srr\x00srx" + + "\x00ssswssd\x00ssg\x00ssy\x00stotstk\x00stq\x00suunsua\x00sue\x00suk\x00" + + "sur\x00sus\x00svweswwaswb\x00swc\x00swg\x00swp\x00swv\x00sxn\x00sxw\x00s" + + "yl\x00syr\x00szl\x00taamtaj\x00tal\x00tan\x00taq\x00tbc\x00tbd\x00tbf" + + "\x00tbg\x00tbo\x00tbw\x00tbz\x00tci\x00tcy\x00tdd\x00tdg\x00tdh\x00teelt" + + "ed\x00tem\x00teo\x00tet\x00tfi\x00tggktgc\x00tgo\x00tgu\x00thhathl\x00th" + + "q\x00thr\x00tiirtif\x00tig\x00tik\x00tim\x00tio\x00tiv\x00tkuktkl\x00tkr" + + "\x00tkt\x00tlgltlf\x00tlx\x00tly\x00tmh\x00tmy\x00tnsntnh\x00toontof\x00" + + "tog\x00toq\x00tpi\x00tpm\x00tpz\x00tqo\x00trurtru\x00trv\x00trw\x00tssot" + + "sd\x00tsf\x00tsg\x00tsj\x00tsw\x00ttatttd\x00tte\x00ttj\x00ttr\x00tts" + + "\x00ttt\x00tuh\x00tul\x00tum\x00tuq\x00tvd\x00tvl\x00tvu\x00twwitwh\x00t" + + "wq\x00txg\x00tyahtya\x00tyv\x00tzm\x00ubu\x00udm\x00ugiguga\x00ukkruli" + + "\x00umb\x00und\x00unr\x00unx\x00urrduri\x00urt\x00urw\x00usa\x00utr\x00u" + + "vh\x00uvl\x00uzzbvag\x00vai\x00van\x00veenvec\x00vep\x00viievic\x00viv" + + "\x00vls\x00vmf\x00vmw\x00voolvot\x00vro\x00vun\x00vut\x00walnwae\x00waj" + + "\x00wal\x00wan\x00war\x00wbp\x00wbq\x00wbr\x00wci\x00wer\x00wgi\x00whg" + + "\x00wib\x00wiu\x00wiv\x00wja\x00wji\x00wls\x00wmo\x00wnc\x00wni\x00wnu" + + "\x00woolwob\x00wos\x00wrs\x00wsk\x00wtm\x00wuu\x00wuv\x00wwa\x00xav\x00x" + + "bi\x00xcr\x00xes\x00xhhoxla\x00xlc\x00xld\x00xmf\x00xmn\x00xmr\x00xna" + + "\x00xnr\x00xog\x00xon\x00xpr\x00xrb\x00xsa\x00xsi\x00xsm\x00xsr\x00xwe" + + "\x00yam\x00yao\x00yap\x00yas\x00yat\x00yav\x00yay\x00yaz\x00yba\x00ybb" + + "\x00yby\x00yer\x00ygr\x00ygw\x00yiidyko\x00yle\x00ylg\x00yll\x00yml\x00y" + + "ooryon\x00yrb\x00yre\x00yrl\x00yss\x00yua\x00yue\x00yuj\x00yut\x00yuw" + + "\x00zahazag\x00zbl\x00zdj\x00zea\x00zgh\x00zhhozhx\x00zia\x00zlm\x00zmi" + + "\x00zne\x00zuulzxx\x00zza\x00\xff\xff\xff\xff" + +const langNoIndexOffset = 1330 + +// langNoIndex is a bit vector of all 3-letter language codes that are not used as an index +// in lookup tables. The language ids for these language codes are derived directly +// from the letters and are not consecutive. +// Size: 2197 bytes, 2197 elements +var langNoIndex = [2197]uint8{ + // Entry 0 - 3F + 0xff, 0xf8, 0xed, 0xfe, 0xeb, 0xd3, 0x3b, 0xd2, + 0xfb, 0xbf, 0x7a, 0xfa, 0x37, 0x1d, 0x3c, 0x57, + 0x6e, 0x97, 0x73, 0x38, 0xfb, 0xea, 0xbf, 0x70, + 0xad, 0x03, 0xff, 0xff, 0xcf, 0x05, 0x84, 0x62, + 0xe9, 0xbf, 0xfd, 0xbf, 0xbf, 0xf7, 0xfd, 0x77, + 0x0f, 0xff, 0xef, 0x6f, 0xff, 0xfb, 0xdf, 0xe2, + 0xc9, 0xf8, 0x7f, 0x7e, 0x4d, 0xbc, 0x0a, 0x6a, + 0x7c, 0xea, 0xe3, 0xfa, 0x7a, 0xbf, 0x67, 0xff, + // Entry 40 - 7F + 0xff, 0xff, 0xff, 0xdf, 0x2a, 0x54, 0x91, 0xc0, + 0x5d, 0xe3, 0x97, 0x14, 0x07, 0x20, 0xdd, 0xed, + 0x9f, 0x3f, 0xc9, 0x21, 0xf8, 0x3f, 0x94, 0x35, + 0x7c, 0x5f, 0xff, 0x5f, 0x8e, 0x6e, 0xdf, 0xff, + 0xff, 0xff, 0x55, 0x7c, 0xd3, 0xfd, 0xbf, 0xb5, + 0x7b, 0xdf, 0x7f, 0xf7, 0xca, 0xfe, 0xdb, 0xa3, + 0xa8, 0xff, 0x1f, 0x67, 0x7d, 0xeb, 0xef, 0xce, + 0xff, 0xff, 0x9f, 0xff, 0xb7, 0xef, 0xfe, 0xcf, + // Entry 80 - BF + 0xdb, 0xff, 0xf3, 0xcd, 0xfb, 0x6f, 0xff, 0xff, + 0xbb, 0xee, 0xf7, 0xbd, 0xdb, 0xff, 0x5f, 0xf7, + 0xfd, 0xf2, 0xfd, 0xff, 0x5e, 0x2f, 0x3b, 0xba, + 0x7e, 0xff, 0xff, 0xfe, 0xf7, 0xff, 0xdd, 0xff, + 0xfd, 0xdf, 0xfb, 0xfe, 0x9d, 0xb4, 0xd3, 0xff, + 0xef, 0xff, 0xdf, 0xf7, 0x7f, 0xb7, 0xfd, 0xd5, + 0xa5, 0x77, 0x40, 0xff, 0x9c, 0xc1, 0x41, 0x2c, + 0x08, 0x21, 0x41, 0x00, 0x50, 0x40, 0x00, 0x80, + // Entry C0 - FF + 0xfb, 0x4a, 0xf2, 0x9f, 0xb4, 0x42, 0x41, 0x96, + 0x1b, 0x14, 0x08, 0xf3, 0x2b, 0xe7, 0x17, 0x56, + 0x05, 0x7d, 0x0e, 0x1c, 0x37, 0x7b, 0xf3, 0xef, + 0x97, 0xff, 0x5d, 0x38, 0x64, 0x08, 0x00, 0x10, + 0xbc, 0x85, 0xaf, 0xdf, 0xff, 0xff, 0x7b, 0x35, + 0x3e, 0xc7, 0xc7, 0xdf, 0xff, 0x01, 0x81, 0x00, + 0xb0, 0x05, 0x80, 0x00, 0x00, 0x00, 0x00, 0x03, + 0x40, 0x00, 0x40, 0x92, 0x21, 0x50, 0xb1, 0x5d, + // Entry 100 - 13F + 0xfd, 0xdc, 0xbe, 0x5e, 0x00, 0x00, 0x02, 0x64, + 0x0d, 0x19, 0x41, 0xdf, 0x79, 0x22, 0x00, 0x00, + 0x00, 0x5e, 0x64, 0xdc, 0x24, 0xe5, 0xd9, 0xe3, + 0xfe, 0xff, 0xfd, 0xcb, 0x9f, 0x14, 0x41, 0x0c, + 0x86, 0x00, 0xd1, 0x00, 0xf0, 0xc7, 0x67, 0x5f, + 0x56, 0x99, 0x5e, 0xb5, 0x6c, 0xaf, 0x03, 0x00, + 0x02, 0x00, 0x00, 0x00, 0xc0, 0x37, 0xda, 0x56, + 0x90, 0x69, 0x01, 0x2c, 0x96, 0x69, 0x20, 0xfb, + // Entry 140 - 17F + 0xff, 0x3f, 0x00, 0x00, 0x00, 0x01, 0x0c, 0x16, + 0x03, 0x00, 0x00, 0xb0, 0x14, 0x03, 0x50, 0x06, + 0x0a, 0x00, 0x01, 0x00, 0x00, 0x10, 0x11, 0x09, + 0x00, 0x00, 0x60, 0x10, 0x00, 0x00, 0x00, 0x10, + 0x00, 0x00, 0x44, 0x00, 0x00, 0x10, 0x00, 0x04, + 0x08, 0x00, 0x00, 0x05, 0x00, 0x80, 0x28, 0x04, + 0x00, 0x00, 0x40, 0xd5, 0x2d, 0x00, 0x64, 0x35, + 0x24, 0x52, 0xf4, 0xd5, 0xbf, 0x62, 0xc9, 0x03, + // Entry 180 - 1BF + 0x00, 0x80, 0x00, 0x40, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x04, 0x13, 0x39, 0x01, 0xdd, 0x57, 0x98, + 0x21, 0x18, 0x81, 0x00, 0x00, 0x01, 0x40, 0x82, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x01, 0x40, 0x00, 0x44, 0x00, 0x00, 0x80, 0xea, + 0xa9, 0x39, 0x00, 0x02, 0x00, 0x00, 0x00, 0x04, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x02, 0x00, 0x00, 0x00, + // Entry 1C0 - 1FF + 0x00, 0x03, 0x28, 0x05, 0x00, 0x00, 0x00, 0x00, + 0x04, 0x20, 0x04, 0xa6, 0x00, 0x04, 0x00, 0x00, + 0x81, 0x50, 0x00, 0x00, 0x00, 0x11, 0x84, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x55, + 0x02, 0x10, 0x08, 0x04, 0x00, 0x00, 0x00, 0x40, + 0x30, 0x83, 0x01, 0x00, 0x00, 0x00, 0x11, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x1e, 0xcd, 0xbf, 0x7a, 0xbf, + // Entry 200 - 23F + 0xdf, 0xc3, 0x83, 0x82, 0xc0, 0xfb, 0x57, 0x27, + 0xed, 0x55, 0xe7, 0x01, 0x00, 0x20, 0xb2, 0xc5, + 0xa4, 0x45, 0x25, 0x9b, 0x02, 0xdf, 0xe1, 0xdf, + 0x03, 0x44, 0x08, 0x90, 0x01, 0x04, 0x81, 0xe3, + 0x92, 0x54, 0xdb, 0x28, 0xd3, 0x5f, 0xfe, 0x6d, + 0x79, 0xed, 0x1c, 0x7d, 0x04, 0x08, 0x00, 0x01, + 0x21, 0x12, 0x64, 0x5f, 0xdd, 0x0e, 0x85, 0x4f, + 0x40, 0x40, 0x00, 0x04, 0xf1, 0xfd, 0x3d, 0x54, + // Entry 240 - 27F + 0xe8, 0x03, 0xb4, 0x27, 0x23, 0x0d, 0x00, 0x00, + 0x20, 0x7b, 0x78, 0x02, 0x07, 0x84, 0x00, 0xf0, + 0xbb, 0x7e, 0x5a, 0x00, 0x18, 0x04, 0x81, 0x00, + 0x00, 0x00, 0x80, 0x10, 0x90, 0x1c, 0x01, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x10, 0x40, 0x00, 0x04, + 0x08, 0xa0, 0x70, 0xa5, 0x0c, 0x40, 0x00, 0x00, + 0x91, 0x24, 0x04, 0x68, 0x00, 0x20, 0x70, 0xff, + 0x7b, 0x7f, 0x70, 0x00, 0x05, 0x9b, 0xdd, 0x66, + // Entry 280 - 2BF + 0x03, 0x00, 0x11, 0x00, 0x00, 0x00, 0x40, 0x05, + 0xb5, 0xb6, 0x80, 0x08, 0x04, 0x00, 0x04, 0x51, + 0xe2, 0xef, 0xfd, 0x3f, 0x05, 0x09, 0x08, 0x05, + 0x40, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00, + 0x0c, 0x00, 0x00, 0x00, 0x00, 0x81, 0x00, 0x60, + 0xe7, 0x48, 0x00, 0x81, 0x20, 0xc0, 0x05, 0x80, + 0x03, 0x00, 0x00, 0x00, 0x8c, 0x50, 0x40, 0x04, + 0x84, 0x47, 0x84, 0x40, 0x20, 0x10, 0x00, 0x20, + // Entry 2C0 - 2FF + 0x02, 0x50, 0x80, 0x11, 0x00, 0x91, 0x6c, 0xe2, + 0x50, 0x27, 0x1d, 0x11, 0x29, 0x06, 0x59, 0xe9, + 0x33, 0x08, 0x00, 0x20, 0x04, 0x40, 0x10, 0x00, + 0x00, 0x00, 0x50, 0x44, 0x92, 0x49, 0xd6, 0x5d, + 0xa7, 0x81, 0x47, 0x97, 0xfb, 0x00, 0x10, 0x00, + 0x08, 0x00, 0x80, 0x00, 0x40, 0x04, 0x00, 0x01, + 0x02, 0x00, 0x01, 0x40, 0x80, 0x00, 0x00, 0x08, + 0xd8, 0xeb, 0xf6, 0x39, 0xc4, 0x8d, 0x12, 0x00, + // Entry 300 - 33F + 0x00, 0x0c, 0x04, 0x01, 0x20, 0x20, 0xdd, 0xa0, + 0x01, 0x00, 0x00, 0x00, 0x12, 0x00, 0x00, 0x00, + 0x04, 0x10, 0xd0, 0x9d, 0x95, 0x13, 0x04, 0x80, + 0x00, 0x01, 0xd0, 0x16, 0x40, 0x00, 0x10, 0xb0, + 0x10, 0x62, 0x4c, 0xd2, 0x02, 0x01, 0x4a, 0x00, + 0x46, 0x04, 0x00, 0x08, 0x02, 0x00, 0x20, 0x80, + 0x00, 0x80, 0x06, 0x00, 0x08, 0x00, 0x00, 0x00, + 0x00, 0xf0, 0xd8, 0x6f, 0x15, 0x02, 0x08, 0x00, + // Entry 340 - 37F + 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x10, 0x01, + 0x00, 0x10, 0x00, 0x00, 0x00, 0xf0, 0x84, 0xe3, + 0xdd, 0xbf, 0xf9, 0xf9, 0x3b, 0x7f, 0x7f, 0xdb, + 0xfd, 0xfc, 0xfe, 0xdf, 0xff, 0xfd, 0xff, 0xf6, + 0xfb, 0xfc, 0xf7, 0x1f, 0xff, 0xb3, 0x6c, 0xff, + 0xd9, 0xad, 0xdf, 0xfe, 0xef, 0xba, 0xdf, 0xff, + 0xff, 0xff, 0xb7, 0xdd, 0x7d, 0xbf, 0xab, 0x7f, + 0xfd, 0xfd, 0xdf, 0x2f, 0x9c, 0xdf, 0xf3, 0x6f, + // Entry 380 - 3BF + 0xdf, 0xdd, 0xff, 0xfb, 0xee, 0xd2, 0xab, 0x5f, + 0xd5, 0xdf, 0x7f, 0xff, 0xeb, 0xff, 0xe4, 0x4d, + 0xf9, 0xff, 0xfe, 0xf7, 0xfd, 0xdf, 0xfb, 0xbf, + 0xee, 0xdb, 0x6f, 0xef, 0xff, 0x7f, 0xff, 0xff, + 0xf7, 0x5f, 0xd3, 0x3b, 0xfd, 0xd9, 0xdf, 0xeb, + 0xbc, 0x08, 0x05, 0x24, 0xff, 0x07, 0x70, 0xfe, + 0xe6, 0x5e, 0x00, 0x08, 0x00, 0x83, 0x3d, 0x1b, + 0x06, 0xe6, 0x72, 0x60, 0xd1, 0x3c, 0x7f, 0x44, + // Entry 3C0 - 3FF + 0x02, 0x30, 0x9f, 0x7a, 0x16, 0xbd, 0x7f, 0x57, + 0xf2, 0xff, 0x31, 0xff, 0xf2, 0x1e, 0x90, 0xf7, + 0xf1, 0xf9, 0x45, 0x80, 0x01, 0x02, 0x00, 0x00, + 0x40, 0x54, 0x9f, 0x8a, 0xdb, 0xf9, 0x2e, 0x11, + 0x86, 0x51, 0xc0, 0xf3, 0xfb, 0x47, 0x40, 0x01, + 0x05, 0xd1, 0x50, 0x5c, 0x00, 0x40, 0x00, 0x10, + 0x04, 0x02, 0x00, 0x00, 0x0a, 0x00, 0x17, 0xd2, + 0xb9, 0xfd, 0xfc, 0xba, 0xfe, 0xef, 0xc7, 0xbe, + // Entry 400 - 43F + 0x53, 0x6f, 0xdf, 0xe7, 0xdb, 0x65, 0xbb, 0x7f, + 0xfa, 0xff, 0x77, 0xf3, 0xef, 0xbf, 0xfd, 0xf7, + 0xdf, 0xdf, 0x9b, 0x7f, 0xff, 0xff, 0x7f, 0x6f, + 0xf7, 0xfb, 0xeb, 0xdf, 0xbc, 0xff, 0xbf, 0x6b, + 0x7b, 0xfb, 0xff, 0xce, 0x76, 0xbd, 0xf7, 0xf7, + 0xdf, 0xdc, 0xf7, 0xf7, 0xff, 0xdf, 0xf3, 0xfe, + 0xef, 0xff, 0xff, 0xff, 0xb6, 0x7f, 0x7f, 0xde, + 0xf7, 0xb9, 0xeb, 0x77, 0xff, 0xfb, 0xbf, 0xdf, + // Entry 440 - 47F + 0xfd, 0xfe, 0xfb, 0xff, 0xfe, 0xeb, 0x1f, 0x7d, + 0x2f, 0xfd, 0xb6, 0xb5, 0xa5, 0xfc, 0xff, 0xfd, + 0x7f, 0x4e, 0xbf, 0x8f, 0xae, 0xff, 0xee, 0xdf, + 0x7f, 0xf7, 0x73, 0x02, 0x02, 0x04, 0xfc, 0xf7, + 0xff, 0xb7, 0xd7, 0xef, 0xfe, 0xcd, 0xf5, 0xce, + 0xe2, 0x8e, 0xe7, 0xbf, 0xb7, 0xff, 0x56, 0xfd, + 0xcd, 0xff, 0xfb, 0xff, 0xdf, 0xd7, 0xea, 0xff, + 0xe5, 0x5f, 0x6d, 0x0f, 0xa7, 0x51, 0x06, 0xc4, + // Entry 480 - 4BF + 0x93, 0x50, 0x5d, 0xaf, 0xa6, 0xff, 0x99, 0xfb, + 0x63, 0x1d, 0x53, 0xff, 0xef, 0xb7, 0x35, 0x20, + 0x14, 0x00, 0x55, 0x51, 0x82, 0x65, 0xf5, 0x41, + 0xe2, 0xff, 0xfc, 0xdf, 0x02, 0x05, 0xc5, 0x05, + 0x00, 0x22, 0x00, 0x74, 0x69, 0x10, 0x08, 0x05, + 0x41, 0x00, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x51, 0x20, 0x05, 0x04, 0x01, 0x00, 0x00, + 0x06, 0x01, 0x20, 0x00, 0x18, 0x01, 0x92, 0xf1, + // Entry 4C0 - 4FF + 0xfd, 0x47, 0x69, 0x06, 0x95, 0x06, 0x57, 0xed, + 0xfb, 0x4d, 0x1c, 0x6b, 0x83, 0x04, 0x62, 0x40, + 0x00, 0x11, 0x42, 0x00, 0x00, 0x00, 0x54, 0x83, + 0xb8, 0x4f, 0x10, 0x8e, 0x89, 0x46, 0xde, 0xf7, + 0x13, 0x31, 0x00, 0x20, 0x00, 0x00, 0x00, 0x90, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x0a, 0x10, 0x00, + 0x01, 0x00, 0x00, 0xf0, 0x5b, 0xf4, 0xbe, 0x3d, + 0xbe, 0xcf, 0xf7, 0xaf, 0x42, 0x04, 0x84, 0x41, + // Entry 500 - 53F + 0x30, 0xff, 0x79, 0x72, 0x04, 0x00, 0x00, 0x49, + 0x2d, 0x14, 0x27, 0x57, 0xed, 0xf1, 0x3f, 0xe7, + 0x3f, 0x00, 0x00, 0x02, 0xc6, 0xa0, 0x1e, 0xf8, + 0xbb, 0xff, 0xfd, 0xfb, 0xb7, 0xfd, 0xe7, 0xf7, + 0xfd, 0xfc, 0xd5, 0xed, 0x47, 0xf4, 0x7e, 0x10, + 0x01, 0x01, 0x84, 0x6d, 0xff, 0xf7, 0xdd, 0xf9, + 0x5b, 0x05, 0x86, 0xed, 0xf5, 0x77, 0xbd, 0x3c, + 0x00, 0x00, 0x00, 0x42, 0x71, 0x42, 0x00, 0x40, + // Entry 540 - 57F + 0x00, 0x00, 0x01, 0x43, 0x19, 0x00, 0x08, 0x00, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + // Entry 580 - 5BF + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xab, 0xbd, 0xe7, 0x57, 0xee, 0x13, 0x5d, + 0x09, 0xc1, 0x40, 0x21, 0xfa, 0x17, 0x01, 0x80, + 0x00, 0x00, 0x00, 0x00, 0xf0, 0xce, 0xfb, 0xbf, + 0x00, 0x23, 0x00, 0x00, 0x00, 0x00, 0x08, 0x00, + 0x00, 0x30, 0x15, 0xa3, 0x10, 0x00, 0x00, 0x00, + 0x11, 0x04, 0x16, 0x00, 0x00, 0x02, 0x00, 0x81, + 0xa3, 0x01, 0x50, 0x00, 0x00, 0x83, 0x11, 0x40, + // Entry 5C0 - 5FF + 0x00, 0x00, 0x00, 0xf0, 0xdd, 0x7b, 0x3e, 0x02, + 0xaa, 0x10, 0x5d, 0x98, 0x52, 0x00, 0x80, 0x20, + 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x02, 0x02, + 0x19, 0x00, 0x10, 0x02, 0x10, 0x61, 0x5a, 0x9d, + 0x31, 0x00, 0x00, 0x00, 0x01, 0x18, 0x02, 0x20, + 0x00, 0x00, 0x01, 0x00, 0x42, 0x00, 0x20, 0x00, + 0x00, 0x1f, 0xdf, 0xd2, 0xb9, 0xff, 0xfd, 0x3f, + 0x1f, 0x98, 0xcf, 0x9c, 0xff, 0xaf, 0x5f, 0xfe, + // Entry 600 - 63F + 0x7b, 0x4b, 0x40, 0x10, 0xe1, 0xfd, 0xaf, 0xd9, + 0xb7, 0xf6, 0xfb, 0xb3, 0xc7, 0xff, 0x6f, 0xf1, + 0x73, 0xb1, 0x7f, 0x9f, 0x7f, 0xbd, 0xfc, 0xb7, + 0xee, 0x1c, 0xfa, 0xcb, 0xef, 0xdd, 0xf9, 0xbd, + 0x6e, 0xae, 0x55, 0xfd, 0x6e, 0x81, 0x76, 0x9f, + 0xd4, 0x77, 0xf5, 0x7d, 0xfb, 0xff, 0xeb, 0xfe, + 0xbe, 0x5f, 0x46, 0x5b, 0xe9, 0x5f, 0x50, 0x18, + 0x02, 0xfa, 0xf7, 0x9d, 0x15, 0x97, 0x05, 0x0f, + // Entry 640 - 67F + 0x75, 0xc4, 0x7d, 0x81, 0x92, 0xf5, 0x57, 0x6c, + 0xff, 0xe4, 0xef, 0x6f, 0xff, 0xfc, 0xdd, 0xde, + 0xfc, 0xfd, 0x76, 0x5f, 0x7a, 0x3f, 0x00, 0x98, + 0x02, 0xfb, 0xa3, 0xef, 0xf3, 0xd6, 0xf2, 0xff, + 0xb9, 0xda, 0x7d, 0xd0, 0x3e, 0x15, 0x7b, 0xb4, + 0xf5, 0x3e, 0xff, 0xff, 0xf1, 0xf7, 0xff, 0xe7, + 0x5f, 0xff, 0xff, 0x9e, 0xdb, 0xf6, 0xd7, 0xb9, + 0xef, 0x27, 0x80, 0xbb, 0xc5, 0xff, 0xff, 0xe3, + // Entry 680 - 6BF + 0x97, 0x9d, 0xbf, 0x9f, 0xf7, 0xc7, 0xfd, 0x37, + 0xce, 0x7f, 0x04, 0x1d, 0x73, 0x7f, 0xf8, 0xda, + 0x5d, 0xce, 0x7d, 0x06, 0xb9, 0xea, 0x79, 0xa0, + 0x1a, 0x20, 0x00, 0x30, 0x02, 0x04, 0x24, 0x08, + 0x04, 0x00, 0x00, 0x40, 0xd4, 0x02, 0x04, 0x00, + 0x00, 0x04, 0x00, 0x04, 0x00, 0x20, 0x01, 0x06, + 0x50, 0x00, 0x08, 0x00, 0x00, 0x00, 0x24, 0x00, + 0x04, 0x00, 0x10, 0xdc, 0x58, 0xd7, 0x0d, 0x0f, + // Entry 6C0 - 6FF + 0x14, 0x4d, 0xf1, 0x16, 0x44, 0xd5, 0x42, 0x08, + 0x40, 0x00, 0x00, 0x40, 0x00, 0x08, 0x00, 0x00, + 0x00, 0xdc, 0xfb, 0xcb, 0x0e, 0x58, 0x48, 0x41, + 0x24, 0x20, 0x04, 0x00, 0x30, 0x12, 0x40, 0x00, + 0x00, 0x10, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x01, 0x00, 0x00, 0x00, 0x80, 0x10, 0x10, 0xab, + 0x6d, 0x93, 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x80, 0x80, 0x25, 0x00, 0x00, + // Entry 700 - 73F + 0x00, 0x00, 0x00, 0x00, 0x0a, 0x00, 0x00, 0x00, + 0x80, 0x86, 0xc2, 0x00, 0x00, 0x00, 0x00, 0x01, + 0xff, 0x18, 0x02, 0x00, 0x02, 0xf0, 0xfd, 0x79, + 0x3b, 0x00, 0x25, 0x00, 0x00, 0x00, 0x02, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x00, + 0x03, 0x00, 0x09, 0x20, 0x00, 0x00, 0x01, 0x00, + 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x01, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 740 - 77F + 0x00, 0x00, 0x00, 0xef, 0xd5, 0xfd, 0xcf, 0x7e, + 0xb0, 0x11, 0x00, 0x00, 0x00, 0x92, 0x01, 0x44, + 0xcd, 0xf9, 0x5c, 0x00, 0x01, 0x00, 0x30, 0x04, + 0x04, 0x55, 0x00, 0x01, 0x04, 0xf4, 0x3f, 0x4a, + 0x01, 0x00, 0x00, 0xb0, 0x80, 0x20, 0x55, 0x75, + 0x97, 0x7c, 0xdf, 0x31, 0xcc, 0x68, 0xd1, 0x03, + 0xd5, 0x57, 0x27, 0x14, 0x01, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x2c, 0xf7, 0xcb, 0x1f, 0x14, 0x60, + // Entry 780 - 7BF + 0x03, 0x68, 0x01, 0x10, 0x8b, 0x38, 0x8a, 0x01, + 0x00, 0x00, 0x20, 0x00, 0x24, 0x44, 0x00, 0x00, + 0x10, 0x03, 0x11, 0x02, 0x01, 0x00, 0x00, 0xf0, + 0xf5, 0xff, 0xd5, 0x97, 0xbc, 0x70, 0xd6, 0x78, + 0x78, 0x15, 0x50, 0x01, 0xa4, 0x84, 0xa9, 0x41, + 0x00, 0x00, 0x00, 0x6b, 0x39, 0x52, 0x74, 0x00, + 0xe8, 0x30, 0x90, 0x6a, 0x92, 0x00, 0x00, 0x02, + 0xff, 0xef, 0xff, 0x4b, 0x85, 0x53, 0xf4, 0xed, + // Entry 7C0 - 7FF + 0xdd, 0xbf, 0xf2, 0x5d, 0xc7, 0x0c, 0xd5, 0x42, + 0xfc, 0xff, 0xf7, 0x1f, 0x00, 0x80, 0x40, 0x56, + 0xcc, 0x16, 0x9e, 0xea, 0x35, 0x7d, 0xef, 0xff, + 0xbd, 0xa4, 0xaf, 0x01, 0x44, 0x18, 0x01, 0x4d, + 0x4e, 0x4a, 0x08, 0x50, 0x28, 0x30, 0xe0, 0x80, + 0x10, 0x20, 0x24, 0x00, 0xff, 0x2f, 0xd3, 0x60, + 0xfe, 0x01, 0x02, 0x88, 0x0a, 0x40, 0x16, 0x01, + 0x01, 0x15, 0x2b, 0x3c, 0x01, 0x00, 0x00, 0x10, + // Entry 800 - 83F + 0x90, 0x49, 0x41, 0x02, 0x02, 0x01, 0xe1, 0xbf, + 0xbf, 0x03, 0x00, 0x00, 0x10, 0xd4, 0xa3, 0xd1, + 0x40, 0x9c, 0x44, 0xdf, 0xf5, 0x8f, 0x66, 0xb3, + 0x55, 0x20, 0xd4, 0xc1, 0xd8, 0x30, 0x3d, 0x80, + 0x00, 0x00, 0x00, 0x04, 0xd4, 0x11, 0xc5, 0x84, + 0x2f, 0x50, 0x00, 0x22, 0x50, 0x6e, 0xbd, 0x93, + 0x07, 0x00, 0x20, 0x10, 0x84, 0xb2, 0x45, 0x10, + 0x06, 0x44, 0x00, 0x00, 0x12, 0x02, 0x11, 0x00, + // Entry 840 - 87F + 0xf0, 0xfb, 0xfd, 0x7f, 0x05, 0x00, 0x16, 0x81, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x02, + 0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x02, 0x28, + 0x84, 0x00, 0x21, 0xc0, 0x23, 0x24, 0x00, 0x00, + 0x00, 0xcb, 0xe4, 0x3a, 0x46, 0x88, 0x14, 0xf1, + 0xef, 0xff, 0x7f, 0x12, 0x01, 0x01, 0x84, 0x50, + 0x07, 0xfc, 0xff, 0xff, 0x0f, 0x01, 0x00, 0x40, + 0x10, 0x38, 0x01, 0x01, 0x1c, 0x12, 0x40, 0xe1, + // Entry 880 - 8BF + 0x76, 0x16, 0x08, 0x03, 0x10, 0x00, 0x00, 0x00, + 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x24, + 0x0a, 0x00, 0x80, 0x00, 0x00, +} + +// altLangISO3 holds an alphabetically sorted list of 3-letter language code alternatives +// to 2-letter language codes that cannot be derived using the method described above. +// Each 3-letter code is followed by its 1-byte langID. +const altLangISO3 tag.Index = "---\x00cor\x00hbs\x01heb\x02kin\x03spa\x04yid\x05\xff\xff\xff\xff" + +// altLangIndex is used to convert indexes in altLangISO3 to langIDs. +// Size: 12 bytes, 6 elements +var altLangIndex = [6]uint16{ + 0x0281, 0x0407, 0x01fb, 0x03e5, 0x013e, 0x0208, +} + +// AliasMap maps langIDs to their suggested replacements. +// Size: 716 bytes, 179 elements +var AliasMap = [179]FromTo{ + 0: {From: 0x82, To: 0x88}, + 1: {From: 0x187, To: 0x1ae}, + 2: {From: 0x1f3, To: 0x1e1}, + 3: {From: 0x1fb, To: 0x1bc}, + 4: {From: 0x208, To: 0x512}, + 5: {From: 0x20f, To: 0x20e}, + 6: {From: 0x310, To: 0x3dc}, + 7: {From: 0x347, To: 0x36f}, + 8: {From: 0x407, To: 0x432}, + 9: {From: 0x47a, To: 0x153}, + 10: {From: 0x490, To: 0x451}, + 11: {From: 0x4a2, To: 0x21}, + 12: {From: 0x53e, To: 0x544}, + 13: {From: 0x58f, To: 0x12d}, + 14: {From: 0x630, To: 0x1eb1}, + 15: {From: 0x651, To: 0x431}, + 16: {From: 0x662, To: 0x431}, + 17: {From: 0x6ed, To: 0x3a}, + 18: {From: 0x6f8, To: 0x1d7}, + 19: {From: 0x709, To: 0x3625}, + 20: {From: 0x73e, To: 0x21a1}, + 21: {From: 0x7b3, To: 0x56}, + 22: {From: 0x7b9, To: 0x299b}, + 23: {From: 0x7c5, To: 0x58}, + 24: {From: 0x7e6, To: 0x145}, + 25: {From: 0x80c, To: 0x5a}, + 26: {From: 0x815, To: 0x8d}, + 27: {From: 0x87e, To: 0x810}, + 28: {From: 0x8a8, To: 0x8b7}, + 29: {From: 0x8c3, To: 0xee3}, + 30: {From: 0x8fa, To: 0x1dc}, + 31: {From: 0x9ef, To: 0x331}, + 32: {From: 0xa36, To: 0x2c5}, + 33: {From: 0xa3d, To: 0xbf}, + 34: {From: 0xabe, To: 0x3322}, + 35: {From: 0xb38, To: 0x529}, + 36: {From: 0xb75, To: 0x265a}, + 37: {From: 0xb7e, To: 0xbc3}, + 38: {From: 0xb9b, To: 0x44e}, + 39: {From: 0xbbc, To: 0x4229}, + 40: {From: 0xbbf, To: 0x529}, + 41: {From: 0xbfe, To: 0x2da7}, + 42: {From: 0xc2e, To: 0x3181}, + 43: {From: 0xcb9, To: 0xf3}, + 44: {From: 0xd08, To: 0xfa}, + 45: {From: 0xdc8, To: 0x11a}, + 46: {From: 0xdd7, To: 0x32d}, + 47: {From: 0xdf8, To: 0xdfb}, + 48: {From: 0xdfe, To: 0x531}, + 49: {From: 0xe01, To: 0xdf3}, + 50: {From: 0xedf, To: 0x205a}, + 51: {From: 0xee9, To: 0x222e}, + 52: {From: 0xeee, To: 0x2e9a}, + 53: {From: 0xf39, To: 0x367}, + 54: {From: 0x10d0, To: 0x140}, + 55: {From: 0x1104, To: 0x2d0}, + 56: {From: 0x11a0, To: 0x1ec}, + 57: {From: 0x1279, To: 0x21}, + 58: {From: 0x1424, To: 0x15e}, + 59: {From: 0x1470, To: 0x14e}, + 60: {From: 0x151f, To: 0xd9b}, + 61: {From: 0x1523, To: 0x390}, + 62: {From: 0x1532, To: 0x19f}, + 63: {From: 0x1580, To: 0x210}, + 64: {From: 0x1583, To: 0x10d}, + 65: {From: 0x15a3, To: 0x3caf}, + 66: {From: 0x1630, To: 0x222e}, + 67: {From: 0x166a, To: 0x19b}, + 68: {From: 0x16c8, To: 0x136}, + 69: {From: 0x1700, To: 0x29f8}, + 70: {From: 0x1718, To: 0x194}, + 71: {From: 0x1727, To: 0xf3f}, + 72: {From: 0x177a, To: 0x178}, + 73: {From: 0x1809, To: 0x17b6}, + 74: {From: 0x1816, To: 0x18f3}, + 75: {From: 0x188a, To: 0x436}, + 76: {From: 0x1979, To: 0x1d01}, + 77: {From: 0x1a74, To: 0x2bb0}, + 78: {From: 0x1a8a, To: 0x1f8}, + 79: {From: 0x1b5a, To: 0x1fa}, + 80: {From: 0x1b86, To: 0x1515}, + 81: {From: 0x1d64, To: 0x2c9b}, + 82: {From: 0x2038, To: 0x37b1}, + 83: {From: 0x203d, To: 0x20dd}, + 84: {From: 0x205a, To: 0x30b}, + 85: {From: 0x20e3, To: 0x274}, + 86: {From: 0x20ee, To: 0x263}, + 87: {From: 0x20f2, To: 0x22d}, + 88: {From: 0x20f9, To: 0x256}, + 89: {From: 0x210f, To: 0x21eb}, + 90: {From: 0x2135, To: 0x27d}, + 91: {From: 0x2160, To: 0x913}, + 92: {From: 0x2199, To: 0x121}, + 93: {From: 0x21ce, To: 0x1561}, + 94: {From: 0x21e6, To: 0x504}, + 95: {From: 0x21f4, To: 0x49f}, + 96: {From: 0x21fb, To: 0x269}, + 97: {From: 0x222d, To: 0x121}, + 98: {From: 0x2237, To: 0x121}, + 99: {From: 0x2262, To: 0x92a}, + 100: {From: 0x2316, To: 0x3226}, + 101: {From: 0x236a, To: 0x2835}, + 102: {From: 0x2382, To: 0x3365}, + 103: {From: 0x2472, To: 0x2c7}, + 104: {From: 0x24e4, To: 0x2ff}, + 105: {From: 0x24f0, To: 0x2fa}, + 106: {From: 0x24fa, To: 0x31f}, + 107: {From: 0x2550, To: 0xb5b}, + 108: {From: 0x25a9, To: 0xe2}, + 109: {From: 0x263e, To: 0x2d0}, + 110: {From: 0x26c9, To: 0x26b4}, + 111: {From: 0x26f9, To: 0x3c8}, + 112: {From: 0x2727, To: 0x3caf}, + 113: {From: 0x2755, To: 0x6a4}, + 114: {From: 0x2765, To: 0x26b4}, + 115: {From: 0x2789, To: 0x4358}, + 116: {From: 0x27c9, To: 0x2001}, + 117: {From: 0x28ea, To: 0x27b1}, + 118: {From: 0x28ef, To: 0x2837}, + 119: {From: 0x2914, To: 0x351}, + 120: {From: 0x2986, To: 0x2da7}, + 121: {From: 0x29f0, To: 0x96b}, + 122: {From: 0x2b1a, To: 0x38d}, + 123: {From: 0x2bfc, To: 0x395}, + 124: {From: 0x2c3f, To: 0x3caf}, + 125: {From: 0x2ce1, To: 0x2201}, + 126: {From: 0x2cfc, To: 0x3be}, + 127: {From: 0x2d13, To: 0x597}, + 128: {From: 0x2d47, To: 0x148}, + 129: {From: 0x2d48, To: 0x148}, + 130: {From: 0x2dff, To: 0x2f1}, + 131: {From: 0x2e08, To: 0x19cc}, + 132: {From: 0x2e1a, To: 0x2d95}, + 133: {From: 0x2e21, To: 0x292}, + 134: {From: 0x2e54, To: 0x7d}, + 135: {From: 0x2e65, To: 0x2282}, + 136: {From: 0x2ea0, To: 0x2e9b}, + 137: {From: 0x2eef, To: 0x2ed7}, + 138: {From: 0x3193, To: 0x3c4}, + 139: {From: 0x3366, To: 0x338e}, + 140: {From: 0x342a, To: 0x3dc}, + 141: {From: 0x34ee, To: 0x18d0}, + 142: {From: 0x35c8, To: 0x2c9b}, + 143: {From: 0x35e6, To: 0x412}, + 144: {From: 0x3658, To: 0x246}, + 145: {From: 0x3676, To: 0x3f4}, + 146: {From: 0x36fd, To: 0x445}, + 147: {From: 0x37c0, To: 0x121}, + 148: {From: 0x3816, To: 0x38f2}, + 149: {From: 0x382a, To: 0x2b48}, + 150: {From: 0x382b, To: 0x2c9b}, + 151: {From: 0x382f, To: 0xa9}, + 152: {From: 0x3832, To: 0x3228}, + 153: {From: 0x386c, To: 0x39a6}, + 154: {From: 0x3892, To: 0x3fc0}, + 155: {From: 0x38a5, To: 0x39d7}, + 156: {From: 0x38b4, To: 0x1fa4}, + 157: {From: 0x38b5, To: 0x2e9a}, + 158: {From: 0x395c, To: 0x47e}, + 159: {From: 0x3b4e, To: 0xd91}, + 160: {From: 0x3b78, To: 0x137}, + 161: {From: 0x3c99, To: 0x4bc}, + 162: {From: 0x3fbd, To: 0x100}, + 163: {From: 0x4208, To: 0xa91}, + 164: {From: 0x42be, To: 0x573}, + 165: {From: 0x42f9, To: 0x3f60}, + 166: {From: 0x4378, To: 0x25a}, + 167: {From: 0x43b8, To: 0xe6c}, + 168: {From: 0x43cd, To: 0x10f}, + 169: {From: 0x44af, To: 0x3322}, + 170: {From: 0x44e3, To: 0x512}, + 171: {From: 0x45ca, To: 0x2409}, + 172: {From: 0x45dd, To: 0x26dc}, + 173: {From: 0x4610, To: 0x48ae}, + 174: {From: 0x46ae, To: 0x46a0}, + 175: {From: 0x473e, To: 0x4745}, + 176: {From: 0x4817, To: 0x3503}, + 177: {From: 0x4916, To: 0x31f}, + 178: {From: 0x49a7, To: 0x523}, +} + +// Size: 179 bytes, 179 elements +var AliasTypes = [179]AliasType{ + // Entry 0 - 3F + 1, 0, 0, 0, 0, 0, 0, 1, 2, 2, 0, 1, 0, 0, 1, 2, + 1, 1, 2, 0, 0, 1, 0, 1, 2, 1, 1, 0, 0, 0, 0, 2, + 1, 1, 0, 2, 0, 0, 1, 0, 1, 0, 0, 1, 2, 1, 1, 1, + 1, 0, 0, 0, 0, 2, 1, 1, 1, 1, 2, 1, 0, 1, 1, 2, + // Entry 40 - 7F + 2, 0, 0, 1, 2, 0, 1, 0, 1, 1, 1, 1, 0, 0, 2, 1, + 0, 0, 0, 0, 1, 1, 1, 1, 1, 0, 1, 0, 0, 0, 0, 0, + 0, 0, 0, 1, 0, 0, 0, 1, 2, 2, 2, 0, 1, 1, 0, 1, + 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 1, 1, 0, 0, 1, 0, + // Entry 80 - BF + 2, 1, 1, 0, 0, 1, 0, 0, 0, 0, 1, 1, 2, 0, 0, 2, + 1, 1, 1, 0, 0, 0, 0, 2, 0, 0, 0, 0, 0, 0, 1, 1, + 0, 1, 2, 0, 0, 0, 1, 0, 1, 0, 1, 0, 0, 0, 0, 1, + 0, 1, 1, +} + +const ( + _Latn = 90 + _Hani = 57 + _Hans = 59 + _Hant = 60 + _Qaaa = 147 + _Qaai = 155 + _Qabx = 196 + _Zinh = 252 + _Zyyy = 257 + _Zzzz = 258 +) + +// script is an alphabetically sorted list of ISO 15924 codes. The index +// of the script in the string, divided by 4, is the internal scriptID. +const script tag.Index = "" + // Size: 1040 bytes + "----AdlmAfakAghbAhomArabAranArmiArmnAvstBaliBamuBassBatkBengBhksBlisBopo" + + "BrahBraiBugiBuhdCakmCansCariChamCherChrsCirtCoptCpmnCprtCyrlCyrsDevaDiak" + + "DogrDsrtDuplEgydEgyhEgypElbaElymEthiGeokGeorGlagGongGonmGothGranGrekGujr" + + "GuruHanbHangHaniHanoHansHantHatrHebrHiraHluwHmngHmnpHrktHungIndsItalJamo" + + "JavaJpanJurcKaliKanaKharKhmrKhojKitlKitsKndaKoreKpelKthiLanaLaooLatfLatg" + + "LatnLekeLepcLimbLinaLinbLisuLomaLyciLydiMahjMakaMandManiMarcMayaMedfMend" + + "MercMeroMlymModiMongMoonMrooMteiMultMymrNandNarbNbatNewaNkdbNkgbNkooNshu" + + "OgamOlckOrkhOryaOsgeOsmaOugrPalmPaucPcunPelmPermPhagPhliPhlpPhlvPhnxPiqd" + + "PlrdPrtiPsinQaaaQaabQaacQaadQaaeQaafQaagQaahQaaiQaajQaakQaalQaamQaanQaao" + + "QaapQaaqQaarQaasQaatQaauQaavQaawQaaxQaayQaazQabaQabbQabcQabdQabeQabfQabg" + + "QabhQabiQabjQabkQablQabmQabnQaboQabpQabqQabrQabsQabtQabuQabvQabwQabxRanj" + + "RjngRohgRoroRunrSamrSaraSarbSaurSgnwShawShrdShuiSiddSindSinhSogdSogoSora" + + "SoyoSundSyloSyrcSyreSyrjSyrnTagbTakrTaleTaluTamlTangTavtTeluTengTfngTglg" + + "ThaaThaiTibtTirhTnsaTotoUgarVaiiVispVithWaraWchoWoleXpeoXsuxYeziYiiiZanb" + + "ZinhZmthZsyeZsymZxxxZyyyZzzz\xff\xff\xff\xff" + +// suppressScript is an index from langID to the dominant script for that language, +// if it exists. If a script is given, it should be suppressed from the language tag. +// Size: 1330 bytes, 1330 elements +var suppressScript = [1330]uint8{ + // Entry 0 - 3F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x2c, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 40 - 7F + 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x20, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, + // Entry 80 - BF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry C0 - FF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 100 - 13F + 0x5a, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xea, 0x00, 0x00, 0x00, 0x00, 0xec, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x34, 0x00, + 0x00, 0x5a, 0x00, 0x00, 0x5a, 0x00, 0x5a, 0x00, + // Entry 140 - 17F + 0x5a, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, + 0x05, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, + 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x00, 0x5a, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x5a, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 180 - 1BF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x5a, 0x35, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x3e, 0x00, 0x22, 0x00, + // Entry 1C0 - 1FF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5a, 0x5a, 0x00, 0x5a, 0x5a, 0x00, 0x08, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, + 0x5a, 0x5a, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00, + // Entry 200 - 23F + 0x49, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x2e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 240 - 27F + 0x00, 0x00, 0x20, 0x00, 0x00, 0x5a, 0x00, 0x00, + 0x00, 0x00, 0x4e, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x52, 0x00, 0x00, 0x53, 0x00, 0x22, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 280 - 2BF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, + 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 2C0 - 2FF + 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x22, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, + // Entry 300 - 33F + 0x00, 0x00, 0x00, 0x00, 0x6e, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x22, 0x00, 0x00, 0x00, 0x5a, + 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x75, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, + // Entry 340 - 37F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x5a, 0x22, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x7c, 0x5a, 0x00, + 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 380 - 3BF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5a, 0x00, 0x00, 0x00, 0x00, 0x81, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x36, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x05, 0x00, + // Entry 3C0 - 3FF + 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, + 0x00, 0x5a, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x20, 0x00, 0x00, 0x5a, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 400 - 43F + 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0xd4, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, + // Entry 440 - 47F + 0x00, 0x00, 0x00, 0x00, 0x5a, 0x5a, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xe3, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0xe6, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xeb, 0x00, 0x00, 0x00, 0x2c, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, + // Entry 480 - 4BF + 0x5a, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 4C0 - 4FF + 0x5a, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 500 - 53F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, +} + +const ( + _001 = 1 + _419 = 31 + _BR = 65 + _CA = 73 + _ES = 110 + _GB = 123 + _MD = 188 + _PT = 238 + _UK = 306 + _US = 309 + _ZZ = 357 + _XA = 323 + _XC = 325 + _XK = 333 +) + +// isoRegionOffset needs to be added to the index of regionISO to obtain the regionID +// for 2-letter ISO codes. (The first isoRegionOffset regionIDs are reserved for +// the UN.M49 codes used for groups.) +const isoRegionOffset = 32 + +// regionTypes defines the status of a region for various standards. +// Size: 358 bytes, 358 elements +var regionTypes = [358]uint8{ + // Entry 0 - 3F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x05, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + // Entry 40 - 7F + 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x04, + 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, + 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, + 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, + 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + // Entry 80 - BF + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x00, 0x04, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + // Entry C0 - FF + 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, + 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, 0x06, + 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, + 0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, + 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, + // Entry 100 - 13F + 0x05, 0x05, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x02, 0x06, 0x04, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, + // Entry 140 - 17F + 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05, + 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, + 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, + 0x05, 0x05, 0x05, 0x05, 0x05, 0x04, 0x06, 0x06, + 0x04, 0x06, 0x06, 0x04, 0x06, 0x05, +} + +// regionISO holds a list of alphabetically sorted 2-letter ISO region codes. +// Each 2-letter codes is followed by two bytes with the following meaning: +// - [A-Z}{2}: the first letter of the 2-letter code plus these two +// letters form the 3-letter ISO code. +// - 0, n: index into altRegionISO3. +const regionISO tag.Index = "" + // Size: 1308 bytes + "AAAAACSCADNDAEREAFFGAGTGAIIAALLBAMRMANNTAOGOAQTAARRGASSMATUTAUUSAWBWAXLA" + + "AZZEBAIHBBRBBDGDBEELBFFABGGRBHHRBIDIBJENBLLMBMMUBNRNBOOLBQESBRRABSHSBTTN" + + "BUURBVVTBWWABYLRBZLZCAANCCCKCDODCFAFCGOGCHHECIIVCKOKCLHLCMMRCNHNCOOLCPPT" + + "CRRICS\x00\x00CTTECUUBCVPVCWUWCXXRCYYPCZZEDDDRDEEUDGGADJJIDKNKDMMADOOMDY" + + "HYDZZAEA ECCUEESTEGGYEHSHERRIESSPETTHEU\x00\x03EZ FIINFJJIFKLKFMSMFORO" + + "FQ\x00\x18FRRAFXXXGAABGBBRGDRDGEEOGFUFGGGYGHHAGIIBGLRLGMMBGNINGPLPGQNQGR" + + "RCGS\x00\x06GTTMGUUMGWNBGYUYHKKGHMMDHNNDHRRVHTTIHUUNHVVOIC IDDNIERLILSR" + + "IMMNINNDIOOTIQRQIRRNISSLITTAJEEYJMAMJOORJPPNJTTNKEENKGGZKHHMKIIRKM\x00" + + "\x09KNNAKP\x00\x0cKRORKWWTKY\x00\x0fKZAZLAAOLBBNLCCALIIELKKALRBRLSSOLTTU" + + "LUUXLVVALYBYMAARMCCOMDDAMENEMFAFMGDGMHHLMIIDMKKDMLLIMMMRMNNGMOACMPNPMQTQ" + + "MRRTMSSRMTLTMUUSMVDVMWWIMXEXMYYSMZOZNAAMNCCLNEERNFFKNGGANHHBNIICNLLDNOOR" + + "NPPLNQ\x00\x1eNRRUNTTZNUIUNZZLOMMNPAANPCCIPEERPFYFPGNGPHHLPKAKPLOLPM\x00" + + "\x12PNCNPRRIPSSEPTRTPUUSPWLWPYRYPZCZQAATQMMMQNNNQOOOQPPPQQQQQRRRQSSSQTTT" + + "QU\x00\x03QVVVQWWWQXXXQYYYQZZZREEURHHOROOURS\x00\x15RUUSRWWASAAUSBLBSCYC" + + "SDDNSEWESGGPSHHNSIVNSJJMSKVKSLLESMMRSNENSOOMSRURSSSDSTTPSUUNSVLVSXXMSYYR" + + "SZWZTAAATCCATDCDTF\x00\x18TGGOTHHATJJKTKKLTLLSTMKMTNUNTOONTPMPTRURTTTOTV" + + "UVTWWNTZZAUAKRUGGAUK UMMIUN USSAUYRYUZZBVAATVCCTVDDRVEENVGGBVIIRVNNMVU" + + "UTWFLFWKAKWSSMXAAAXBBBXCCCXDDDXEEEXFFFXGGGXHHHXIIIXJJJXKKKXLLLXMMMXNNNXO" + + "OOXPPPXQQQXRRRXSSSXTTTXUUUXVVVXWWWXXXXXYYYXZZZYDMDYEEMYT\x00\x1bYUUGZAAF" + + "ZMMBZRARZWWEZZZZ\xff\xff\xff\xff" + +// altRegionISO3 holds a list of 3-letter region codes that cannot be +// mapped to 2-letter codes using the default algorithm. This is a short list. +const altRegionISO3 string = "SCGQUUSGSCOMPRKCYMSPMSRBATFMYTATN" + +// altRegionIDs holds a list of regionIDs the positions of which match those +// of the 3-letter ISO codes in altRegionISO3. +// Size: 22 bytes, 11 elements +var altRegionIDs = [11]uint16{ + 0x0057, 0x0070, 0x0088, 0x00a8, 0x00aa, 0x00ad, 0x00ea, 0x0105, + 0x0121, 0x015f, 0x00dc, +} + +// Size: 80 bytes, 20 elements +var regionOldMap = [20]FromTo{ + 0: {From: 0x44, To: 0xc4}, + 1: {From: 0x58, To: 0xa7}, + 2: {From: 0x5f, To: 0x60}, + 3: {From: 0x66, To: 0x3b}, + 4: {From: 0x79, To: 0x78}, + 5: {From: 0x93, To: 0x37}, + 6: {From: 0xa3, To: 0x133}, + 7: {From: 0xc1, To: 0x133}, + 8: {From: 0xd7, To: 0x13f}, + 9: {From: 0xdc, To: 0x2b}, + 10: {From: 0xef, To: 0x133}, + 11: {From: 0xf2, To: 0xe2}, + 12: {From: 0xfc, To: 0x70}, + 13: {From: 0x103, To: 0x164}, + 14: {From: 0x12a, To: 0x126}, + 15: {From: 0x132, To: 0x7b}, + 16: {From: 0x13a, To: 0x13e}, + 17: {From: 0x141, To: 0x133}, + 18: {From: 0x15d, To: 0x15e}, + 19: {From: 0x163, To: 0x4b}, +} + +// m49 maps regionIDs to UN.M49 codes. The first isoRegionOffset entries are +// codes indicating collections of regions. +// Size: 716 bytes, 358 elements +var m49 = [358]int16{ + // Entry 0 - 3F + 0, 1, 2, 3, 5, 9, 11, 13, + 14, 15, 17, 18, 19, 21, 29, 30, + 34, 35, 39, 53, 54, 57, 61, 142, + 143, 145, 150, 151, 154, 155, 202, 419, + 958, 0, 20, 784, 4, 28, 660, 8, + 51, 530, 24, 10, 32, 16, 40, 36, + 533, 248, 31, 70, 52, 50, 56, 854, + 100, 48, 108, 204, 652, 60, 96, 68, + // Entry 40 - 7F + 535, 76, 44, 64, 104, 74, 72, 112, + 84, 124, 166, 180, 140, 178, 756, 384, + 184, 152, 120, 156, 170, 0, 188, 891, + 296, 192, 132, 531, 162, 196, 203, 278, + 276, 0, 262, 208, 212, 214, 204, 12, + 0, 218, 233, 818, 732, 232, 724, 231, + 967, 0, 246, 242, 238, 583, 234, 0, + 250, 249, 266, 826, 308, 268, 254, 831, + // Entry 80 - BF + 288, 292, 304, 270, 324, 312, 226, 300, + 239, 320, 316, 624, 328, 344, 334, 340, + 191, 332, 348, 854, 0, 360, 372, 376, + 833, 356, 86, 368, 364, 352, 380, 832, + 388, 400, 392, 581, 404, 417, 116, 296, + 174, 659, 408, 410, 414, 136, 398, 418, + 422, 662, 438, 144, 430, 426, 440, 442, + 428, 434, 504, 492, 498, 499, 663, 450, + // Entry C0 - FF + 584, 581, 807, 466, 104, 496, 446, 580, + 474, 478, 500, 470, 480, 462, 454, 484, + 458, 508, 516, 540, 562, 574, 566, 548, + 558, 528, 578, 524, 10, 520, 536, 570, + 554, 512, 591, 0, 604, 258, 598, 608, + 586, 616, 666, 612, 630, 275, 620, 581, + 585, 600, 591, 634, 959, 960, 961, 962, + 963, 964, 965, 966, 967, 968, 969, 970, + // Entry 100 - 13F + 971, 972, 638, 716, 642, 688, 643, 646, + 682, 90, 690, 729, 752, 702, 654, 705, + 744, 703, 694, 674, 686, 706, 740, 728, + 678, 810, 222, 534, 760, 748, 0, 796, + 148, 260, 768, 764, 762, 772, 626, 795, + 788, 776, 626, 792, 780, 798, 158, 834, + 804, 800, 826, 581, 0, 840, 858, 860, + 336, 670, 704, 862, 92, 850, 704, 548, + // Entry 140 - 17F + 876, 581, 882, 973, 974, 975, 976, 977, + 978, 979, 980, 981, 982, 983, 984, 985, + 986, 987, 988, 989, 990, 991, 992, 993, + 994, 995, 996, 997, 998, 720, 887, 175, + 891, 710, 894, 180, 716, 999, +} + +// m49Index gives indexes into fromM49 based on the three most significant bits +// of a 10-bit UN.M49 code. To search an UN.M49 code in fromM49, search in +// +// fromM49[m49Index[msb39(code)]:m49Index[msb3(code)+1]] +// +// for an entry where the first 7 bits match the 7 lsb of the UN.M49 code. +// The region code is stored in the 9 lsb of the indexed value. +// Size: 18 bytes, 9 elements +var m49Index = [9]int16{ + 0, 59, 108, 143, 181, 220, 259, 291, + 333, +} + +// fromM49 contains entries to map UN.M49 codes to regions. See m49Index for details. +// Size: 666 bytes, 333 elements +var fromM49 = [333]uint16{ + // Entry 0 - 3F + 0x0201, 0x0402, 0x0603, 0x0824, 0x0a04, 0x1027, 0x1205, 0x142b, + 0x1606, 0x1867, 0x1a07, 0x1c08, 0x1e09, 0x202d, 0x220a, 0x240b, + 0x260c, 0x2822, 0x2a0d, 0x302a, 0x3825, 0x3a0e, 0x3c0f, 0x3e32, + 0x402c, 0x4410, 0x4611, 0x482f, 0x4e12, 0x502e, 0x5842, 0x6039, + 0x6435, 0x6628, 0x6834, 0x6a13, 0x6c14, 0x7036, 0x7215, 0x783d, + 0x7a16, 0x8043, 0x883f, 0x8c33, 0x9046, 0x9445, 0x9841, 0xa848, + 0xac9a, 0xb509, 0xb93c, 0xc03e, 0xc838, 0xd0c4, 0xd83a, 0xe047, + 0xe8a6, 0xf052, 0xf849, 0x085a, 0x10ad, 0x184c, 0x1c17, 0x1e18, + // Entry 40 - 7F + 0x20b3, 0x2219, 0x2920, 0x2c1a, 0x2e1b, 0x3051, 0x341c, 0x361d, + 0x3853, 0x3d2e, 0x445c, 0x4c4a, 0x5454, 0x5ca8, 0x5f5f, 0x644d, + 0x684b, 0x7050, 0x7856, 0x7e90, 0x8059, 0x885d, 0x941e, 0x965e, + 0x983b, 0xa063, 0xa864, 0xac65, 0xb469, 0xbd1a, 0xc486, 0xcc6f, + 0xce6f, 0xd06d, 0xd26a, 0xd476, 0xdc74, 0xde88, 0xe473, 0xec72, + 0xf031, 0xf279, 0xf478, 0xfc7e, 0x04e5, 0x0921, 0x0c62, 0x147a, + 0x187d, 0x1c83, 0x26ed, 0x2860, 0x2c5f, 0x3060, 0x4080, 0x4881, + 0x50a7, 0x5887, 0x6082, 0x687c, 0x7085, 0x788a, 0x8089, 0x8884, + // Entry 80 - BF + 0x908c, 0x9891, 0x9c8e, 0xa138, 0xa88f, 0xb08d, 0xb892, 0xc09d, + 0xc899, 0xd095, 0xd89c, 0xe09b, 0xe896, 0xf097, 0xf89e, 0x004f, + 0x08a0, 0x10a2, 0x1cae, 0x20a1, 0x28a4, 0x30aa, 0x34ab, 0x3cac, + 0x42a5, 0x44af, 0x461f, 0x4cb0, 0x54b5, 0x58b8, 0x5cb4, 0x64b9, + 0x6cb2, 0x70b6, 0x74b7, 0x7cc6, 0x84bf, 0x8cce, 0x94d0, 0x9ccd, + 0xa4c3, 0xaccb, 0xb4c8, 0xbcc9, 0xc0cc, 0xc8cf, 0xd8bb, 0xe0c5, + 0xe4bc, 0xe6bd, 0xe8ca, 0xf0ba, 0xf8d1, 0x00e1, 0x08d2, 0x10dd, + 0x18db, 0x20d9, 0x2429, 0x265b, 0x2a30, 0x2d1b, 0x2e40, 0x30de, + // Entry C0 - FF + 0x38d3, 0x493f, 0x54e0, 0x5cd8, 0x64d4, 0x6cd6, 0x74df, 0x7cd5, + 0x84da, 0x88c7, 0x8b33, 0x8e75, 0x90c0, 0x92f0, 0x94e8, 0x9ee2, + 0xace6, 0xb0f1, 0xb8e4, 0xc0e7, 0xc8eb, 0xd0e9, 0xd8ee, 0xe08b, + 0xe526, 0xecec, 0xf4f3, 0xfd02, 0x0504, 0x0706, 0x0d07, 0x183c, + 0x1d0e, 0x26a9, 0x2826, 0x2cb1, 0x2ebe, 0x34ea, 0x3d39, 0x4513, + 0x4d18, 0x5508, 0x5d14, 0x6105, 0x650a, 0x6d12, 0x7d0d, 0x7f11, + 0x813e, 0x830f, 0x8515, 0x8d61, 0x9964, 0xa15d, 0xa86e, 0xb117, + 0xb30b, 0xb86c, 0xc10b, 0xc916, 0xd110, 0xd91d, 0xe10c, 0xe84e, + // Entry 100 - 13F + 0xf11c, 0xf524, 0xf923, 0x0122, 0x0925, 0x1129, 0x192c, 0x2023, + 0x2928, 0x312b, 0x3727, 0x391f, 0x3d2d, 0x4131, 0x4930, 0x4ec2, + 0x5519, 0x646b, 0x747b, 0x7e7f, 0x809f, 0x8298, 0x852f, 0x9135, + 0xa53d, 0xac37, 0xb536, 0xb937, 0xbd3b, 0xd940, 0xe542, 0xed5e, + 0xef5e, 0xf657, 0xfd62, 0x7c20, 0x7ef4, 0x80f5, 0x82f6, 0x84f7, + 0x86f8, 0x88f9, 0x8afa, 0x8cfb, 0x8e70, 0x90fd, 0x92fe, 0x94ff, + 0x9700, 0x9901, 0x9b43, 0x9d44, 0x9f45, 0xa146, 0xa347, 0xa548, + 0xa749, 0xa94a, 0xab4b, 0xad4c, 0xaf4d, 0xb14e, 0xb34f, 0xb550, + // Entry 140 - 17F + 0xb751, 0xb952, 0xbb53, 0xbd54, 0xbf55, 0xc156, 0xc357, 0xc558, + 0xc759, 0xc95a, 0xcb5b, 0xcd5c, 0xcf65, +} + +// Size: 2014 bytes +var variantIndex = map[string]uint8{ + "1606nict": 0x0, + "1694acad": 0x1, + "1901": 0x2, + "1959acad": 0x3, + "1994": 0x61, + "1996": 0x4, + "abl1943": 0x5, + "akuapem": 0x6, + "alalc97": 0x63, + "aluku": 0x7, + "ao1990": 0x8, + "aranes": 0x9, + "arevela": 0xa, + "arevmda": 0xb, + "arkaika": 0xc, + "asante": 0xd, + "auvern": 0xe, + "baku1926": 0xf, + "balanka": 0x10, + "barla": 0x11, + "basiceng": 0x12, + "bauddha": 0x13, + "biscayan": 0x14, + "biske": 0x5c, + "bohoric": 0x15, + "boont": 0x16, + "bornholm": 0x17, + "cisaup": 0x18, + "colb1945": 0x19, + "cornu": 0x1a, + "creiss": 0x1b, + "dajnko": 0x1c, + "ekavsk": 0x1d, + "emodeng": 0x1e, + "fonipa": 0x64, + "fonkirsh": 0x65, + "fonnapa": 0x66, + "fonupa": 0x67, + "fonxsamp": 0x68, + "gascon": 0x1f, + "grclass": 0x20, + "grital": 0x21, + "grmistr": 0x22, + "hepburn": 0x23, + "heploc": 0x62, + "hognorsk": 0x24, + "hsistemo": 0x25, + "ijekavsk": 0x26, + "itihasa": 0x27, + "ivanchov": 0x28, + "jauer": 0x29, + "jyutping": 0x2a, + "kkcor": 0x2b, + "kociewie": 0x2c, + "kscor": 0x2d, + "laukika": 0x2e, + "lemosin": 0x2f, + "lengadoc": 0x30, + "lipaw": 0x5d, + "luna1918": 0x31, + "metelko": 0x32, + "monoton": 0x33, + "ndyuka": 0x34, + "nedis": 0x35, + "newfound": 0x36, + "nicard": 0x37, + "njiva": 0x5e, + "nulik": 0x38, + "osojs": 0x5f, + "oxendict": 0x39, + "pahawh2": 0x3a, + "pahawh3": 0x3b, + "pahawh4": 0x3c, + "pamaka": 0x3d, + "peano": 0x3e, + "petr1708": 0x3f, + "pinyin": 0x40, + "polyton": 0x41, + "provenc": 0x42, + "puter": 0x43, + "rigik": 0x44, + "rozaj": 0x45, + "rumgr": 0x46, + "scotland": 0x47, + "scouse": 0x48, + "simple": 0x69, + "solba": 0x60, + "sotav": 0x49, + "spanglis": 0x4a, + "surmiran": 0x4b, + "sursilv": 0x4c, + "sutsilv": 0x4d, + "tarask": 0x4e, + "tongyong": 0x4f, + "tunumiit": 0x50, + "uccor": 0x51, + "ucrcor": 0x52, + "ulster": 0x53, + "unifon": 0x54, + "vaidika": 0x55, + "valencia": 0x56, + "vallader": 0x57, + "vecdruka": 0x58, + "vivaraup": 0x59, + "wadegile": 0x5a, + "xsistemo": 0x5b, +} + +// variantNumSpecialized is the number of specialized variants in variants. +const variantNumSpecialized = 99 + +// nRegionGroups is the number of region groups. +const nRegionGroups = 33 + +type likelyLangRegion struct { + lang uint16 + region uint16 +} + +// likelyScript is a lookup table, indexed by scriptID, for the most likely +// languages and regions given a script. +// Size: 1040 bytes, 260 elements +var likelyScript = [260]likelyLangRegion{ + 1: {lang: 0x14e, region: 0x84}, + 3: {lang: 0x2a2, region: 0x106}, + 4: {lang: 0x1f, region: 0x99}, + 5: {lang: 0x3a, region: 0x6b}, + 7: {lang: 0x3b, region: 0x9c}, + 8: {lang: 0x1d7, region: 0x28}, + 9: {lang: 0x13, region: 0x9c}, + 10: {lang: 0x5b, region: 0x95}, + 11: {lang: 0x60, region: 0x52}, + 12: {lang: 0xb9, region: 0xb4}, + 13: {lang: 0x63, region: 0x95}, + 14: {lang: 0xa5, region: 0x35}, + 15: {lang: 0x3e9, region: 0x99}, + 17: {lang: 0x529, region: 0x12e}, + 18: {lang: 0x3b1, region: 0x99}, + 19: {lang: 0x15e, region: 0x78}, + 20: {lang: 0xc2, region: 0x95}, + 21: {lang: 0x9d, region: 0xe7}, + 22: {lang: 0xdb, region: 0x35}, + 23: {lang: 0xf3, region: 0x49}, + 24: {lang: 0x4f0, region: 0x12b}, + 25: {lang: 0xe7, region: 0x13e}, + 26: {lang: 0xe5, region: 0x135}, + 29: {lang: 0xf1, region: 0x6b}, + 31: {lang: 0x1a0, region: 0x5d}, + 32: {lang: 0x3e2, region: 0x106}, + 34: {lang: 0x1be, region: 0x99}, + 38: {lang: 0x15e, region: 0x78}, + 41: {lang: 0x133, region: 0x6b}, + 42: {lang: 0x431, region: 0x27}, + 44: {lang: 0x27, region: 0x6f}, + 46: {lang: 0x210, region: 0x7d}, + 47: {lang: 0xfe, region: 0x38}, + 49: {lang: 0x19b, region: 0x99}, + 50: {lang: 0x19e, region: 0x130}, + 51: {lang: 0x3e9, region: 0x99}, + 52: {lang: 0x136, region: 0x87}, + 53: {lang: 0x1a4, region: 0x99}, + 54: {lang: 0x39d, region: 0x99}, + 55: {lang: 0x529, region: 0x12e}, + 56: {lang: 0x254, region: 0xab}, + 57: {lang: 0x529, region: 0x53}, + 58: {lang: 0x1cb, region: 0xe7}, + 59: {lang: 0x529, region: 0x53}, + 60: {lang: 0x529, region: 0x12e}, + 61: {lang: 0x2fd, region: 0x9b}, + 62: {lang: 0x1bc, region: 0x97}, + 63: {lang: 0x200, region: 0xa2}, + 64: {lang: 0x1c5, region: 0x12b}, + 65: {lang: 0x1ca, region: 0xaf}, + 68: {lang: 0x1d5, region: 0x92}, + 70: {lang: 0x142, region: 0x9e}, + 71: {lang: 0x254, region: 0xab}, + 72: {lang: 0x20e, region: 0x95}, + 73: {lang: 0x200, region: 0xa2}, + 75: {lang: 0x135, region: 0xc4}, + 76: {lang: 0x200, region: 0xa2}, + 77: {lang: 0x3bb, region: 0xe8}, + 78: {lang: 0x24a, region: 0xa6}, + 79: {lang: 0x3fa, region: 0x99}, + 82: {lang: 0x251, region: 0x99}, + 83: {lang: 0x254, region: 0xab}, + 85: {lang: 0x88, region: 0x99}, + 86: {lang: 0x370, region: 0x123}, + 87: {lang: 0x2b8, region: 0xaf}, + 92: {lang: 0x29f, region: 0x99}, + 93: {lang: 0x2a8, region: 0x99}, + 94: {lang: 0x28f, region: 0x87}, + 95: {lang: 0x1a0, region: 0x87}, + 96: {lang: 0x2ac, region: 0x53}, + 98: {lang: 0x4f4, region: 0x12b}, + 99: {lang: 0x4f5, region: 0x12b}, + 100: {lang: 0x1be, region: 0x99}, + 102: {lang: 0x337, region: 0x9c}, + 103: {lang: 0x4f7, region: 0x53}, + 104: {lang: 0xa9, region: 0x53}, + 107: {lang: 0x2e8, region: 0x112}, + 108: {lang: 0x4f8, region: 0x10b}, + 109: {lang: 0x4f8, region: 0x10b}, + 110: {lang: 0x304, region: 0x99}, + 111: {lang: 0x31b, region: 0x99}, + 112: {lang: 0x30b, region: 0x53}, + 114: {lang: 0x31e, region: 0x35}, + 115: {lang: 0x30e, region: 0x99}, + 116: {lang: 0x414, region: 0xe8}, + 117: {lang: 0x331, region: 0xc4}, + 119: {lang: 0x4f9, region: 0x108}, + 120: {lang: 0x3b, region: 0xa1}, + 121: {lang: 0x353, region: 0xdb}, + 124: {lang: 0x2d0, region: 0x84}, + 125: {lang: 0x52a, region: 0x53}, + 126: {lang: 0x403, region: 0x96}, + 127: {lang: 0x3ee, region: 0x99}, + 128: {lang: 0x39b, region: 0xc5}, + 129: {lang: 0x395, region: 0x99}, + 130: {lang: 0x399, region: 0x135}, + 131: {lang: 0x429, region: 0x115}, + 133: {lang: 0x3b, region: 0x11c}, + 134: {lang: 0xfd, region: 0xc4}, + 137: {lang: 0x27d, region: 0x106}, + 138: {lang: 0x2c9, region: 0x53}, + 139: {lang: 0x39f, region: 0x9c}, + 140: {lang: 0x39f, region: 0x53}, + 142: {lang: 0x3ad, region: 0xb0}, + 144: {lang: 0x1c6, region: 0x53}, + 145: {lang: 0x4fd, region: 0x9c}, + 198: {lang: 0x3cb, region: 0x95}, + 201: {lang: 0x372, region: 0x10c}, + 202: {lang: 0x420, region: 0x97}, + 204: {lang: 0x4ff, region: 0x15e}, + 205: {lang: 0x3f0, region: 0x99}, + 206: {lang: 0x45, region: 0x135}, + 207: {lang: 0x139, region: 0x7b}, + 208: {lang: 0x3e9, region: 0x99}, + 210: {lang: 0x3e9, region: 0x99}, + 211: {lang: 0x3fa, region: 0x99}, + 212: {lang: 0x40c, region: 0xb3}, + 215: {lang: 0x433, region: 0x99}, + 216: {lang: 0xef, region: 0xc5}, + 217: {lang: 0x43e, region: 0x95}, + 218: {lang: 0x44d, region: 0x35}, + 219: {lang: 0x44e, region: 0x9b}, + 223: {lang: 0x45a, region: 0xe7}, + 224: {lang: 0x11a, region: 0x99}, + 225: {lang: 0x45e, region: 0x53}, + 226: {lang: 0x232, region: 0x53}, + 227: {lang: 0x450, region: 0x99}, + 228: {lang: 0x4a5, region: 0x53}, + 229: {lang: 0x9f, region: 0x13e}, + 230: {lang: 0x461, region: 0x99}, + 232: {lang: 0x528, region: 0xba}, + 233: {lang: 0x153, region: 0xe7}, + 234: {lang: 0x128, region: 0xcd}, + 235: {lang: 0x46b, region: 0x123}, + 236: {lang: 0xa9, region: 0x53}, + 237: {lang: 0x2ce, region: 0x99}, + 240: {lang: 0x4ad, region: 0x11c}, + 241: {lang: 0x4be, region: 0xb4}, + 244: {lang: 0x1ce, region: 0x99}, + 247: {lang: 0x3a9, region: 0x9c}, + 248: {lang: 0x22, region: 0x9b}, + 250: {lang: 0x1ea, region: 0x53}, + 251: {lang: 0xef, region: 0xc5}, +} + +type likelyScriptRegion struct { + region uint16 + script uint16 + flags uint8 +} + +// likelyLang is a lookup table, indexed by langID, for the most likely +// scripts and regions given incomplete information. If more entries exist for a +// given language, region and script are the index and size respectively +// of the list in likelyLangList. +// Size: 7980 bytes, 1330 elements +var likelyLang = [1330]likelyScriptRegion{ + 0: {region: 0x135, script: 0x5a, flags: 0x0}, + 1: {region: 0x6f, script: 0x5a, flags: 0x0}, + 2: {region: 0x165, script: 0x5a, flags: 0x0}, + 3: {region: 0x165, script: 0x5a, flags: 0x0}, + 4: {region: 0x165, script: 0x5a, flags: 0x0}, + 5: {region: 0x7d, script: 0x20, flags: 0x0}, + 6: {region: 0x165, script: 0x5a, flags: 0x0}, + 7: {region: 0x165, script: 0x20, flags: 0x0}, + 8: {region: 0x80, script: 0x5a, flags: 0x0}, + 9: {region: 0x165, script: 0x5a, flags: 0x0}, + 10: {region: 0x165, script: 0x5a, flags: 0x0}, + 11: {region: 0x165, script: 0x5a, flags: 0x0}, + 12: {region: 0x95, script: 0x5a, flags: 0x0}, + 13: {region: 0x131, script: 0x5a, flags: 0x0}, + 14: {region: 0x80, script: 0x5a, flags: 0x0}, + 15: {region: 0x165, script: 0x5a, flags: 0x0}, + 16: {region: 0x165, script: 0x5a, flags: 0x0}, + 17: {region: 0x106, script: 0x20, flags: 0x0}, + 18: {region: 0x165, script: 0x5a, flags: 0x0}, + 19: {region: 0x9c, script: 0x9, flags: 0x0}, + 20: {region: 0x128, script: 0x5, flags: 0x0}, + 21: {region: 0x165, script: 0x5a, flags: 0x0}, + 22: {region: 0x161, script: 0x5a, flags: 0x0}, + 23: {region: 0x165, script: 0x5a, flags: 0x0}, + 24: {region: 0x165, script: 0x5a, flags: 0x0}, + 25: {region: 0x165, script: 0x5a, flags: 0x0}, + 26: {region: 0x165, script: 0x5a, flags: 0x0}, + 27: {region: 0x165, script: 0x5a, flags: 0x0}, + 28: {region: 0x52, script: 0x5a, flags: 0x0}, + 29: {region: 0x165, script: 0x5a, flags: 0x0}, + 30: {region: 0x165, script: 0x5a, flags: 0x0}, + 31: {region: 0x99, script: 0x4, flags: 0x0}, + 32: {region: 0x165, script: 0x5a, flags: 0x0}, + 33: {region: 0x80, script: 0x5a, flags: 0x0}, + 34: {region: 0x9b, script: 0xf8, flags: 0x0}, + 35: {region: 0x165, script: 0x5a, flags: 0x0}, + 36: {region: 0x165, script: 0x5a, flags: 0x0}, + 37: {region: 0x14d, script: 0x5a, flags: 0x0}, + 38: {region: 0x106, script: 0x20, flags: 0x0}, + 39: {region: 0x6f, script: 0x2c, flags: 0x0}, + 40: {region: 0x165, script: 0x5a, flags: 0x0}, + 41: {region: 0x165, script: 0x5a, flags: 0x0}, + 42: {region: 0xd6, script: 0x5a, flags: 0x0}, + 43: {region: 0x165, script: 0x5a, flags: 0x0}, + 45: {region: 0x165, script: 0x5a, flags: 0x0}, + 46: {region: 0x165, script: 0x5a, flags: 0x0}, + 47: {region: 0x165, script: 0x5a, flags: 0x0}, + 48: {region: 0x165, script: 0x5a, flags: 0x0}, + 49: {region: 0x165, script: 0x5a, flags: 0x0}, + 50: {region: 0x165, script: 0x5a, flags: 0x0}, + 51: {region: 0x95, script: 0x5a, flags: 0x0}, + 52: {region: 0x165, script: 0x5, flags: 0x0}, + 53: {region: 0x122, script: 0x5, flags: 0x0}, + 54: {region: 0x165, script: 0x5a, flags: 0x0}, + 55: {region: 0x165, script: 0x5a, flags: 0x0}, + 56: {region: 0x165, script: 0x5a, flags: 0x0}, + 57: {region: 0x165, script: 0x5a, flags: 0x0}, + 58: {region: 0x6b, script: 0x5, flags: 0x0}, + 59: {region: 0x0, script: 0x3, flags: 0x1}, + 60: {region: 0x165, script: 0x5a, flags: 0x0}, + 61: {region: 0x51, script: 0x5a, flags: 0x0}, + 62: {region: 0x3f, script: 0x5a, flags: 0x0}, + 63: {region: 0x67, script: 0x5, flags: 0x0}, + 65: {region: 0xba, script: 0x5, flags: 0x0}, + 66: {region: 0x6b, script: 0x5, flags: 0x0}, + 67: {region: 0x99, script: 0xe, flags: 0x0}, + 68: {region: 0x12f, script: 0x5a, flags: 0x0}, + 69: {region: 0x135, script: 0xce, flags: 0x0}, + 70: {region: 0x165, script: 0x5a, flags: 0x0}, + 71: {region: 0x165, script: 0x5a, flags: 0x0}, + 72: {region: 0x6e, script: 0x5a, flags: 0x0}, + 73: {region: 0x165, script: 0x5a, flags: 0x0}, + 74: {region: 0x165, script: 0x5a, flags: 0x0}, + 75: {region: 0x49, script: 0x5a, flags: 0x0}, + 76: {region: 0x165, script: 0x5a, flags: 0x0}, + 77: {region: 0x106, script: 0x20, flags: 0x0}, + 78: {region: 0x165, script: 0x5, flags: 0x0}, + 79: {region: 0x165, script: 0x5a, flags: 0x0}, + 80: {region: 0x165, script: 0x5a, flags: 0x0}, + 81: {region: 0x165, script: 0x5a, flags: 0x0}, + 82: {region: 0x99, script: 0x22, flags: 0x0}, + 83: {region: 0x165, script: 0x5a, flags: 0x0}, + 84: {region: 0x165, script: 0x5a, flags: 0x0}, + 85: {region: 0x165, script: 0x5a, flags: 0x0}, + 86: {region: 0x3f, script: 0x5a, flags: 0x0}, + 87: {region: 0x165, script: 0x5a, flags: 0x0}, + 88: {region: 0x3, script: 0x5, flags: 0x1}, + 89: {region: 0x106, script: 0x20, flags: 0x0}, + 90: {region: 0xe8, script: 0x5, flags: 0x0}, + 91: {region: 0x95, script: 0x5a, flags: 0x0}, + 92: {region: 0xdb, script: 0x22, flags: 0x0}, + 93: {region: 0x2e, script: 0x5a, flags: 0x0}, + 94: {region: 0x52, script: 0x5a, flags: 0x0}, + 95: {region: 0x165, script: 0x5a, flags: 0x0}, + 96: {region: 0x52, script: 0xb, flags: 0x0}, + 97: {region: 0x165, script: 0x5a, flags: 0x0}, + 98: {region: 0x165, script: 0x5a, flags: 0x0}, + 99: {region: 0x95, script: 0x5a, flags: 0x0}, + 100: {region: 0x165, script: 0x5a, flags: 0x0}, + 101: {region: 0x52, script: 0x5a, flags: 0x0}, + 102: {region: 0x165, script: 0x5a, flags: 0x0}, + 103: {region: 0x165, script: 0x5a, flags: 0x0}, + 104: {region: 0x165, script: 0x5a, flags: 0x0}, + 105: {region: 0x165, script: 0x5a, flags: 0x0}, + 106: {region: 0x4f, script: 0x5a, flags: 0x0}, + 107: {region: 0x165, script: 0x5a, flags: 0x0}, + 108: {region: 0x165, script: 0x5a, flags: 0x0}, + 109: {region: 0x165, script: 0x5a, flags: 0x0}, + 110: {region: 0x165, script: 0x2c, flags: 0x0}, + 111: {region: 0x165, script: 0x5a, flags: 0x0}, + 112: {region: 0x165, script: 0x5a, flags: 0x0}, + 113: {region: 0x47, script: 0x20, flags: 0x0}, + 114: {region: 0x165, script: 0x5a, flags: 0x0}, + 115: {region: 0x165, script: 0x5a, flags: 0x0}, + 116: {region: 0x10b, script: 0x5, flags: 0x0}, + 117: {region: 0x162, script: 0x5a, flags: 0x0}, + 118: {region: 0x165, script: 0x5a, flags: 0x0}, + 119: {region: 0x95, script: 0x5a, flags: 0x0}, + 120: {region: 0x165, script: 0x5a, flags: 0x0}, + 121: {region: 0x12f, script: 0x5a, flags: 0x0}, + 122: {region: 0x52, script: 0x5a, flags: 0x0}, + 123: {region: 0x99, script: 0xe3, flags: 0x0}, + 124: {region: 0xe8, script: 0x5, flags: 0x0}, + 125: {region: 0x99, script: 0x22, flags: 0x0}, + 126: {region: 0x38, script: 0x20, flags: 0x0}, + 127: {region: 0x99, script: 0x22, flags: 0x0}, + 128: {region: 0xe8, script: 0x5, flags: 0x0}, + 129: {region: 0x12b, script: 0x34, flags: 0x0}, + 131: {region: 0x99, script: 0x22, flags: 0x0}, + 132: {region: 0x165, script: 0x5a, flags: 0x0}, + 133: {region: 0x99, script: 0x22, flags: 0x0}, + 134: {region: 0xe7, script: 0x5a, flags: 0x0}, + 135: {region: 0x165, script: 0x5a, flags: 0x0}, + 136: {region: 0x99, script: 0x22, flags: 0x0}, + 137: {region: 0x165, script: 0x5a, flags: 0x0}, + 138: {region: 0x13f, script: 0x5a, flags: 0x0}, + 139: {region: 0x165, script: 0x5a, flags: 0x0}, + 140: {region: 0x165, script: 0x5a, flags: 0x0}, + 141: {region: 0xe7, script: 0x5a, flags: 0x0}, + 142: {region: 0x165, script: 0x5a, flags: 0x0}, + 143: {region: 0xd6, script: 0x5a, flags: 0x0}, + 144: {region: 0x165, script: 0x5a, flags: 0x0}, + 145: {region: 0x165, script: 0x5a, flags: 0x0}, + 146: {region: 0x165, script: 0x5a, flags: 0x0}, + 147: {region: 0x165, script: 0x2c, flags: 0x0}, + 148: {region: 0x99, script: 0x22, flags: 0x0}, + 149: {region: 0x95, script: 0x5a, flags: 0x0}, + 150: {region: 0x165, script: 0x5a, flags: 0x0}, + 151: {region: 0x165, script: 0x5a, flags: 0x0}, + 152: {region: 0x114, script: 0x5a, flags: 0x0}, + 153: {region: 0x165, script: 0x5a, flags: 0x0}, + 154: {region: 0x165, script: 0x5a, flags: 0x0}, + 155: {region: 0x52, script: 0x5a, flags: 0x0}, + 156: {region: 0x165, script: 0x5a, flags: 0x0}, + 157: {region: 0xe7, script: 0x5a, flags: 0x0}, + 158: {region: 0x165, script: 0x5a, flags: 0x0}, + 159: {region: 0x13e, script: 0xe5, flags: 0x0}, + 160: {region: 0xc3, script: 0x5a, flags: 0x0}, + 161: {region: 0x165, script: 0x5a, flags: 0x0}, + 162: {region: 0x165, script: 0x5a, flags: 0x0}, + 163: {region: 0xc3, script: 0x5a, flags: 0x0}, + 164: {region: 0x165, script: 0x5a, flags: 0x0}, + 165: {region: 0x35, script: 0xe, flags: 0x0}, + 166: {region: 0x165, script: 0x5a, flags: 0x0}, + 167: {region: 0x165, script: 0x5a, flags: 0x0}, + 168: {region: 0x165, script: 0x5a, flags: 0x0}, + 169: {region: 0x53, script: 0xec, flags: 0x0}, + 170: {region: 0x165, script: 0x5a, flags: 0x0}, + 171: {region: 0x165, script: 0x5a, flags: 0x0}, + 172: {region: 0x165, script: 0x5a, flags: 0x0}, + 173: {region: 0x99, script: 0xe, flags: 0x0}, + 174: {region: 0x165, script: 0x5a, flags: 0x0}, + 175: {region: 0x9c, script: 0x5, flags: 0x0}, + 176: {region: 0x165, script: 0x5a, flags: 0x0}, + 177: {region: 0x4f, script: 0x5a, flags: 0x0}, + 178: {region: 0x78, script: 0x5a, flags: 0x0}, + 179: {region: 0x99, script: 0x22, flags: 0x0}, + 180: {region: 0xe8, script: 0x5, flags: 0x0}, + 181: {region: 0x99, script: 0x22, flags: 0x0}, + 182: {region: 0x165, script: 0x5a, flags: 0x0}, + 183: {region: 0x33, script: 0x5a, flags: 0x0}, + 184: {region: 0x165, script: 0x5a, flags: 0x0}, + 185: {region: 0xb4, script: 0xc, flags: 0x0}, + 186: {region: 0x52, script: 0x5a, flags: 0x0}, + 187: {region: 0x165, script: 0x2c, flags: 0x0}, + 188: {region: 0xe7, script: 0x5a, flags: 0x0}, + 189: {region: 0x165, script: 0x5a, flags: 0x0}, + 190: {region: 0xe8, script: 0x22, flags: 0x0}, + 191: {region: 0x106, script: 0x20, flags: 0x0}, + 192: {region: 0x15f, script: 0x5a, flags: 0x0}, + 193: {region: 0x165, script: 0x5a, flags: 0x0}, + 194: {region: 0x95, script: 0x5a, flags: 0x0}, + 195: {region: 0x165, script: 0x5a, flags: 0x0}, + 196: {region: 0x52, script: 0x5a, flags: 0x0}, + 197: {region: 0x165, script: 0x5a, flags: 0x0}, + 198: {region: 0x165, script: 0x5a, flags: 0x0}, + 199: {region: 0x165, script: 0x5a, flags: 0x0}, + 200: {region: 0x86, script: 0x5a, flags: 0x0}, + 201: {region: 0x165, script: 0x5a, flags: 0x0}, + 202: {region: 0x165, script: 0x5a, flags: 0x0}, + 203: {region: 0x165, script: 0x5a, flags: 0x0}, + 204: {region: 0x165, script: 0x5a, flags: 0x0}, + 205: {region: 0x6d, script: 0x2c, flags: 0x0}, + 206: {region: 0x165, script: 0x5a, flags: 0x0}, + 207: {region: 0x165, script: 0x5a, flags: 0x0}, + 208: {region: 0x52, script: 0x5a, flags: 0x0}, + 209: {region: 0x165, script: 0x5a, flags: 0x0}, + 210: {region: 0x165, script: 0x5a, flags: 0x0}, + 211: {region: 0xc3, script: 0x5a, flags: 0x0}, + 212: {region: 0x165, script: 0x5a, flags: 0x0}, + 213: {region: 0x165, script: 0x5a, flags: 0x0}, + 214: {region: 0x165, script: 0x5a, flags: 0x0}, + 215: {region: 0x6e, script: 0x5a, flags: 0x0}, + 216: {region: 0x165, script: 0x5a, flags: 0x0}, + 217: {region: 0x165, script: 0x5a, flags: 0x0}, + 218: {region: 0xd6, script: 0x5a, flags: 0x0}, + 219: {region: 0x35, script: 0x16, flags: 0x0}, + 220: {region: 0x106, script: 0x20, flags: 0x0}, + 221: {region: 0xe7, script: 0x5a, flags: 0x0}, + 222: {region: 0x165, script: 0x5a, flags: 0x0}, + 223: {region: 0x131, script: 0x5a, flags: 0x0}, + 224: {region: 0x8a, script: 0x5a, flags: 0x0}, + 225: {region: 0x75, script: 0x5a, flags: 0x0}, + 226: {region: 0x106, script: 0x20, flags: 0x0}, + 227: {region: 0x135, script: 0x5a, flags: 0x0}, + 228: {region: 0x49, script: 0x5a, flags: 0x0}, + 229: {region: 0x135, script: 0x1a, flags: 0x0}, + 230: {region: 0xa6, script: 0x5, flags: 0x0}, + 231: {region: 0x13e, script: 0x19, flags: 0x0}, + 232: {region: 0x165, script: 0x5a, flags: 0x0}, + 233: {region: 0x9b, script: 0x5, flags: 0x0}, + 234: {region: 0x165, script: 0x5a, flags: 0x0}, + 235: {region: 0x165, script: 0x5a, flags: 0x0}, + 236: {region: 0x165, script: 0x5a, flags: 0x0}, + 237: {region: 0x165, script: 0x5a, flags: 0x0}, + 238: {region: 0x165, script: 0x5a, flags: 0x0}, + 239: {region: 0xc5, script: 0xd8, flags: 0x0}, + 240: {region: 0x78, script: 0x5a, flags: 0x0}, + 241: {region: 0x6b, script: 0x1d, flags: 0x0}, + 242: {region: 0xe7, script: 0x5a, flags: 0x0}, + 243: {region: 0x49, script: 0x17, flags: 0x0}, + 244: {region: 0x130, script: 0x20, flags: 0x0}, + 245: {region: 0x49, script: 0x17, flags: 0x0}, + 246: {region: 0x49, script: 0x17, flags: 0x0}, + 247: {region: 0x49, script: 0x17, flags: 0x0}, + 248: {region: 0x49, script: 0x17, flags: 0x0}, + 249: {region: 0x10a, script: 0x5a, flags: 0x0}, + 250: {region: 0x5e, script: 0x5a, flags: 0x0}, + 251: {region: 0xe9, script: 0x5a, flags: 0x0}, + 252: {region: 0x49, script: 0x17, flags: 0x0}, + 253: {region: 0xc4, script: 0x86, flags: 0x0}, + 254: {region: 0x8, script: 0x2, flags: 0x1}, + 255: {region: 0x106, script: 0x20, flags: 0x0}, + 256: {region: 0x7b, script: 0x5a, flags: 0x0}, + 257: {region: 0x63, script: 0x5a, flags: 0x0}, + 258: {region: 0x165, script: 0x5a, flags: 0x0}, + 259: {region: 0x165, script: 0x5a, flags: 0x0}, + 260: {region: 0x165, script: 0x5a, flags: 0x0}, + 261: {region: 0x165, script: 0x5a, flags: 0x0}, + 262: {region: 0x135, script: 0x5a, flags: 0x0}, + 263: {region: 0x106, script: 0x20, flags: 0x0}, + 264: {region: 0xa4, script: 0x5a, flags: 0x0}, + 265: {region: 0x165, script: 0x5a, flags: 0x0}, + 266: {region: 0x165, script: 0x5a, flags: 0x0}, + 267: {region: 0x99, script: 0x5, flags: 0x0}, + 268: {region: 0x165, script: 0x5a, flags: 0x0}, + 269: {region: 0x60, script: 0x5a, flags: 0x0}, + 270: {region: 0x165, script: 0x5a, flags: 0x0}, + 271: {region: 0x49, script: 0x5a, flags: 0x0}, + 272: {region: 0x165, script: 0x5a, flags: 0x0}, + 273: {region: 0x165, script: 0x5a, flags: 0x0}, + 274: {region: 0x165, script: 0x5a, flags: 0x0}, + 275: {region: 0x165, script: 0x5, flags: 0x0}, + 276: {region: 0x49, script: 0x5a, flags: 0x0}, + 277: {region: 0x165, script: 0x5a, flags: 0x0}, + 278: {region: 0x165, script: 0x5a, flags: 0x0}, + 279: {region: 0xd4, script: 0x5a, flags: 0x0}, + 280: {region: 0x4f, script: 0x5a, flags: 0x0}, + 281: {region: 0x165, script: 0x5a, flags: 0x0}, + 282: {region: 0x99, script: 0x5, flags: 0x0}, + 283: {region: 0x165, script: 0x5a, flags: 0x0}, + 284: {region: 0x165, script: 0x5a, flags: 0x0}, + 285: {region: 0x165, script: 0x5a, flags: 0x0}, + 286: {region: 0x165, script: 0x2c, flags: 0x0}, + 287: {region: 0x60, script: 0x5a, flags: 0x0}, + 288: {region: 0xc3, script: 0x5a, flags: 0x0}, + 289: {region: 0xd0, script: 0x5a, flags: 0x0}, + 290: {region: 0x165, script: 0x5a, flags: 0x0}, + 291: {region: 0xdb, script: 0x22, flags: 0x0}, + 292: {region: 0x52, script: 0x5a, flags: 0x0}, + 293: {region: 0x165, script: 0x5a, flags: 0x0}, + 294: {region: 0x165, script: 0x5a, flags: 0x0}, + 295: {region: 0x165, script: 0x5a, flags: 0x0}, + 296: {region: 0xcd, script: 0xea, flags: 0x0}, + 297: {region: 0x165, script: 0x5a, flags: 0x0}, + 298: {region: 0x165, script: 0x5a, flags: 0x0}, + 299: {region: 0x114, script: 0x5a, flags: 0x0}, + 300: {region: 0x37, script: 0x5a, flags: 0x0}, + 301: {region: 0x43, script: 0xec, flags: 0x0}, + 302: {region: 0x165, script: 0x5a, flags: 0x0}, + 303: {region: 0xa4, script: 0x5a, flags: 0x0}, + 304: {region: 0x80, script: 0x5a, flags: 0x0}, + 305: {region: 0xd6, script: 0x5a, flags: 0x0}, + 306: {region: 0x9e, script: 0x5a, flags: 0x0}, + 307: {region: 0x6b, script: 0x29, flags: 0x0}, + 308: {region: 0x165, script: 0x5a, flags: 0x0}, + 309: {region: 0xc4, script: 0x4b, flags: 0x0}, + 310: {region: 0x87, script: 0x34, flags: 0x0}, + 311: {region: 0x165, script: 0x5a, flags: 0x0}, + 312: {region: 0x165, script: 0x5a, flags: 0x0}, + 313: {region: 0xa, script: 0x2, flags: 0x1}, + 314: {region: 0x165, script: 0x5a, flags: 0x0}, + 315: {region: 0x165, script: 0x5a, flags: 0x0}, + 316: {region: 0x1, script: 0x5a, flags: 0x0}, + 317: {region: 0x165, script: 0x5a, flags: 0x0}, + 318: {region: 0x6e, script: 0x5a, flags: 0x0}, + 319: {region: 0x135, script: 0x5a, flags: 0x0}, + 320: {region: 0x6a, script: 0x5a, flags: 0x0}, + 321: {region: 0x165, script: 0x5a, flags: 0x0}, + 322: {region: 0x9e, script: 0x46, flags: 0x0}, + 323: {region: 0x165, script: 0x5a, flags: 0x0}, + 324: {region: 0x165, script: 0x5a, flags: 0x0}, + 325: {region: 0x6e, script: 0x5a, flags: 0x0}, + 326: {region: 0x52, script: 0x5a, flags: 0x0}, + 327: {region: 0x6e, script: 0x5a, flags: 0x0}, + 328: {region: 0x9c, script: 0x5, flags: 0x0}, + 329: {region: 0x165, script: 0x5a, flags: 0x0}, + 330: {region: 0x165, script: 0x5a, flags: 0x0}, + 331: {region: 0x165, script: 0x5a, flags: 0x0}, + 332: {region: 0x165, script: 0x5a, flags: 0x0}, + 333: {region: 0x86, script: 0x5a, flags: 0x0}, + 334: {region: 0xc, script: 0x2, flags: 0x1}, + 335: {region: 0x165, script: 0x5a, flags: 0x0}, + 336: {region: 0xc3, script: 0x5a, flags: 0x0}, + 337: {region: 0x72, script: 0x5a, flags: 0x0}, + 338: {region: 0x10b, script: 0x5, flags: 0x0}, + 339: {region: 0xe7, script: 0x5a, flags: 0x0}, + 340: {region: 0x10c, script: 0x5a, flags: 0x0}, + 341: {region: 0x73, script: 0x5a, flags: 0x0}, + 342: {region: 0x165, script: 0x5a, flags: 0x0}, + 343: {region: 0x165, script: 0x5a, flags: 0x0}, + 344: {region: 0x76, script: 0x5a, flags: 0x0}, + 345: {region: 0x165, script: 0x5a, flags: 0x0}, + 346: {region: 0x3b, script: 0x5a, flags: 0x0}, + 347: {region: 0x165, script: 0x5a, flags: 0x0}, + 348: {region: 0x165, script: 0x5a, flags: 0x0}, + 349: {region: 0x165, script: 0x5a, flags: 0x0}, + 350: {region: 0x78, script: 0x5a, flags: 0x0}, + 351: {region: 0x135, script: 0x5a, flags: 0x0}, + 352: {region: 0x78, script: 0x5a, flags: 0x0}, + 353: {region: 0x60, script: 0x5a, flags: 0x0}, + 354: {region: 0x60, script: 0x5a, flags: 0x0}, + 355: {region: 0x52, script: 0x5, flags: 0x0}, + 356: {region: 0x140, script: 0x5a, flags: 0x0}, + 357: {region: 0x165, script: 0x5a, flags: 0x0}, + 358: {region: 0x84, script: 0x5a, flags: 0x0}, + 359: {region: 0x165, script: 0x5a, flags: 0x0}, + 360: {region: 0xd4, script: 0x5a, flags: 0x0}, + 361: {region: 0x9e, script: 0x5a, flags: 0x0}, + 362: {region: 0xd6, script: 0x5a, flags: 0x0}, + 363: {region: 0x165, script: 0x5a, flags: 0x0}, + 364: {region: 0x10b, script: 0x5a, flags: 0x0}, + 365: {region: 0xd9, script: 0x5a, flags: 0x0}, + 366: {region: 0x96, script: 0x5a, flags: 0x0}, + 367: {region: 0x80, script: 0x5a, flags: 0x0}, + 368: {region: 0x165, script: 0x5a, flags: 0x0}, + 369: {region: 0xbc, script: 0x5a, flags: 0x0}, + 370: {region: 0x165, script: 0x5a, flags: 0x0}, + 371: {region: 0x165, script: 0x5a, flags: 0x0}, + 372: {region: 0x165, script: 0x5a, flags: 0x0}, + 373: {region: 0x53, script: 0x3b, flags: 0x0}, + 374: {region: 0x165, script: 0x5a, flags: 0x0}, + 375: {region: 0x95, script: 0x5a, flags: 0x0}, + 376: {region: 0x165, script: 0x5a, flags: 0x0}, + 377: {region: 0x165, script: 0x5a, flags: 0x0}, + 378: {region: 0x99, script: 0x22, flags: 0x0}, + 379: {region: 0x165, script: 0x5a, flags: 0x0}, + 380: {region: 0x9c, script: 0x5, flags: 0x0}, + 381: {region: 0x7e, script: 0x5a, flags: 0x0}, + 382: {region: 0x7b, script: 0x5a, flags: 0x0}, + 383: {region: 0x165, script: 0x5a, flags: 0x0}, + 384: {region: 0x165, script: 0x5a, flags: 0x0}, + 385: {region: 0x165, script: 0x5a, flags: 0x0}, + 386: {region: 0x165, script: 0x5a, flags: 0x0}, + 387: {region: 0x165, script: 0x5a, flags: 0x0}, + 388: {region: 0x165, script: 0x5a, flags: 0x0}, + 389: {region: 0x6f, script: 0x2c, flags: 0x0}, + 390: {region: 0x165, script: 0x5a, flags: 0x0}, + 391: {region: 0xdb, script: 0x22, flags: 0x0}, + 392: {region: 0x165, script: 0x5a, flags: 0x0}, + 393: {region: 0xa7, script: 0x5a, flags: 0x0}, + 394: {region: 0x165, script: 0x5a, flags: 0x0}, + 395: {region: 0xe8, script: 0x5, flags: 0x0}, + 396: {region: 0x165, script: 0x5a, flags: 0x0}, + 397: {region: 0xe8, script: 0x5, flags: 0x0}, + 398: {region: 0x165, script: 0x5a, flags: 0x0}, + 399: {region: 0x165, script: 0x5a, flags: 0x0}, + 400: {region: 0x6e, script: 0x5a, flags: 0x0}, + 401: {region: 0x9c, script: 0x5, flags: 0x0}, + 402: {region: 0x165, script: 0x5a, flags: 0x0}, + 403: {region: 0x165, script: 0x2c, flags: 0x0}, + 404: {region: 0xf1, script: 0x5a, flags: 0x0}, + 405: {region: 0x165, script: 0x5a, flags: 0x0}, + 406: {region: 0x165, script: 0x5a, flags: 0x0}, + 407: {region: 0x165, script: 0x5a, flags: 0x0}, + 408: {region: 0x165, script: 0x2c, flags: 0x0}, + 409: {region: 0x165, script: 0x5a, flags: 0x0}, + 410: {region: 0x99, script: 0x22, flags: 0x0}, + 411: {region: 0x99, script: 0xe6, flags: 0x0}, + 412: {region: 0x95, script: 0x5a, flags: 0x0}, + 413: {region: 0xd9, script: 0x5a, flags: 0x0}, + 414: {region: 0x130, script: 0x32, flags: 0x0}, + 415: {region: 0x165, script: 0x5a, flags: 0x0}, + 416: {region: 0xe, script: 0x2, flags: 0x1}, + 417: {region: 0x99, script: 0xe, flags: 0x0}, + 418: {region: 0x165, script: 0x5a, flags: 0x0}, + 419: {region: 0x4e, script: 0x5a, flags: 0x0}, + 420: {region: 0x99, script: 0x35, flags: 0x0}, + 421: {region: 0x41, script: 0x5a, flags: 0x0}, + 422: {region: 0x54, script: 0x5a, flags: 0x0}, + 423: {region: 0x165, script: 0x5a, flags: 0x0}, + 424: {region: 0x80, script: 0x5a, flags: 0x0}, + 425: {region: 0x165, script: 0x5a, flags: 0x0}, + 426: {region: 0x165, script: 0x5a, flags: 0x0}, + 427: {region: 0xa4, script: 0x5a, flags: 0x0}, + 428: {region: 0x98, script: 0x5a, flags: 0x0}, + 429: {region: 0x165, script: 0x5a, flags: 0x0}, + 430: {region: 0xdb, script: 0x22, flags: 0x0}, + 431: {region: 0x165, script: 0x5a, flags: 0x0}, + 432: {region: 0x165, script: 0x5, flags: 0x0}, + 433: {region: 0x49, script: 0x5a, flags: 0x0}, + 434: {region: 0x165, script: 0x5, flags: 0x0}, + 435: {region: 0x165, script: 0x5a, flags: 0x0}, + 436: {region: 0x10, script: 0x3, flags: 0x1}, + 437: {region: 0x165, script: 0x5a, flags: 0x0}, + 438: {region: 0x53, script: 0x3b, flags: 0x0}, + 439: {region: 0x165, script: 0x5a, flags: 0x0}, + 440: {region: 0x135, script: 0x5a, flags: 0x0}, + 441: {region: 0x24, script: 0x5, flags: 0x0}, + 442: {region: 0x165, script: 0x5a, flags: 0x0}, + 443: {region: 0x165, script: 0x2c, flags: 0x0}, + 444: {region: 0x97, script: 0x3e, flags: 0x0}, + 445: {region: 0x165, script: 0x5a, flags: 0x0}, + 446: {region: 0x99, script: 0x22, flags: 0x0}, + 447: {region: 0x165, script: 0x5a, flags: 0x0}, + 448: {region: 0x73, script: 0x5a, flags: 0x0}, + 449: {region: 0x165, script: 0x5a, flags: 0x0}, + 450: {region: 0x165, script: 0x5a, flags: 0x0}, + 451: {region: 0xe7, script: 0x5a, flags: 0x0}, + 452: {region: 0x165, script: 0x5a, flags: 0x0}, + 453: {region: 0x12b, script: 0x40, flags: 0x0}, + 454: {region: 0x53, script: 0x90, flags: 0x0}, + 455: {region: 0x165, script: 0x5a, flags: 0x0}, + 456: {region: 0xe8, script: 0x5, flags: 0x0}, + 457: {region: 0x99, script: 0x22, flags: 0x0}, + 458: {region: 0xaf, script: 0x41, flags: 0x0}, + 459: {region: 0xe7, script: 0x5a, flags: 0x0}, + 460: {region: 0xe8, script: 0x5, flags: 0x0}, + 461: {region: 0xe6, script: 0x5a, flags: 0x0}, + 462: {region: 0x99, script: 0x22, flags: 0x0}, + 463: {region: 0x99, script: 0x22, flags: 0x0}, + 464: {region: 0x165, script: 0x5a, flags: 0x0}, + 465: {region: 0x90, script: 0x5a, flags: 0x0}, + 466: {region: 0x60, script: 0x5a, flags: 0x0}, + 467: {region: 0x53, script: 0x3b, flags: 0x0}, + 468: {region: 0x91, script: 0x5a, flags: 0x0}, + 469: {region: 0x92, script: 0x5a, flags: 0x0}, + 470: {region: 0x165, script: 0x5a, flags: 0x0}, + 471: {region: 0x28, script: 0x8, flags: 0x0}, + 472: {region: 0xd2, script: 0x5a, flags: 0x0}, + 473: {region: 0x78, script: 0x5a, flags: 0x0}, + 474: {region: 0x165, script: 0x5a, flags: 0x0}, + 475: {region: 0x165, script: 0x5a, flags: 0x0}, + 476: {region: 0xd0, script: 0x5a, flags: 0x0}, + 477: {region: 0xd6, script: 0x5a, flags: 0x0}, + 478: {region: 0x165, script: 0x5a, flags: 0x0}, + 479: {region: 0x165, script: 0x5a, flags: 0x0}, + 480: {region: 0x165, script: 0x5a, flags: 0x0}, + 481: {region: 0x95, script: 0x5a, flags: 0x0}, + 482: {region: 0x165, script: 0x5a, flags: 0x0}, + 483: {region: 0x165, script: 0x5a, flags: 0x0}, + 484: {region: 0x165, script: 0x5a, flags: 0x0}, + 486: {region: 0x122, script: 0x5a, flags: 0x0}, + 487: {region: 0xd6, script: 0x5a, flags: 0x0}, + 488: {region: 0x165, script: 0x5a, flags: 0x0}, + 489: {region: 0x165, script: 0x5a, flags: 0x0}, + 490: {region: 0x53, script: 0xfa, flags: 0x0}, + 491: {region: 0x165, script: 0x5a, flags: 0x0}, + 492: {region: 0x135, script: 0x5a, flags: 0x0}, + 493: {region: 0x165, script: 0x5a, flags: 0x0}, + 494: {region: 0x49, script: 0x5a, flags: 0x0}, + 495: {region: 0x165, script: 0x5a, flags: 0x0}, + 496: {region: 0x165, script: 0x5a, flags: 0x0}, + 497: {region: 0xe7, script: 0x5a, flags: 0x0}, + 498: {region: 0x165, script: 0x5a, flags: 0x0}, + 499: {region: 0x95, script: 0x5a, flags: 0x0}, + 500: {region: 0x106, script: 0x20, flags: 0x0}, + 501: {region: 0x1, script: 0x5a, flags: 0x0}, + 502: {region: 0x165, script: 0x5a, flags: 0x0}, + 503: {region: 0x165, script: 0x5a, flags: 0x0}, + 504: {region: 0x9d, script: 0x5a, flags: 0x0}, + 505: {region: 0x9e, script: 0x5a, flags: 0x0}, + 506: {region: 0x49, script: 0x17, flags: 0x0}, + 507: {region: 0x97, script: 0x3e, flags: 0x0}, + 508: {region: 0x165, script: 0x5a, flags: 0x0}, + 509: {region: 0x165, script: 0x5a, flags: 0x0}, + 510: {region: 0x106, script: 0x5a, flags: 0x0}, + 511: {region: 0x165, script: 0x5a, flags: 0x0}, + 512: {region: 0xa2, script: 0x49, flags: 0x0}, + 513: {region: 0x165, script: 0x5a, flags: 0x0}, + 514: {region: 0xa0, script: 0x5a, flags: 0x0}, + 515: {region: 0x1, script: 0x5a, flags: 0x0}, + 516: {region: 0x165, script: 0x5a, flags: 0x0}, + 517: {region: 0x165, script: 0x5a, flags: 0x0}, + 518: {region: 0x165, script: 0x5a, flags: 0x0}, + 519: {region: 0x52, script: 0x5a, flags: 0x0}, + 520: {region: 0x130, script: 0x3e, flags: 0x0}, + 521: {region: 0x165, script: 0x5a, flags: 0x0}, + 522: {region: 0x12f, script: 0x5a, flags: 0x0}, + 523: {region: 0xdb, script: 0x22, flags: 0x0}, + 524: {region: 0x165, script: 0x5a, flags: 0x0}, + 525: {region: 0x63, script: 0x5a, flags: 0x0}, + 526: {region: 0x95, script: 0x5a, flags: 0x0}, + 527: {region: 0x95, script: 0x5a, flags: 0x0}, + 528: {region: 0x7d, script: 0x2e, flags: 0x0}, + 529: {region: 0x137, script: 0x20, flags: 0x0}, + 530: {region: 0x67, script: 0x5a, flags: 0x0}, + 531: {region: 0xc4, script: 0x5a, flags: 0x0}, + 532: {region: 0x165, script: 0x5a, flags: 0x0}, + 533: {region: 0x165, script: 0x5a, flags: 0x0}, + 534: {region: 0xd6, script: 0x5a, flags: 0x0}, + 535: {region: 0xa4, script: 0x5a, flags: 0x0}, + 536: {region: 0xc3, script: 0x5a, flags: 0x0}, + 537: {region: 0x106, script: 0x20, flags: 0x0}, + 538: {region: 0x165, script: 0x5a, flags: 0x0}, + 539: {region: 0x165, script: 0x5a, flags: 0x0}, + 540: {region: 0x165, script: 0x5a, flags: 0x0}, + 541: {region: 0x165, script: 0x5a, flags: 0x0}, + 542: {region: 0xd4, script: 0x5, flags: 0x0}, + 543: {region: 0xd6, script: 0x5a, flags: 0x0}, + 544: {region: 0x164, script: 0x5a, flags: 0x0}, + 545: {region: 0x165, script: 0x5a, flags: 0x0}, + 546: {region: 0x165, script: 0x5a, flags: 0x0}, + 547: {region: 0x12f, script: 0x5a, flags: 0x0}, + 548: {region: 0x122, script: 0x5, flags: 0x0}, + 549: {region: 0x165, script: 0x5a, flags: 0x0}, + 550: {region: 0x123, script: 0xeb, flags: 0x0}, + 551: {region: 0x5a, script: 0x5a, flags: 0x0}, + 552: {region: 0x52, script: 0x5a, flags: 0x0}, + 553: {region: 0x165, script: 0x5a, flags: 0x0}, + 554: {region: 0x4f, script: 0x5a, flags: 0x0}, + 555: {region: 0x99, script: 0x22, flags: 0x0}, + 556: {region: 0x99, script: 0x22, flags: 0x0}, + 557: {region: 0x4b, script: 0x5a, flags: 0x0}, + 558: {region: 0x95, script: 0x5a, flags: 0x0}, + 559: {region: 0x165, script: 0x5a, flags: 0x0}, + 560: {region: 0x41, script: 0x5a, flags: 0x0}, + 561: {region: 0x99, script: 0x5a, flags: 0x0}, + 562: {region: 0x53, script: 0xe2, flags: 0x0}, + 563: {region: 0x99, script: 0x22, flags: 0x0}, + 564: {region: 0xc3, script: 0x5a, flags: 0x0}, + 565: {region: 0x165, script: 0x5a, flags: 0x0}, + 566: {region: 0x99, script: 0x75, flags: 0x0}, + 567: {region: 0xe8, script: 0x5, flags: 0x0}, + 568: {region: 0x165, script: 0x5a, flags: 0x0}, + 569: {region: 0xa4, script: 0x5a, flags: 0x0}, + 570: {region: 0x165, script: 0x5a, flags: 0x0}, + 571: {region: 0x12b, script: 0x5a, flags: 0x0}, + 572: {region: 0x165, script: 0x5a, flags: 0x0}, + 573: {region: 0xd2, script: 0x5a, flags: 0x0}, + 574: {region: 0x165, script: 0x5a, flags: 0x0}, + 575: {region: 0xaf, script: 0x57, flags: 0x0}, + 576: {region: 0x165, script: 0x5a, flags: 0x0}, + 577: {region: 0x165, script: 0x5a, flags: 0x0}, + 578: {region: 0x13, script: 0x6, flags: 0x1}, + 579: {region: 0x165, script: 0x5a, flags: 0x0}, + 580: {region: 0x52, script: 0x5a, flags: 0x0}, + 581: {region: 0x82, script: 0x5a, flags: 0x0}, + 582: {region: 0xa4, script: 0x5a, flags: 0x0}, + 583: {region: 0x165, script: 0x5a, flags: 0x0}, + 584: {region: 0x165, script: 0x5a, flags: 0x0}, + 585: {region: 0x165, script: 0x5a, flags: 0x0}, + 586: {region: 0xa6, script: 0x4e, flags: 0x0}, + 587: {region: 0x2a, script: 0x5a, flags: 0x0}, + 588: {region: 0x165, script: 0x5a, flags: 0x0}, + 589: {region: 0x165, script: 0x5a, flags: 0x0}, + 590: {region: 0x165, script: 0x5a, flags: 0x0}, + 591: {region: 0x165, script: 0x5a, flags: 0x0}, + 592: {region: 0x165, script: 0x5a, flags: 0x0}, + 593: {region: 0x99, script: 0x52, flags: 0x0}, + 594: {region: 0x8b, script: 0x5a, flags: 0x0}, + 595: {region: 0x165, script: 0x5a, flags: 0x0}, + 596: {region: 0xab, script: 0x53, flags: 0x0}, + 597: {region: 0x106, script: 0x20, flags: 0x0}, + 598: {region: 0x99, script: 0x22, flags: 0x0}, + 599: {region: 0x165, script: 0x5a, flags: 0x0}, + 600: {region: 0x75, script: 0x5a, flags: 0x0}, + 601: {region: 0x165, script: 0x5a, flags: 0x0}, + 602: {region: 0xb4, script: 0x5a, flags: 0x0}, + 603: {region: 0x165, script: 0x5a, flags: 0x0}, + 604: {region: 0x165, script: 0x5a, flags: 0x0}, + 605: {region: 0x165, script: 0x5a, flags: 0x0}, + 606: {region: 0x165, script: 0x5a, flags: 0x0}, + 607: {region: 0x165, script: 0x5a, flags: 0x0}, + 608: {region: 0x165, script: 0x5a, flags: 0x0}, + 609: {region: 0x165, script: 0x5a, flags: 0x0}, + 610: {region: 0x165, script: 0x2c, flags: 0x0}, + 611: {region: 0x165, script: 0x5a, flags: 0x0}, + 612: {region: 0x106, script: 0x20, flags: 0x0}, + 613: {region: 0x112, script: 0x5a, flags: 0x0}, + 614: {region: 0xe7, script: 0x5a, flags: 0x0}, + 615: {region: 0x106, script: 0x5a, flags: 0x0}, + 616: {region: 0x165, script: 0x5a, flags: 0x0}, + 617: {region: 0x99, script: 0x22, flags: 0x0}, + 618: {region: 0x99, script: 0x5, flags: 0x0}, + 619: {region: 0x12f, script: 0x5a, flags: 0x0}, + 620: {region: 0x165, script: 0x5a, flags: 0x0}, + 621: {region: 0x52, script: 0x5a, flags: 0x0}, + 622: {region: 0x60, script: 0x5a, flags: 0x0}, + 623: {region: 0x165, script: 0x5a, flags: 0x0}, + 624: {region: 0x165, script: 0x5a, flags: 0x0}, + 625: {region: 0x165, script: 0x2c, flags: 0x0}, + 626: {region: 0x165, script: 0x5a, flags: 0x0}, + 627: {region: 0x165, script: 0x5a, flags: 0x0}, + 628: {region: 0x19, script: 0x3, flags: 0x1}, + 629: {region: 0x165, script: 0x5a, flags: 0x0}, + 630: {region: 0x165, script: 0x5a, flags: 0x0}, + 631: {region: 0x165, script: 0x5a, flags: 0x0}, + 632: {region: 0x165, script: 0x5a, flags: 0x0}, + 633: {region: 0x106, script: 0x20, flags: 0x0}, + 634: {region: 0x165, script: 0x5a, flags: 0x0}, + 635: {region: 0x165, script: 0x5a, flags: 0x0}, + 636: {region: 0x165, script: 0x5a, flags: 0x0}, + 637: {region: 0x106, script: 0x20, flags: 0x0}, + 638: {region: 0x165, script: 0x5a, flags: 0x0}, + 639: {region: 0x95, script: 0x5a, flags: 0x0}, + 640: {region: 0xe8, script: 0x5, flags: 0x0}, + 641: {region: 0x7b, script: 0x5a, flags: 0x0}, + 642: {region: 0x165, script: 0x5a, flags: 0x0}, + 643: {region: 0x165, script: 0x5a, flags: 0x0}, + 644: {region: 0x165, script: 0x5a, flags: 0x0}, + 645: {region: 0x165, script: 0x2c, flags: 0x0}, + 646: {region: 0x123, script: 0xeb, flags: 0x0}, + 647: {region: 0xe8, script: 0x5, flags: 0x0}, + 648: {region: 0x165, script: 0x5a, flags: 0x0}, + 649: {region: 0x165, script: 0x5a, flags: 0x0}, + 650: {region: 0x1c, script: 0x5, flags: 0x1}, + 651: {region: 0x165, script: 0x5a, flags: 0x0}, + 652: {region: 0x165, script: 0x5a, flags: 0x0}, + 653: {region: 0x165, script: 0x5a, flags: 0x0}, + 654: {region: 0x138, script: 0x5a, flags: 0x0}, + 655: {region: 0x87, script: 0x5e, flags: 0x0}, + 656: {region: 0x97, script: 0x3e, flags: 0x0}, + 657: {region: 0x12f, script: 0x5a, flags: 0x0}, + 658: {region: 0xe8, script: 0x5, flags: 0x0}, + 659: {region: 0x131, script: 0x5a, flags: 0x0}, + 660: {region: 0x165, script: 0x5a, flags: 0x0}, + 661: {region: 0xb7, script: 0x5a, flags: 0x0}, + 662: {region: 0x106, script: 0x20, flags: 0x0}, + 663: {region: 0x165, script: 0x5a, flags: 0x0}, + 664: {region: 0x95, script: 0x5a, flags: 0x0}, + 665: {region: 0x165, script: 0x5a, flags: 0x0}, + 666: {region: 0x53, script: 0xeb, flags: 0x0}, + 667: {region: 0x165, script: 0x5a, flags: 0x0}, + 668: {region: 0x165, script: 0x5a, flags: 0x0}, + 669: {region: 0x165, script: 0x5a, flags: 0x0}, + 670: {region: 0x165, script: 0x5a, flags: 0x0}, + 671: {region: 0x99, script: 0x5c, flags: 0x0}, + 672: {region: 0x165, script: 0x5a, flags: 0x0}, + 673: {region: 0x165, script: 0x5a, flags: 0x0}, + 674: {region: 0x106, script: 0x20, flags: 0x0}, + 675: {region: 0x131, script: 0x5a, flags: 0x0}, + 676: {region: 0x165, script: 0x5a, flags: 0x0}, + 677: {region: 0xd9, script: 0x5a, flags: 0x0}, + 678: {region: 0x165, script: 0x5a, flags: 0x0}, + 679: {region: 0x165, script: 0x5a, flags: 0x0}, + 680: {region: 0x21, script: 0x2, flags: 0x1}, + 681: {region: 0x165, script: 0x5a, flags: 0x0}, + 682: {region: 0x165, script: 0x5a, flags: 0x0}, + 683: {region: 0x9e, script: 0x5a, flags: 0x0}, + 684: {region: 0x53, script: 0x60, flags: 0x0}, + 685: {region: 0x95, script: 0x5a, flags: 0x0}, + 686: {region: 0x9c, script: 0x5, flags: 0x0}, + 687: {region: 0x135, script: 0x5a, flags: 0x0}, + 688: {region: 0x165, script: 0x5a, flags: 0x0}, + 689: {region: 0x165, script: 0x5a, flags: 0x0}, + 690: {region: 0x99, script: 0xe6, flags: 0x0}, + 691: {region: 0x9e, script: 0x5a, flags: 0x0}, + 692: {region: 0x165, script: 0x5a, flags: 0x0}, + 693: {region: 0x4b, script: 0x5a, flags: 0x0}, + 694: {region: 0x165, script: 0x5a, flags: 0x0}, + 695: {region: 0x165, script: 0x5a, flags: 0x0}, + 696: {region: 0xaf, script: 0x57, flags: 0x0}, + 697: {region: 0x165, script: 0x5a, flags: 0x0}, + 698: {region: 0x165, script: 0x5a, flags: 0x0}, + 699: {region: 0x4b, script: 0x5a, flags: 0x0}, + 700: {region: 0x165, script: 0x5a, flags: 0x0}, + 701: {region: 0x165, script: 0x5a, flags: 0x0}, + 702: {region: 0x162, script: 0x5a, flags: 0x0}, + 703: {region: 0x9c, script: 0x5, flags: 0x0}, + 704: {region: 0xb6, script: 0x5a, flags: 0x0}, + 705: {region: 0xb8, script: 0x5a, flags: 0x0}, + 706: {region: 0x4b, script: 0x5a, flags: 0x0}, + 707: {region: 0x4b, script: 0x5a, flags: 0x0}, + 708: {region: 0xa4, script: 0x5a, flags: 0x0}, + 709: {region: 0xa4, script: 0x5a, flags: 0x0}, + 710: {region: 0x9c, script: 0x5, flags: 0x0}, + 711: {region: 0xb8, script: 0x5a, flags: 0x0}, + 712: {region: 0x123, script: 0xeb, flags: 0x0}, + 713: {region: 0x53, script: 0x3b, flags: 0x0}, + 714: {region: 0x12b, script: 0x5a, flags: 0x0}, + 715: {region: 0x95, script: 0x5a, flags: 0x0}, + 716: {region: 0x52, script: 0x5a, flags: 0x0}, + 717: {region: 0x99, script: 0x22, flags: 0x0}, + 718: {region: 0x99, script: 0x22, flags: 0x0}, + 719: {region: 0x95, script: 0x5a, flags: 0x0}, + 720: {region: 0x23, script: 0x3, flags: 0x1}, + 721: {region: 0xa4, script: 0x5a, flags: 0x0}, + 722: {region: 0x165, script: 0x5a, flags: 0x0}, + 723: {region: 0xcf, script: 0x5a, flags: 0x0}, + 724: {region: 0x165, script: 0x5a, flags: 0x0}, + 725: {region: 0x165, script: 0x5a, flags: 0x0}, + 726: {region: 0x165, script: 0x5a, flags: 0x0}, + 727: {region: 0x165, script: 0x5a, flags: 0x0}, + 728: {region: 0x165, script: 0x5a, flags: 0x0}, + 729: {region: 0x165, script: 0x5a, flags: 0x0}, + 730: {region: 0x165, script: 0x5a, flags: 0x0}, + 731: {region: 0x165, script: 0x5a, flags: 0x0}, + 732: {region: 0x165, script: 0x5a, flags: 0x0}, + 733: {region: 0x165, script: 0x5a, flags: 0x0}, + 734: {region: 0x165, script: 0x5a, flags: 0x0}, + 735: {region: 0x165, script: 0x5, flags: 0x0}, + 736: {region: 0x106, script: 0x20, flags: 0x0}, + 737: {region: 0xe7, script: 0x5a, flags: 0x0}, + 738: {region: 0x165, script: 0x5a, flags: 0x0}, + 739: {region: 0x95, script: 0x5a, flags: 0x0}, + 740: {region: 0x165, script: 0x2c, flags: 0x0}, + 741: {region: 0x165, script: 0x5a, flags: 0x0}, + 742: {region: 0x165, script: 0x5a, flags: 0x0}, + 743: {region: 0x165, script: 0x5a, flags: 0x0}, + 744: {region: 0x112, script: 0x5a, flags: 0x0}, + 745: {region: 0xa4, script: 0x5a, flags: 0x0}, + 746: {region: 0x165, script: 0x5a, flags: 0x0}, + 747: {region: 0x165, script: 0x5a, flags: 0x0}, + 748: {region: 0x123, script: 0x5, flags: 0x0}, + 749: {region: 0xcc, script: 0x5a, flags: 0x0}, + 750: {region: 0x165, script: 0x5a, flags: 0x0}, + 751: {region: 0x165, script: 0x5a, flags: 0x0}, + 752: {region: 0x165, script: 0x5a, flags: 0x0}, + 753: {region: 0xbf, script: 0x5a, flags: 0x0}, + 754: {region: 0xd1, script: 0x5a, flags: 0x0}, + 755: {region: 0x165, script: 0x5a, flags: 0x0}, + 756: {region: 0x52, script: 0x5a, flags: 0x0}, + 757: {region: 0xdb, script: 0x22, flags: 0x0}, + 758: {region: 0x12f, script: 0x5a, flags: 0x0}, + 759: {region: 0xc0, script: 0x5a, flags: 0x0}, + 760: {region: 0x165, script: 0x5a, flags: 0x0}, + 761: {region: 0x165, script: 0x5a, flags: 0x0}, + 762: {region: 0xe0, script: 0x5a, flags: 0x0}, + 763: {region: 0x165, script: 0x5a, flags: 0x0}, + 764: {region: 0x95, script: 0x5a, flags: 0x0}, + 765: {region: 0x9b, script: 0x3d, flags: 0x0}, + 766: {region: 0x165, script: 0x5a, flags: 0x0}, + 767: {region: 0xc2, script: 0x20, flags: 0x0}, + 768: {region: 0x165, script: 0x5, flags: 0x0}, + 769: {region: 0x165, script: 0x5a, flags: 0x0}, + 770: {region: 0x165, script: 0x5a, flags: 0x0}, + 771: {region: 0x165, script: 0x5a, flags: 0x0}, + 772: {region: 0x99, script: 0x6e, flags: 0x0}, + 773: {region: 0x165, script: 0x5a, flags: 0x0}, + 774: {region: 0x165, script: 0x5a, flags: 0x0}, + 775: {region: 0x10b, script: 0x5a, flags: 0x0}, + 776: {region: 0x165, script: 0x5a, flags: 0x0}, + 777: {region: 0x165, script: 0x5a, flags: 0x0}, + 778: {region: 0x165, script: 0x5a, flags: 0x0}, + 779: {region: 0x26, script: 0x3, flags: 0x1}, + 780: {region: 0x165, script: 0x5a, flags: 0x0}, + 781: {region: 0x165, script: 0x5a, flags: 0x0}, + 782: {region: 0x99, script: 0xe, flags: 0x0}, + 783: {region: 0xc4, script: 0x75, flags: 0x0}, + 785: {region: 0x165, script: 0x5a, flags: 0x0}, + 786: {region: 0x49, script: 0x5a, flags: 0x0}, + 787: {region: 0x49, script: 0x5a, flags: 0x0}, + 788: {region: 0x37, script: 0x5a, flags: 0x0}, + 789: {region: 0x165, script: 0x5a, flags: 0x0}, + 790: {region: 0x165, script: 0x5a, flags: 0x0}, + 791: {region: 0x165, script: 0x5a, flags: 0x0}, + 792: {region: 0x165, script: 0x5a, flags: 0x0}, + 793: {region: 0x165, script: 0x5a, flags: 0x0}, + 794: {region: 0x165, script: 0x5a, flags: 0x0}, + 795: {region: 0x99, script: 0x22, flags: 0x0}, + 796: {region: 0xdb, script: 0x22, flags: 0x0}, + 797: {region: 0x106, script: 0x20, flags: 0x0}, + 798: {region: 0x35, script: 0x72, flags: 0x0}, + 799: {region: 0x29, script: 0x3, flags: 0x1}, + 800: {region: 0xcb, script: 0x5a, flags: 0x0}, + 801: {region: 0x165, script: 0x5a, flags: 0x0}, + 802: {region: 0x165, script: 0x5a, flags: 0x0}, + 803: {region: 0x165, script: 0x5a, flags: 0x0}, + 804: {region: 0x99, script: 0x22, flags: 0x0}, + 805: {region: 0x52, script: 0x5a, flags: 0x0}, + 807: {region: 0x165, script: 0x5a, flags: 0x0}, + 808: {region: 0x135, script: 0x5a, flags: 0x0}, + 809: {region: 0x165, script: 0x5a, flags: 0x0}, + 810: {region: 0x165, script: 0x5a, flags: 0x0}, + 811: {region: 0xe8, script: 0x5, flags: 0x0}, + 812: {region: 0xc3, script: 0x5a, flags: 0x0}, + 813: {region: 0x99, script: 0x22, flags: 0x0}, + 814: {region: 0x95, script: 0x5a, flags: 0x0}, + 815: {region: 0x164, script: 0x5a, flags: 0x0}, + 816: {region: 0x165, script: 0x5a, flags: 0x0}, + 817: {region: 0xc4, script: 0x75, flags: 0x0}, + 818: {region: 0x165, script: 0x5a, flags: 0x0}, + 819: {region: 0x165, script: 0x2c, flags: 0x0}, + 820: {region: 0x106, script: 0x20, flags: 0x0}, + 821: {region: 0x165, script: 0x5a, flags: 0x0}, + 822: {region: 0x131, script: 0x5a, flags: 0x0}, + 823: {region: 0x9c, script: 0x66, flags: 0x0}, + 824: {region: 0x165, script: 0x5a, flags: 0x0}, + 825: {region: 0x165, script: 0x5a, flags: 0x0}, + 826: {region: 0x9c, script: 0x5, flags: 0x0}, + 827: {region: 0x165, script: 0x5a, flags: 0x0}, + 828: {region: 0x165, script: 0x5a, flags: 0x0}, + 829: {region: 0x165, script: 0x5a, flags: 0x0}, + 830: {region: 0xdd, script: 0x5a, flags: 0x0}, + 831: {region: 0x165, script: 0x5a, flags: 0x0}, + 832: {region: 0x165, script: 0x5a, flags: 0x0}, + 834: {region: 0x165, script: 0x5a, flags: 0x0}, + 835: {region: 0x53, script: 0x3b, flags: 0x0}, + 836: {region: 0x9e, script: 0x5a, flags: 0x0}, + 837: {region: 0xd2, script: 0x5a, flags: 0x0}, + 838: {region: 0x165, script: 0x5a, flags: 0x0}, + 839: {region: 0xda, script: 0x5a, flags: 0x0}, + 840: {region: 0x165, script: 0x5a, flags: 0x0}, + 841: {region: 0x165, script: 0x5a, flags: 0x0}, + 842: {region: 0x165, script: 0x5a, flags: 0x0}, + 843: {region: 0xcf, script: 0x5a, flags: 0x0}, + 844: {region: 0x165, script: 0x5a, flags: 0x0}, + 845: {region: 0x165, script: 0x5a, flags: 0x0}, + 846: {region: 0x164, script: 0x5a, flags: 0x0}, + 847: {region: 0xd1, script: 0x5a, flags: 0x0}, + 848: {region: 0x60, script: 0x5a, flags: 0x0}, + 849: {region: 0xdb, script: 0x22, flags: 0x0}, + 850: {region: 0x165, script: 0x5a, flags: 0x0}, + 851: {region: 0xdb, script: 0x22, flags: 0x0}, + 852: {region: 0x165, script: 0x5a, flags: 0x0}, + 853: {region: 0x165, script: 0x5a, flags: 0x0}, + 854: {region: 0xd2, script: 0x5a, flags: 0x0}, + 855: {region: 0x165, script: 0x5a, flags: 0x0}, + 856: {region: 0x165, script: 0x5a, flags: 0x0}, + 857: {region: 0xd1, script: 0x5a, flags: 0x0}, + 858: {region: 0x165, script: 0x5a, flags: 0x0}, + 859: {region: 0xcf, script: 0x5a, flags: 0x0}, + 860: {region: 0xcf, script: 0x5a, flags: 0x0}, + 861: {region: 0x165, script: 0x5a, flags: 0x0}, + 862: {region: 0x165, script: 0x5a, flags: 0x0}, + 863: {region: 0x95, script: 0x5a, flags: 0x0}, + 864: {region: 0x165, script: 0x5a, flags: 0x0}, + 865: {region: 0xdf, script: 0x5a, flags: 0x0}, + 866: {region: 0x165, script: 0x5a, flags: 0x0}, + 867: {region: 0x165, script: 0x5a, flags: 0x0}, + 868: {region: 0x99, script: 0x5a, flags: 0x0}, + 869: {region: 0x165, script: 0x5a, flags: 0x0}, + 870: {region: 0x165, script: 0x5a, flags: 0x0}, + 871: {region: 0xd9, script: 0x5a, flags: 0x0}, + 872: {region: 0x52, script: 0x5a, flags: 0x0}, + 873: {region: 0x165, script: 0x5a, flags: 0x0}, + 874: {region: 0xda, script: 0x5a, flags: 0x0}, + 875: {region: 0x165, script: 0x5a, flags: 0x0}, + 876: {region: 0x52, script: 0x5a, flags: 0x0}, + 877: {region: 0x165, script: 0x5a, flags: 0x0}, + 878: {region: 0x165, script: 0x5a, flags: 0x0}, + 879: {region: 0xda, script: 0x5a, flags: 0x0}, + 880: {region: 0x123, script: 0x56, flags: 0x0}, + 881: {region: 0x99, script: 0x22, flags: 0x0}, + 882: {region: 0x10c, script: 0xc9, flags: 0x0}, + 883: {region: 0x165, script: 0x5a, flags: 0x0}, + 884: {region: 0x165, script: 0x5a, flags: 0x0}, + 885: {region: 0x84, script: 0x7c, flags: 0x0}, + 886: {region: 0x161, script: 0x5a, flags: 0x0}, + 887: {region: 0x165, script: 0x5a, flags: 0x0}, + 888: {region: 0x49, script: 0x17, flags: 0x0}, + 889: {region: 0x165, script: 0x5a, flags: 0x0}, + 890: {region: 0x161, script: 0x5a, flags: 0x0}, + 891: {region: 0x165, script: 0x5a, flags: 0x0}, + 892: {region: 0x165, script: 0x5a, flags: 0x0}, + 893: {region: 0x165, script: 0x5a, flags: 0x0}, + 894: {region: 0x165, script: 0x5a, flags: 0x0}, + 895: {region: 0x165, script: 0x5a, flags: 0x0}, + 896: {region: 0x117, script: 0x5a, flags: 0x0}, + 897: {region: 0x165, script: 0x5a, flags: 0x0}, + 898: {region: 0x165, script: 0x5a, flags: 0x0}, + 899: {region: 0x135, script: 0x5a, flags: 0x0}, + 900: {region: 0x165, script: 0x5a, flags: 0x0}, + 901: {region: 0x53, script: 0x5a, flags: 0x0}, + 902: {region: 0x165, script: 0x5a, flags: 0x0}, + 903: {region: 0xce, script: 0x5a, flags: 0x0}, + 904: {region: 0x12f, script: 0x5a, flags: 0x0}, + 905: {region: 0x131, script: 0x5a, flags: 0x0}, + 906: {region: 0x80, script: 0x5a, flags: 0x0}, + 907: {region: 0x78, script: 0x5a, flags: 0x0}, + 908: {region: 0x165, script: 0x5a, flags: 0x0}, + 910: {region: 0x165, script: 0x5a, flags: 0x0}, + 911: {region: 0x165, script: 0x5a, flags: 0x0}, + 912: {region: 0x6f, script: 0x5a, flags: 0x0}, + 913: {region: 0x165, script: 0x5a, flags: 0x0}, + 914: {region: 0x165, script: 0x5a, flags: 0x0}, + 915: {region: 0x165, script: 0x5a, flags: 0x0}, + 916: {region: 0x165, script: 0x5a, flags: 0x0}, + 917: {region: 0x99, script: 0x81, flags: 0x0}, + 918: {region: 0x165, script: 0x5a, flags: 0x0}, + 919: {region: 0x165, script: 0x5, flags: 0x0}, + 920: {region: 0x7d, script: 0x20, flags: 0x0}, + 921: {region: 0x135, script: 0x82, flags: 0x0}, + 922: {region: 0x165, script: 0x5, flags: 0x0}, + 923: {region: 0xc5, script: 0x80, flags: 0x0}, + 924: {region: 0x165, script: 0x5a, flags: 0x0}, + 925: {region: 0x2c, script: 0x3, flags: 0x1}, + 926: {region: 0xe7, script: 0x5a, flags: 0x0}, + 927: {region: 0x2f, script: 0x2, flags: 0x1}, + 928: {region: 0xe7, script: 0x5a, flags: 0x0}, + 929: {region: 0x30, script: 0x5a, flags: 0x0}, + 930: {region: 0xf0, script: 0x5a, flags: 0x0}, + 931: {region: 0x165, script: 0x5a, flags: 0x0}, + 932: {region: 0x78, script: 0x5a, flags: 0x0}, + 933: {region: 0xd6, script: 0x5a, flags: 0x0}, + 934: {region: 0x135, script: 0x5a, flags: 0x0}, + 935: {region: 0x49, script: 0x5a, flags: 0x0}, + 936: {region: 0x165, script: 0x5a, flags: 0x0}, + 937: {region: 0x9c, script: 0xf7, flags: 0x0}, + 938: {region: 0x165, script: 0x5a, flags: 0x0}, + 939: {region: 0x60, script: 0x5a, flags: 0x0}, + 940: {region: 0x165, script: 0x5, flags: 0x0}, + 941: {region: 0xb0, script: 0x8e, flags: 0x0}, + 943: {region: 0x165, script: 0x5a, flags: 0x0}, + 944: {region: 0x165, script: 0x5a, flags: 0x0}, + 945: {region: 0x99, script: 0x12, flags: 0x0}, + 946: {region: 0xa4, script: 0x5a, flags: 0x0}, + 947: {region: 0xe9, script: 0x5a, flags: 0x0}, + 948: {region: 0x165, script: 0x5a, flags: 0x0}, + 949: {region: 0x9e, script: 0x5a, flags: 0x0}, + 950: {region: 0x165, script: 0x5a, flags: 0x0}, + 951: {region: 0x165, script: 0x5a, flags: 0x0}, + 952: {region: 0x87, script: 0x34, flags: 0x0}, + 953: {region: 0x75, script: 0x5a, flags: 0x0}, + 954: {region: 0x165, script: 0x5a, flags: 0x0}, + 955: {region: 0xe8, script: 0x4d, flags: 0x0}, + 956: {region: 0x9c, script: 0x5, flags: 0x0}, + 957: {region: 0x1, script: 0x5a, flags: 0x0}, + 958: {region: 0x24, script: 0x5, flags: 0x0}, + 959: {region: 0x165, script: 0x5a, flags: 0x0}, + 960: {region: 0x41, script: 0x5a, flags: 0x0}, + 961: {region: 0x165, script: 0x5a, flags: 0x0}, + 962: {region: 0x7a, script: 0x5a, flags: 0x0}, + 963: {region: 0x165, script: 0x5a, flags: 0x0}, + 964: {region: 0xe4, script: 0x5a, flags: 0x0}, + 965: {region: 0x89, script: 0x5a, flags: 0x0}, + 966: {region: 0x69, script: 0x5a, flags: 0x0}, + 967: {region: 0x165, script: 0x5a, flags: 0x0}, + 968: {region: 0x99, script: 0x22, flags: 0x0}, + 969: {region: 0x165, script: 0x5a, flags: 0x0}, + 970: {region: 0x102, script: 0x5a, flags: 0x0}, + 971: {region: 0x95, script: 0x5a, flags: 0x0}, + 972: {region: 0x165, script: 0x5a, flags: 0x0}, + 973: {region: 0x165, script: 0x5a, flags: 0x0}, + 974: {region: 0x9e, script: 0x5a, flags: 0x0}, + 975: {region: 0x165, script: 0x5, flags: 0x0}, + 976: {region: 0x99, script: 0x5a, flags: 0x0}, + 977: {region: 0x31, script: 0x2, flags: 0x1}, + 978: {region: 0xdb, script: 0x22, flags: 0x0}, + 979: {region: 0x35, script: 0xe, flags: 0x0}, + 980: {region: 0x4e, script: 0x5a, flags: 0x0}, + 981: {region: 0x72, script: 0x5a, flags: 0x0}, + 982: {region: 0x4e, script: 0x5a, flags: 0x0}, + 983: {region: 0x9c, script: 0x5, flags: 0x0}, + 984: {region: 0x10c, script: 0x5a, flags: 0x0}, + 985: {region: 0x3a, script: 0x5a, flags: 0x0}, + 986: {region: 0x165, script: 0x5a, flags: 0x0}, + 987: {region: 0xd1, script: 0x5a, flags: 0x0}, + 988: {region: 0x104, script: 0x5a, flags: 0x0}, + 989: {region: 0x95, script: 0x5a, flags: 0x0}, + 990: {region: 0x12f, script: 0x5a, flags: 0x0}, + 991: {region: 0x165, script: 0x5a, flags: 0x0}, + 992: {region: 0x165, script: 0x5a, flags: 0x0}, + 993: {region: 0x73, script: 0x5a, flags: 0x0}, + 994: {region: 0x106, script: 0x20, flags: 0x0}, + 995: {region: 0x130, script: 0x20, flags: 0x0}, + 996: {region: 0x109, script: 0x5a, flags: 0x0}, + 997: {region: 0x107, script: 0x5a, flags: 0x0}, + 998: {region: 0x12f, script: 0x5a, flags: 0x0}, + 999: {region: 0x165, script: 0x5a, flags: 0x0}, + 1000: {region: 0xa2, script: 0x4c, flags: 0x0}, + 1001: {region: 0x99, script: 0x22, flags: 0x0}, + 1002: {region: 0x80, script: 0x5a, flags: 0x0}, + 1003: {region: 0x106, script: 0x20, flags: 0x0}, + 1004: {region: 0xa4, script: 0x5a, flags: 0x0}, + 1005: {region: 0x95, script: 0x5a, flags: 0x0}, + 1006: {region: 0x99, script: 0x5a, flags: 0x0}, + 1007: {region: 0x114, script: 0x5a, flags: 0x0}, + 1008: {region: 0x99, script: 0xcd, flags: 0x0}, + 1009: {region: 0x165, script: 0x5a, flags: 0x0}, + 1010: {region: 0x165, script: 0x5a, flags: 0x0}, + 1011: {region: 0x12f, script: 0x5a, flags: 0x0}, + 1012: {region: 0x9e, script: 0x5a, flags: 0x0}, + 1013: {region: 0x99, script: 0x22, flags: 0x0}, + 1014: {region: 0x165, script: 0x5, flags: 0x0}, + 1015: {region: 0x9e, script: 0x5a, flags: 0x0}, + 1016: {region: 0x7b, script: 0x5a, flags: 0x0}, + 1017: {region: 0x49, script: 0x5a, flags: 0x0}, + 1018: {region: 0x33, script: 0x4, flags: 0x1}, + 1019: {region: 0x9e, script: 0x5a, flags: 0x0}, + 1020: {region: 0x9c, script: 0x5, flags: 0x0}, + 1021: {region: 0xda, script: 0x5a, flags: 0x0}, + 1022: {region: 0x4f, script: 0x5a, flags: 0x0}, + 1023: {region: 0xd1, script: 0x5a, flags: 0x0}, + 1024: {region: 0xcf, script: 0x5a, flags: 0x0}, + 1025: {region: 0xc3, script: 0x5a, flags: 0x0}, + 1026: {region: 0x4c, script: 0x5a, flags: 0x0}, + 1027: {region: 0x96, script: 0x7e, flags: 0x0}, + 1028: {region: 0xb6, script: 0x5a, flags: 0x0}, + 1029: {region: 0x165, script: 0x2c, flags: 0x0}, + 1030: {region: 0x165, script: 0x5a, flags: 0x0}, + 1032: {region: 0xba, script: 0xe8, flags: 0x0}, + 1033: {region: 0x165, script: 0x5a, flags: 0x0}, + 1034: {region: 0xc4, script: 0x75, flags: 0x0}, + 1035: {region: 0x165, script: 0x5, flags: 0x0}, + 1036: {region: 0xb3, script: 0xd4, flags: 0x0}, + 1037: {region: 0x6f, script: 0x5a, flags: 0x0}, + 1038: {region: 0x165, script: 0x5a, flags: 0x0}, + 1039: {region: 0x165, script: 0x5a, flags: 0x0}, + 1040: {region: 0x165, script: 0x5a, flags: 0x0}, + 1041: {region: 0x165, script: 0x5a, flags: 0x0}, + 1042: {region: 0x111, script: 0x5a, flags: 0x0}, + 1043: {region: 0x165, script: 0x5a, flags: 0x0}, + 1044: {region: 0xe8, script: 0x5, flags: 0x0}, + 1045: {region: 0x165, script: 0x5a, flags: 0x0}, + 1046: {region: 0x10f, script: 0x5a, flags: 0x0}, + 1047: {region: 0x165, script: 0x5a, flags: 0x0}, + 1048: {region: 0xe9, script: 0x5a, flags: 0x0}, + 1049: {region: 0x165, script: 0x5a, flags: 0x0}, + 1050: {region: 0x95, script: 0x5a, flags: 0x0}, + 1051: {region: 0x142, script: 0x5a, flags: 0x0}, + 1052: {region: 0x10c, script: 0x5a, flags: 0x0}, + 1054: {region: 0x10c, script: 0x5a, flags: 0x0}, + 1055: {region: 0x72, script: 0x5a, flags: 0x0}, + 1056: {region: 0x97, script: 0xca, flags: 0x0}, + 1057: {region: 0x165, script: 0x5a, flags: 0x0}, + 1058: {region: 0x72, script: 0x5a, flags: 0x0}, + 1059: {region: 0x164, script: 0x5a, flags: 0x0}, + 1060: {region: 0x165, script: 0x5a, flags: 0x0}, + 1061: {region: 0xc3, script: 0x5a, flags: 0x0}, + 1062: {region: 0x165, script: 0x5a, flags: 0x0}, + 1063: {region: 0x165, script: 0x5a, flags: 0x0}, + 1064: {region: 0x165, script: 0x5a, flags: 0x0}, + 1065: {region: 0x115, script: 0x5a, flags: 0x0}, + 1066: {region: 0x165, script: 0x5a, flags: 0x0}, + 1067: {region: 0x165, script: 0x5a, flags: 0x0}, + 1068: {region: 0x123, script: 0xeb, flags: 0x0}, + 1069: {region: 0x165, script: 0x5a, flags: 0x0}, + 1070: {region: 0x165, script: 0x5a, flags: 0x0}, + 1071: {region: 0x165, script: 0x5a, flags: 0x0}, + 1072: {region: 0x165, script: 0x5a, flags: 0x0}, + 1073: {region: 0x27, script: 0x5a, flags: 0x0}, + 1074: {region: 0x37, script: 0x5, flags: 0x1}, + 1075: {region: 0x99, script: 0xd7, flags: 0x0}, + 1076: {region: 0x116, script: 0x5a, flags: 0x0}, + 1077: {region: 0x114, script: 0x5a, flags: 0x0}, + 1078: {region: 0x99, script: 0x22, flags: 0x0}, + 1079: {region: 0x161, script: 0x5a, flags: 0x0}, + 1080: {region: 0x165, script: 0x5a, flags: 0x0}, + 1081: {region: 0x165, script: 0x5a, flags: 0x0}, + 1082: {region: 0x6d, script: 0x5a, flags: 0x0}, + 1083: {region: 0x161, script: 0x5a, flags: 0x0}, + 1084: {region: 0x165, script: 0x5a, flags: 0x0}, + 1085: {region: 0x60, script: 0x5a, flags: 0x0}, + 1086: {region: 0x95, script: 0x5a, flags: 0x0}, + 1087: {region: 0x165, script: 0x5a, flags: 0x0}, + 1088: {region: 0x165, script: 0x5a, flags: 0x0}, + 1089: {region: 0x12f, script: 0x5a, flags: 0x0}, + 1090: {region: 0x165, script: 0x5a, flags: 0x0}, + 1091: {region: 0x84, script: 0x5a, flags: 0x0}, + 1092: {region: 0x10c, script: 0x5a, flags: 0x0}, + 1093: {region: 0x12f, script: 0x5a, flags: 0x0}, + 1094: {region: 0x15f, script: 0x5, flags: 0x0}, + 1095: {region: 0x4b, script: 0x5a, flags: 0x0}, + 1096: {region: 0x60, script: 0x5a, flags: 0x0}, + 1097: {region: 0x165, script: 0x5a, flags: 0x0}, + 1098: {region: 0x99, script: 0x22, flags: 0x0}, + 1099: {region: 0x95, script: 0x5a, flags: 0x0}, + 1100: {region: 0x165, script: 0x5a, flags: 0x0}, + 1101: {region: 0x35, script: 0xe, flags: 0x0}, + 1102: {region: 0x9b, script: 0xdb, flags: 0x0}, + 1103: {region: 0xe9, script: 0x5a, flags: 0x0}, + 1104: {region: 0x99, script: 0xe3, flags: 0x0}, + 1105: {region: 0xdb, script: 0x22, flags: 0x0}, + 1106: {region: 0x165, script: 0x5a, flags: 0x0}, + 1107: {region: 0x165, script: 0x5a, flags: 0x0}, + 1108: {region: 0x165, script: 0x5a, flags: 0x0}, + 1109: {region: 0x165, script: 0x5a, flags: 0x0}, + 1110: {region: 0x165, script: 0x5a, flags: 0x0}, + 1111: {region: 0x165, script: 0x5a, flags: 0x0}, + 1112: {region: 0x165, script: 0x5a, flags: 0x0}, + 1113: {region: 0x165, script: 0x5a, flags: 0x0}, + 1114: {region: 0xe7, script: 0x5a, flags: 0x0}, + 1115: {region: 0x165, script: 0x5a, flags: 0x0}, + 1116: {region: 0x165, script: 0x5a, flags: 0x0}, + 1117: {region: 0x99, script: 0x52, flags: 0x0}, + 1118: {region: 0x53, script: 0xe1, flags: 0x0}, + 1119: {region: 0xdb, script: 0x22, flags: 0x0}, + 1120: {region: 0xdb, script: 0x22, flags: 0x0}, + 1121: {region: 0x99, script: 0xe6, flags: 0x0}, + 1122: {region: 0x165, script: 0x5a, flags: 0x0}, + 1123: {region: 0x112, script: 0x5a, flags: 0x0}, + 1124: {region: 0x131, script: 0x5a, flags: 0x0}, + 1125: {region: 0x126, script: 0x5a, flags: 0x0}, + 1126: {region: 0x165, script: 0x5a, flags: 0x0}, + 1127: {region: 0x3c, script: 0x3, flags: 0x1}, + 1128: {region: 0x165, script: 0x5a, flags: 0x0}, + 1129: {region: 0x165, script: 0x5a, flags: 0x0}, + 1130: {region: 0x165, script: 0x5a, flags: 0x0}, + 1131: {region: 0x123, script: 0xeb, flags: 0x0}, + 1132: {region: 0xdb, script: 0x22, flags: 0x0}, + 1133: {region: 0xdb, script: 0x22, flags: 0x0}, + 1134: {region: 0xdb, script: 0x22, flags: 0x0}, + 1135: {region: 0x6f, script: 0x2c, flags: 0x0}, + 1136: {region: 0x165, script: 0x5a, flags: 0x0}, + 1137: {region: 0x6d, script: 0x2c, flags: 0x0}, + 1138: {region: 0x165, script: 0x5a, flags: 0x0}, + 1139: {region: 0x165, script: 0x5a, flags: 0x0}, + 1140: {region: 0x165, script: 0x5a, flags: 0x0}, + 1141: {region: 0xd6, script: 0x5a, flags: 0x0}, + 1142: {region: 0x127, script: 0x5a, flags: 0x0}, + 1143: {region: 0x125, script: 0x5a, flags: 0x0}, + 1144: {region: 0x32, script: 0x5a, flags: 0x0}, + 1145: {region: 0xdb, script: 0x22, flags: 0x0}, + 1146: {region: 0xe7, script: 0x5a, flags: 0x0}, + 1147: {region: 0x165, script: 0x5a, flags: 0x0}, + 1148: {region: 0x165, script: 0x5a, flags: 0x0}, + 1149: {region: 0x32, script: 0x5a, flags: 0x0}, + 1150: {region: 0xd4, script: 0x5a, flags: 0x0}, + 1151: {region: 0x165, script: 0x5a, flags: 0x0}, + 1152: {region: 0x161, script: 0x5a, flags: 0x0}, + 1153: {region: 0x165, script: 0x5a, flags: 0x0}, + 1154: {region: 0x129, script: 0x5a, flags: 0x0}, + 1155: {region: 0x165, script: 0x5a, flags: 0x0}, + 1156: {region: 0xce, script: 0x5a, flags: 0x0}, + 1157: {region: 0x165, script: 0x5a, flags: 0x0}, + 1158: {region: 0xe6, script: 0x5a, flags: 0x0}, + 1159: {region: 0x165, script: 0x5a, flags: 0x0}, + 1160: {region: 0x165, script: 0x5a, flags: 0x0}, + 1161: {region: 0x165, script: 0x5a, flags: 0x0}, + 1162: {region: 0x12b, script: 0x5a, flags: 0x0}, + 1163: {region: 0x12b, script: 0x5a, flags: 0x0}, + 1164: {region: 0x12e, script: 0x5a, flags: 0x0}, + 1165: {region: 0x165, script: 0x5, flags: 0x0}, + 1166: {region: 0x161, script: 0x5a, flags: 0x0}, + 1167: {region: 0x87, script: 0x34, flags: 0x0}, + 1168: {region: 0xdb, script: 0x22, flags: 0x0}, + 1169: {region: 0xe7, script: 0x5a, flags: 0x0}, + 1170: {region: 0x43, script: 0xec, flags: 0x0}, + 1171: {region: 0x165, script: 0x5a, flags: 0x0}, + 1172: {region: 0x106, script: 0x20, flags: 0x0}, + 1173: {region: 0x165, script: 0x5a, flags: 0x0}, + 1174: {region: 0x165, script: 0x5a, flags: 0x0}, + 1175: {region: 0x131, script: 0x5a, flags: 0x0}, + 1176: {region: 0x165, script: 0x5a, flags: 0x0}, + 1177: {region: 0x123, script: 0xeb, flags: 0x0}, + 1178: {region: 0x32, script: 0x5a, flags: 0x0}, + 1179: {region: 0x165, script: 0x5a, flags: 0x0}, + 1180: {region: 0x165, script: 0x5a, flags: 0x0}, + 1181: {region: 0xce, script: 0x5a, flags: 0x0}, + 1182: {region: 0x165, script: 0x5a, flags: 0x0}, + 1183: {region: 0x165, script: 0x5a, flags: 0x0}, + 1184: {region: 0x12d, script: 0x5a, flags: 0x0}, + 1185: {region: 0x165, script: 0x5a, flags: 0x0}, + 1187: {region: 0x165, script: 0x5a, flags: 0x0}, + 1188: {region: 0xd4, script: 0x5a, flags: 0x0}, + 1189: {region: 0x53, script: 0xe4, flags: 0x0}, + 1190: {region: 0xe5, script: 0x5a, flags: 0x0}, + 1191: {region: 0x165, script: 0x5a, flags: 0x0}, + 1192: {region: 0x106, script: 0x20, flags: 0x0}, + 1193: {region: 0xba, script: 0x5a, flags: 0x0}, + 1194: {region: 0x165, script: 0x5a, flags: 0x0}, + 1195: {region: 0x106, script: 0x20, flags: 0x0}, + 1196: {region: 0x3f, script: 0x4, flags: 0x1}, + 1197: {region: 0x11c, script: 0xf0, flags: 0x0}, + 1198: {region: 0x130, script: 0x20, flags: 0x0}, + 1199: {region: 0x75, script: 0x5a, flags: 0x0}, + 1200: {region: 0x2a, script: 0x5a, flags: 0x0}, + 1202: {region: 0x43, script: 0x3, flags: 0x1}, + 1203: {region: 0x99, script: 0xe, flags: 0x0}, + 1204: {region: 0xe8, script: 0x5, flags: 0x0}, + 1205: {region: 0x165, script: 0x5a, flags: 0x0}, + 1206: {region: 0x165, script: 0x5a, flags: 0x0}, + 1207: {region: 0x165, script: 0x5a, flags: 0x0}, + 1208: {region: 0x165, script: 0x5a, flags: 0x0}, + 1209: {region: 0x165, script: 0x5a, flags: 0x0}, + 1210: {region: 0x165, script: 0x5a, flags: 0x0}, + 1211: {region: 0x165, script: 0x5a, flags: 0x0}, + 1212: {region: 0x46, script: 0x4, flags: 0x1}, + 1213: {region: 0x165, script: 0x5a, flags: 0x0}, + 1214: {region: 0xb4, script: 0xf1, flags: 0x0}, + 1215: {region: 0x165, script: 0x5a, flags: 0x0}, + 1216: {region: 0x161, script: 0x5a, flags: 0x0}, + 1217: {region: 0x9e, script: 0x5a, flags: 0x0}, + 1218: {region: 0x106, script: 0x5a, flags: 0x0}, + 1219: {region: 0x13e, script: 0x5a, flags: 0x0}, + 1220: {region: 0x11b, script: 0x5a, flags: 0x0}, + 1221: {region: 0x165, script: 0x5a, flags: 0x0}, + 1222: {region: 0x36, script: 0x5a, flags: 0x0}, + 1223: {region: 0x60, script: 0x5a, flags: 0x0}, + 1224: {region: 0xd1, script: 0x5a, flags: 0x0}, + 1225: {region: 0x1, script: 0x5a, flags: 0x0}, + 1226: {region: 0x106, script: 0x5a, flags: 0x0}, + 1227: {region: 0x6a, script: 0x5a, flags: 0x0}, + 1228: {region: 0x12f, script: 0x5a, flags: 0x0}, + 1229: {region: 0x165, script: 0x5a, flags: 0x0}, + 1230: {region: 0x36, script: 0x5a, flags: 0x0}, + 1231: {region: 0x4e, script: 0x5a, flags: 0x0}, + 1232: {region: 0x165, script: 0x5a, flags: 0x0}, + 1233: {region: 0x6f, script: 0x2c, flags: 0x0}, + 1234: {region: 0x165, script: 0x5a, flags: 0x0}, + 1235: {region: 0xe7, script: 0x5a, flags: 0x0}, + 1236: {region: 0x2f, script: 0x5a, flags: 0x0}, + 1237: {region: 0x99, script: 0xe6, flags: 0x0}, + 1238: {region: 0x99, script: 0x22, flags: 0x0}, + 1239: {region: 0x165, script: 0x5a, flags: 0x0}, + 1240: {region: 0x165, script: 0x5a, flags: 0x0}, + 1241: {region: 0x165, script: 0x5a, flags: 0x0}, + 1242: {region: 0x165, script: 0x5a, flags: 0x0}, + 1243: {region: 0x165, script: 0x5a, flags: 0x0}, + 1244: {region: 0x165, script: 0x5a, flags: 0x0}, + 1245: {region: 0x165, script: 0x5a, flags: 0x0}, + 1246: {region: 0x165, script: 0x5a, flags: 0x0}, + 1247: {region: 0x165, script: 0x5a, flags: 0x0}, + 1248: {region: 0x140, script: 0x5a, flags: 0x0}, + 1249: {region: 0x165, script: 0x5a, flags: 0x0}, + 1250: {region: 0x165, script: 0x5a, flags: 0x0}, + 1251: {region: 0xa8, script: 0x5, flags: 0x0}, + 1252: {region: 0x165, script: 0x5a, flags: 0x0}, + 1253: {region: 0x114, script: 0x5a, flags: 0x0}, + 1254: {region: 0x165, script: 0x5a, flags: 0x0}, + 1255: {region: 0x165, script: 0x5a, flags: 0x0}, + 1256: {region: 0x165, script: 0x5a, flags: 0x0}, + 1257: {region: 0x165, script: 0x5a, flags: 0x0}, + 1258: {region: 0x99, script: 0x22, flags: 0x0}, + 1259: {region: 0x53, script: 0x3b, flags: 0x0}, + 1260: {region: 0x165, script: 0x5a, flags: 0x0}, + 1261: {region: 0x165, script: 0x5a, flags: 0x0}, + 1262: {region: 0x41, script: 0x5a, flags: 0x0}, + 1263: {region: 0x165, script: 0x5a, flags: 0x0}, + 1264: {region: 0x12b, script: 0x18, flags: 0x0}, + 1265: {region: 0x165, script: 0x5a, flags: 0x0}, + 1266: {region: 0x161, script: 0x5a, flags: 0x0}, + 1267: {region: 0x165, script: 0x5a, flags: 0x0}, + 1268: {region: 0x12b, script: 0x62, flags: 0x0}, + 1269: {region: 0x12b, script: 0x63, flags: 0x0}, + 1270: {region: 0x7d, script: 0x2e, flags: 0x0}, + 1271: {region: 0x53, script: 0x67, flags: 0x0}, + 1272: {region: 0x10b, script: 0x6c, flags: 0x0}, + 1273: {region: 0x108, script: 0x77, flags: 0x0}, + 1274: {region: 0x99, script: 0x22, flags: 0x0}, + 1275: {region: 0x131, script: 0x5a, flags: 0x0}, + 1276: {region: 0x165, script: 0x5a, flags: 0x0}, + 1277: {region: 0x9c, script: 0x91, flags: 0x0}, + 1278: {region: 0x165, script: 0x5a, flags: 0x0}, + 1279: {region: 0x15e, script: 0xcc, flags: 0x0}, + 1280: {region: 0x165, script: 0x5a, flags: 0x0}, + 1281: {region: 0x165, script: 0x5a, flags: 0x0}, + 1282: {region: 0xdb, script: 0x22, flags: 0x0}, + 1283: {region: 0x165, script: 0x5a, flags: 0x0}, + 1284: {region: 0x165, script: 0x5a, flags: 0x0}, + 1285: {region: 0xd1, script: 0x5a, flags: 0x0}, + 1286: {region: 0x75, script: 0x5a, flags: 0x0}, + 1287: {region: 0x165, script: 0x5a, flags: 0x0}, + 1288: {region: 0x165, script: 0x5a, flags: 0x0}, + 1289: {region: 0x52, script: 0x5a, flags: 0x0}, + 1290: {region: 0x165, script: 0x5a, flags: 0x0}, + 1291: {region: 0x165, script: 0x5a, flags: 0x0}, + 1292: {region: 0x165, script: 0x5a, flags: 0x0}, + 1293: {region: 0x52, script: 0x5a, flags: 0x0}, + 1294: {region: 0x165, script: 0x5a, flags: 0x0}, + 1295: {region: 0x165, script: 0x5a, flags: 0x0}, + 1296: {region: 0x165, script: 0x5a, flags: 0x0}, + 1297: {region: 0x165, script: 0x5a, flags: 0x0}, + 1298: {region: 0x1, script: 0x3e, flags: 0x0}, + 1299: {region: 0x165, script: 0x5a, flags: 0x0}, + 1300: {region: 0x165, script: 0x5a, flags: 0x0}, + 1301: {region: 0x165, script: 0x5a, flags: 0x0}, + 1302: {region: 0x165, script: 0x5a, flags: 0x0}, + 1303: {region: 0x165, script: 0x5a, flags: 0x0}, + 1304: {region: 0xd6, script: 0x5a, flags: 0x0}, + 1305: {region: 0x165, script: 0x5a, flags: 0x0}, + 1306: {region: 0x165, script: 0x5a, flags: 0x0}, + 1307: {region: 0x165, script: 0x5a, flags: 0x0}, + 1308: {region: 0x41, script: 0x5a, flags: 0x0}, + 1309: {region: 0x165, script: 0x5a, flags: 0x0}, + 1310: {region: 0xcf, script: 0x5a, flags: 0x0}, + 1311: {region: 0x4a, script: 0x3, flags: 0x1}, + 1312: {region: 0x165, script: 0x5a, flags: 0x0}, + 1313: {region: 0x165, script: 0x5a, flags: 0x0}, + 1314: {region: 0x165, script: 0x5a, flags: 0x0}, + 1315: {region: 0x53, script: 0x5a, flags: 0x0}, + 1316: {region: 0x10b, script: 0x5a, flags: 0x0}, + 1318: {region: 0xa8, script: 0x5, flags: 0x0}, + 1319: {region: 0xd9, script: 0x5a, flags: 0x0}, + 1320: {region: 0xba, script: 0xe8, flags: 0x0}, + 1321: {region: 0x4d, script: 0x14, flags: 0x1}, + 1322: {region: 0x53, script: 0x7d, flags: 0x0}, + 1323: {region: 0x165, script: 0x5a, flags: 0x0}, + 1324: {region: 0x122, script: 0x5a, flags: 0x0}, + 1325: {region: 0xd0, script: 0x5a, flags: 0x0}, + 1326: {region: 0x165, script: 0x5a, flags: 0x0}, + 1327: {region: 0x161, script: 0x5a, flags: 0x0}, + 1329: {region: 0x12b, script: 0x5a, flags: 0x0}, +} + +// likelyLangList holds lists info associated with likelyLang. +// Size: 582 bytes, 97 elements +var likelyLangList = [97]likelyScriptRegion{ + 0: {region: 0x9c, script: 0x7, flags: 0x0}, + 1: {region: 0xa1, script: 0x78, flags: 0x2}, + 2: {region: 0x11c, script: 0x85, flags: 0x2}, + 3: {region: 0x32, script: 0x5a, flags: 0x0}, + 4: {region: 0x9b, script: 0x5, flags: 0x4}, + 5: {region: 0x9c, script: 0x5, flags: 0x4}, + 6: {region: 0x106, script: 0x20, flags: 0x4}, + 7: {region: 0x9c, script: 0x5, flags: 0x2}, + 8: {region: 0x106, script: 0x20, flags: 0x0}, + 9: {region: 0x38, script: 0x2f, flags: 0x2}, + 10: {region: 0x135, script: 0x5a, flags: 0x0}, + 11: {region: 0x7b, script: 0xcf, flags: 0x2}, + 12: {region: 0x114, script: 0x5a, flags: 0x0}, + 13: {region: 0x84, script: 0x1, flags: 0x2}, + 14: {region: 0x5d, script: 0x1f, flags: 0x0}, + 15: {region: 0x87, script: 0x5f, flags: 0x2}, + 16: {region: 0xd6, script: 0x5a, flags: 0x0}, + 17: {region: 0x52, script: 0x5, flags: 0x4}, + 18: {region: 0x10b, script: 0x5, flags: 0x4}, + 19: {region: 0xae, script: 0x20, flags: 0x0}, + 20: {region: 0x24, script: 0x5, flags: 0x4}, + 21: {region: 0x53, script: 0x5, flags: 0x4}, + 22: {region: 0x9c, script: 0x5, flags: 0x4}, + 23: {region: 0xc5, script: 0x5, flags: 0x4}, + 24: {region: 0x53, script: 0x5, flags: 0x2}, + 25: {region: 0x12b, script: 0x5a, flags: 0x0}, + 26: {region: 0xb0, script: 0x5, flags: 0x4}, + 27: {region: 0x9b, script: 0x5, flags: 0x2}, + 28: {region: 0xa5, script: 0x20, flags: 0x0}, + 29: {region: 0x53, script: 0x5, flags: 0x4}, + 30: {region: 0x12b, script: 0x5a, flags: 0x4}, + 31: {region: 0x53, script: 0x5, flags: 0x2}, + 32: {region: 0x12b, script: 0x5a, flags: 0x2}, + 33: {region: 0xdb, script: 0x22, flags: 0x0}, + 34: {region: 0x99, script: 0x5d, flags: 0x2}, + 35: {region: 0x83, script: 0x5a, flags: 0x0}, + 36: {region: 0x84, script: 0x7c, flags: 0x4}, + 37: {region: 0x84, script: 0x7c, flags: 0x2}, + 38: {region: 0xc5, script: 0x20, flags: 0x0}, + 39: {region: 0x53, script: 0x70, flags: 0x4}, + 40: {region: 0x53, script: 0x70, flags: 0x2}, + 41: {region: 0xd0, script: 0x5a, flags: 0x0}, + 42: {region: 0x4a, script: 0x5, flags: 0x4}, + 43: {region: 0x95, script: 0x5, flags: 0x4}, + 44: {region: 0x99, script: 0x36, flags: 0x0}, + 45: {region: 0xe8, script: 0x5, flags: 0x4}, + 46: {region: 0xe8, script: 0x5, flags: 0x2}, + 47: {region: 0x9c, script: 0x8b, flags: 0x0}, + 48: {region: 0x53, script: 0x8c, flags: 0x2}, + 49: {region: 0xba, script: 0xe8, flags: 0x0}, + 50: {region: 0xd9, script: 0x5a, flags: 0x4}, + 51: {region: 0xe8, script: 0x5, flags: 0x0}, + 52: {region: 0x99, script: 0x22, flags: 0x2}, + 53: {region: 0x99, script: 0x4f, flags: 0x2}, + 54: {region: 0x99, script: 0xd3, flags: 0x2}, + 55: {region: 0x105, script: 0x20, flags: 0x0}, + 56: {region: 0xbd, script: 0x5a, flags: 0x4}, + 57: {region: 0x104, script: 0x5a, flags: 0x4}, + 58: {region: 0x106, script: 0x5a, flags: 0x4}, + 59: {region: 0x12b, script: 0x5a, flags: 0x4}, + 60: {region: 0x124, script: 0x20, flags: 0x0}, + 61: {region: 0xe8, script: 0x5, flags: 0x4}, + 62: {region: 0xe8, script: 0x5, flags: 0x2}, + 63: {region: 0x53, script: 0x5, flags: 0x0}, + 64: {region: 0xae, script: 0x20, flags: 0x4}, + 65: {region: 0xc5, script: 0x20, flags: 0x4}, + 66: {region: 0xae, script: 0x20, flags: 0x2}, + 67: {region: 0x99, script: 0xe, flags: 0x0}, + 68: {region: 0xdb, script: 0x22, flags: 0x4}, + 69: {region: 0xdb, script: 0x22, flags: 0x2}, + 70: {region: 0x137, script: 0x5a, flags: 0x0}, + 71: {region: 0x24, script: 0x5, flags: 0x4}, + 72: {region: 0x53, script: 0x20, flags: 0x4}, + 73: {region: 0x24, script: 0x5, flags: 0x2}, + 74: {region: 0x8d, script: 0x3c, flags: 0x0}, + 75: {region: 0x53, script: 0x3b, flags: 0x4}, + 76: {region: 0x53, script: 0x3b, flags: 0x2}, + 77: {region: 0x53, script: 0x3b, flags: 0x0}, + 78: {region: 0x2f, script: 0x3c, flags: 0x4}, + 79: {region: 0x3e, script: 0x3c, flags: 0x4}, + 80: {region: 0x7b, script: 0x3c, flags: 0x4}, + 81: {region: 0x7e, script: 0x3c, flags: 0x4}, + 82: {region: 0x8d, script: 0x3c, flags: 0x4}, + 83: {region: 0x95, script: 0x3c, flags: 0x4}, + 84: {region: 0xc6, script: 0x3c, flags: 0x4}, + 85: {region: 0xd0, script: 0x3c, flags: 0x4}, + 86: {region: 0xe2, script: 0x3c, flags: 0x4}, + 87: {region: 0xe5, script: 0x3c, flags: 0x4}, + 88: {region: 0xe7, script: 0x3c, flags: 0x4}, + 89: {region: 0x116, script: 0x3c, flags: 0x4}, + 90: {region: 0x123, script: 0x3c, flags: 0x4}, + 91: {region: 0x12e, script: 0x3c, flags: 0x4}, + 92: {region: 0x135, script: 0x3c, flags: 0x4}, + 93: {region: 0x13e, script: 0x3c, flags: 0x4}, + 94: {region: 0x12e, script: 0x11, flags: 0x2}, + 95: {region: 0x12e, script: 0x37, flags: 0x2}, + 96: {region: 0x12e, script: 0x3c, flags: 0x2}, +} + +type likelyLangScript struct { + lang uint16 + script uint16 + flags uint8 +} + +// likelyRegion is a lookup table, indexed by regionID, for the most likely +// languages and scripts given incomplete information. If more entries exist +// for a given regionID, lang and script are the index and size respectively +// of the list in likelyRegionList. +// TODO: exclude containers and user-definable regions from the list. +// Size: 2148 bytes, 358 elements +var likelyRegion = [358]likelyLangScript{ + 34: {lang: 0xd7, script: 0x5a, flags: 0x0}, + 35: {lang: 0x3a, script: 0x5, flags: 0x0}, + 36: {lang: 0x0, script: 0x2, flags: 0x1}, + 39: {lang: 0x2, script: 0x2, flags: 0x1}, + 40: {lang: 0x4, script: 0x2, flags: 0x1}, + 42: {lang: 0x3c0, script: 0x5a, flags: 0x0}, + 43: {lang: 0x0, script: 0x5a, flags: 0x0}, + 44: {lang: 0x13e, script: 0x5a, flags: 0x0}, + 45: {lang: 0x41b, script: 0x5a, flags: 0x0}, + 46: {lang: 0x10d, script: 0x5a, flags: 0x0}, + 48: {lang: 0x367, script: 0x5a, flags: 0x0}, + 49: {lang: 0x444, script: 0x5a, flags: 0x0}, + 50: {lang: 0x58, script: 0x5a, flags: 0x0}, + 51: {lang: 0x6, script: 0x2, flags: 0x1}, + 53: {lang: 0xa5, script: 0xe, flags: 0x0}, + 54: {lang: 0x367, script: 0x5a, flags: 0x0}, + 55: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 56: {lang: 0x7e, script: 0x20, flags: 0x0}, + 57: {lang: 0x3a, script: 0x5, flags: 0x0}, + 58: {lang: 0x3d9, script: 0x5a, flags: 0x0}, + 59: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 60: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 62: {lang: 0x31f, script: 0x5a, flags: 0x0}, + 63: {lang: 0x13e, script: 0x5a, flags: 0x0}, + 64: {lang: 0x3a1, script: 0x5a, flags: 0x0}, + 65: {lang: 0x3c0, script: 0x5a, flags: 0x0}, + 67: {lang: 0x8, script: 0x2, flags: 0x1}, + 69: {lang: 0x0, script: 0x5a, flags: 0x0}, + 71: {lang: 0x71, script: 0x20, flags: 0x0}, + 73: {lang: 0x512, script: 0x3e, flags: 0x2}, + 74: {lang: 0x31f, script: 0x5, flags: 0x2}, + 75: {lang: 0x445, script: 0x5a, flags: 0x0}, + 76: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 77: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 78: {lang: 0x10d, script: 0x5a, flags: 0x0}, + 79: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 81: {lang: 0x13e, script: 0x5a, flags: 0x0}, + 82: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 83: {lang: 0xa, script: 0x4, flags: 0x1}, + 84: {lang: 0x13e, script: 0x5a, flags: 0x0}, + 85: {lang: 0x0, script: 0x5a, flags: 0x0}, + 86: {lang: 0x13e, script: 0x5a, flags: 0x0}, + 89: {lang: 0x13e, script: 0x5a, flags: 0x0}, + 90: {lang: 0x3c0, script: 0x5a, flags: 0x0}, + 91: {lang: 0x3a1, script: 0x5a, flags: 0x0}, + 93: {lang: 0xe, script: 0x2, flags: 0x1}, + 94: {lang: 0xfa, script: 0x5a, flags: 0x0}, + 96: {lang: 0x10d, script: 0x5a, flags: 0x0}, + 98: {lang: 0x1, script: 0x5a, flags: 0x0}, + 99: {lang: 0x101, script: 0x5a, flags: 0x0}, + 101: {lang: 0x13e, script: 0x5a, flags: 0x0}, + 103: {lang: 0x10, script: 0x2, flags: 0x1}, + 104: {lang: 0x13e, script: 0x5a, flags: 0x0}, + 105: {lang: 0x13e, script: 0x5a, flags: 0x0}, + 106: {lang: 0x140, script: 0x5a, flags: 0x0}, + 107: {lang: 0x3a, script: 0x5, flags: 0x0}, + 108: {lang: 0x3a, script: 0x5, flags: 0x0}, + 109: {lang: 0x46f, script: 0x2c, flags: 0x0}, + 110: {lang: 0x13e, script: 0x5a, flags: 0x0}, + 111: {lang: 0x12, script: 0x2, flags: 0x1}, + 113: {lang: 0x10d, script: 0x5a, flags: 0x0}, + 114: {lang: 0x151, script: 0x5a, flags: 0x0}, + 115: {lang: 0x1c0, script: 0x22, flags: 0x2}, + 118: {lang: 0x158, script: 0x5a, flags: 0x0}, + 120: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 122: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 123: {lang: 0x14, script: 0x2, flags: 0x1}, + 125: {lang: 0x16, script: 0x3, flags: 0x1}, + 126: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 128: {lang: 0x21, script: 0x5a, flags: 0x0}, + 130: {lang: 0x245, script: 0x5a, flags: 0x0}, + 132: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 133: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 134: {lang: 0x13e, script: 0x5a, flags: 0x0}, + 135: {lang: 0x19, script: 0x2, flags: 0x1}, + 136: {lang: 0x0, script: 0x5a, flags: 0x0}, + 137: {lang: 0x13e, script: 0x5a, flags: 0x0}, + 139: {lang: 0x3c0, script: 0x5a, flags: 0x0}, + 141: {lang: 0x529, script: 0x3c, flags: 0x0}, + 142: {lang: 0x0, script: 0x5a, flags: 0x0}, + 143: {lang: 0x13e, script: 0x5a, flags: 0x0}, + 144: {lang: 0x1d1, script: 0x5a, flags: 0x0}, + 145: {lang: 0x1d4, script: 0x5a, flags: 0x0}, + 146: {lang: 0x1d5, script: 0x5a, flags: 0x0}, + 148: {lang: 0x13e, script: 0x5a, flags: 0x0}, + 149: {lang: 0x1b, script: 0x2, flags: 0x1}, + 151: {lang: 0x1bc, script: 0x3e, flags: 0x0}, + 153: {lang: 0x1d, script: 0x3, flags: 0x1}, + 155: {lang: 0x3a, script: 0x5, flags: 0x0}, + 156: {lang: 0x20, script: 0x2, flags: 0x1}, + 157: {lang: 0x1f8, script: 0x5a, flags: 0x0}, + 158: {lang: 0x1f9, script: 0x5a, flags: 0x0}, + 161: {lang: 0x3a, script: 0x5, flags: 0x0}, + 162: {lang: 0x200, script: 0x49, flags: 0x0}, + 164: {lang: 0x445, script: 0x5a, flags: 0x0}, + 165: {lang: 0x28a, script: 0x20, flags: 0x0}, + 166: {lang: 0x22, script: 0x3, flags: 0x1}, + 168: {lang: 0x25, script: 0x2, flags: 0x1}, + 170: {lang: 0x254, script: 0x53, flags: 0x0}, + 171: {lang: 0x254, script: 0x53, flags: 0x0}, + 172: {lang: 0x3a, script: 0x5, flags: 0x0}, + 174: {lang: 0x3e2, script: 0x20, flags: 0x0}, + 175: {lang: 0x27, script: 0x2, flags: 0x1}, + 176: {lang: 0x3a, script: 0x5, flags: 0x0}, + 178: {lang: 0x10d, script: 0x5a, flags: 0x0}, + 179: {lang: 0x40c, script: 0xd4, flags: 0x0}, + 181: {lang: 0x43b, script: 0x5a, flags: 0x0}, + 182: {lang: 0x2c0, script: 0x5a, flags: 0x0}, + 183: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 184: {lang: 0x2c7, script: 0x5a, flags: 0x0}, + 185: {lang: 0x3a, script: 0x5, flags: 0x0}, + 186: {lang: 0x29, script: 0x2, flags: 0x1}, + 187: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 188: {lang: 0x2b, script: 0x2, flags: 0x1}, + 189: {lang: 0x432, script: 0x5a, flags: 0x0}, + 190: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 191: {lang: 0x2f1, script: 0x5a, flags: 0x0}, + 194: {lang: 0x2d, script: 0x2, flags: 0x1}, + 195: {lang: 0xa0, script: 0x5a, flags: 0x0}, + 196: {lang: 0x2f, script: 0x2, flags: 0x1}, + 197: {lang: 0x31, script: 0x2, flags: 0x1}, + 198: {lang: 0x33, script: 0x2, flags: 0x1}, + 200: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 201: {lang: 0x35, script: 0x2, flags: 0x1}, + 203: {lang: 0x320, script: 0x5a, flags: 0x0}, + 204: {lang: 0x37, script: 0x3, flags: 0x1}, + 205: {lang: 0x128, script: 0xea, flags: 0x0}, + 207: {lang: 0x13e, script: 0x5a, flags: 0x0}, + 208: {lang: 0x31f, script: 0x5a, flags: 0x0}, + 209: {lang: 0x3c0, script: 0x5a, flags: 0x0}, + 210: {lang: 0x16, script: 0x5a, flags: 0x0}, + 211: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 212: {lang: 0x1b4, script: 0x5a, flags: 0x0}, + 214: {lang: 0x1b4, script: 0x5, flags: 0x2}, + 216: {lang: 0x13e, script: 0x5a, flags: 0x0}, + 217: {lang: 0x367, script: 0x5a, flags: 0x0}, + 218: {lang: 0x347, script: 0x5a, flags: 0x0}, + 219: {lang: 0x351, script: 0x22, flags: 0x0}, + 225: {lang: 0x3a, script: 0x5, flags: 0x0}, + 226: {lang: 0x13e, script: 0x5a, flags: 0x0}, + 228: {lang: 0x13e, script: 0x5a, flags: 0x0}, + 229: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 230: {lang: 0x486, script: 0x5a, flags: 0x0}, + 231: {lang: 0x153, script: 0x5a, flags: 0x0}, + 232: {lang: 0x3a, script: 0x3, flags: 0x1}, + 233: {lang: 0x3b3, script: 0x5a, flags: 0x0}, + 234: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 236: {lang: 0x13e, script: 0x5a, flags: 0x0}, + 237: {lang: 0x3a, script: 0x5, flags: 0x0}, + 238: {lang: 0x3c0, script: 0x5a, flags: 0x0}, + 240: {lang: 0x3a2, script: 0x5a, flags: 0x0}, + 241: {lang: 0x194, script: 0x5a, flags: 0x0}, + 243: {lang: 0x3a, script: 0x5, flags: 0x0}, + 258: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 260: {lang: 0x3d, script: 0x2, flags: 0x1}, + 261: {lang: 0x432, script: 0x20, flags: 0x0}, + 262: {lang: 0x3f, script: 0x2, flags: 0x1}, + 263: {lang: 0x3e5, script: 0x5a, flags: 0x0}, + 264: {lang: 0x3a, script: 0x5, flags: 0x0}, + 266: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 267: {lang: 0x3a, script: 0x5, flags: 0x0}, + 268: {lang: 0x41, script: 0x2, flags: 0x1}, + 271: {lang: 0x416, script: 0x5a, flags: 0x0}, + 272: {lang: 0x347, script: 0x5a, flags: 0x0}, + 273: {lang: 0x43, script: 0x2, flags: 0x1}, + 275: {lang: 0x1f9, script: 0x5a, flags: 0x0}, + 276: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 277: {lang: 0x429, script: 0x5a, flags: 0x0}, + 278: {lang: 0x367, script: 0x5a, flags: 0x0}, + 280: {lang: 0x3c0, script: 0x5a, flags: 0x0}, + 282: {lang: 0x13e, script: 0x5a, flags: 0x0}, + 284: {lang: 0x45, script: 0x2, flags: 0x1}, + 288: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 289: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 290: {lang: 0x47, script: 0x2, flags: 0x1}, + 291: {lang: 0x49, script: 0x3, flags: 0x1}, + 292: {lang: 0x4c, script: 0x2, flags: 0x1}, + 293: {lang: 0x477, script: 0x5a, flags: 0x0}, + 294: {lang: 0x3c0, script: 0x5a, flags: 0x0}, + 295: {lang: 0x476, script: 0x5a, flags: 0x0}, + 296: {lang: 0x4e, script: 0x2, flags: 0x1}, + 297: {lang: 0x482, script: 0x5a, flags: 0x0}, + 299: {lang: 0x50, script: 0x4, flags: 0x1}, + 301: {lang: 0x4a0, script: 0x5a, flags: 0x0}, + 302: {lang: 0x54, script: 0x2, flags: 0x1}, + 303: {lang: 0x445, script: 0x5a, flags: 0x0}, + 304: {lang: 0x56, script: 0x3, flags: 0x1}, + 305: {lang: 0x445, script: 0x5a, flags: 0x0}, + 309: {lang: 0x512, script: 0x3e, flags: 0x2}, + 310: {lang: 0x13e, script: 0x5a, flags: 0x0}, + 311: {lang: 0x4bc, script: 0x5a, flags: 0x0}, + 312: {lang: 0x1f9, script: 0x5a, flags: 0x0}, + 315: {lang: 0x13e, script: 0x5a, flags: 0x0}, + 318: {lang: 0x4c3, script: 0x5a, flags: 0x0}, + 319: {lang: 0x8a, script: 0x5a, flags: 0x0}, + 320: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 322: {lang: 0x41b, script: 0x5a, flags: 0x0}, + 333: {lang: 0x59, script: 0x2, flags: 0x1}, + 350: {lang: 0x3a, script: 0x5, flags: 0x0}, + 351: {lang: 0x5b, script: 0x2, flags: 0x1}, + 356: {lang: 0x423, script: 0x5a, flags: 0x0}, +} + +// likelyRegionList holds lists info associated with likelyRegion. +// Size: 558 bytes, 93 elements +var likelyRegionList = [93]likelyLangScript{ + 0: {lang: 0x148, script: 0x5, flags: 0x0}, + 1: {lang: 0x476, script: 0x5a, flags: 0x0}, + 2: {lang: 0x431, script: 0x5a, flags: 0x0}, + 3: {lang: 0x2ff, script: 0x20, flags: 0x0}, + 4: {lang: 0x1d7, script: 0x8, flags: 0x0}, + 5: {lang: 0x274, script: 0x5a, flags: 0x0}, + 6: {lang: 0xb7, script: 0x5a, flags: 0x0}, + 7: {lang: 0x432, script: 0x20, flags: 0x0}, + 8: {lang: 0x12d, script: 0xec, flags: 0x0}, + 9: {lang: 0x351, script: 0x22, flags: 0x0}, + 10: {lang: 0x529, script: 0x3b, flags: 0x0}, + 11: {lang: 0x4ac, script: 0x5, flags: 0x0}, + 12: {lang: 0x523, script: 0x5a, flags: 0x0}, + 13: {lang: 0x29a, script: 0xeb, flags: 0x0}, + 14: {lang: 0x136, script: 0x34, flags: 0x0}, + 15: {lang: 0x48a, script: 0x5a, flags: 0x0}, + 16: {lang: 0x3a, script: 0x5, flags: 0x0}, + 17: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 18: {lang: 0x27, script: 0x2c, flags: 0x0}, + 19: {lang: 0x139, script: 0x5a, flags: 0x0}, + 20: {lang: 0x26a, script: 0x5, flags: 0x2}, + 21: {lang: 0x512, script: 0x3e, flags: 0x2}, + 22: {lang: 0x210, script: 0x2e, flags: 0x0}, + 23: {lang: 0x5, script: 0x20, flags: 0x0}, + 24: {lang: 0x274, script: 0x5a, flags: 0x0}, + 25: {lang: 0x136, script: 0x34, flags: 0x0}, + 26: {lang: 0x2ff, script: 0x20, flags: 0x0}, + 27: {lang: 0x1e1, script: 0x5a, flags: 0x0}, + 28: {lang: 0x31f, script: 0x5, flags: 0x0}, + 29: {lang: 0x1be, script: 0x22, flags: 0x0}, + 30: {lang: 0x4b4, script: 0x5, flags: 0x0}, + 31: {lang: 0x236, script: 0x75, flags: 0x0}, + 32: {lang: 0x148, script: 0x5, flags: 0x0}, + 33: {lang: 0x476, script: 0x5a, flags: 0x0}, + 34: {lang: 0x24a, script: 0x4e, flags: 0x0}, + 35: {lang: 0xe6, script: 0x5, flags: 0x0}, + 36: {lang: 0x226, script: 0xeb, flags: 0x0}, + 37: {lang: 0x3a, script: 0x5, flags: 0x0}, + 38: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 39: {lang: 0x2b8, script: 0x57, flags: 0x0}, + 40: {lang: 0x226, script: 0xeb, flags: 0x0}, + 41: {lang: 0x3a, script: 0x5, flags: 0x0}, + 42: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 43: {lang: 0x3dc, script: 0x5a, flags: 0x0}, + 44: {lang: 0x4ae, script: 0x20, flags: 0x0}, + 45: {lang: 0x2ff, script: 0x20, flags: 0x0}, + 46: {lang: 0x431, script: 0x5a, flags: 0x0}, + 47: {lang: 0x331, script: 0x75, flags: 0x0}, + 48: {lang: 0x213, script: 0x5a, flags: 0x0}, + 49: {lang: 0x30b, script: 0x20, flags: 0x0}, + 50: {lang: 0x242, script: 0x5, flags: 0x0}, + 51: {lang: 0x529, script: 0x3c, flags: 0x0}, + 52: {lang: 0x3c0, script: 0x5a, flags: 0x0}, + 53: {lang: 0x3a, script: 0x5, flags: 0x0}, + 54: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 55: {lang: 0x2ed, script: 0x5a, flags: 0x0}, + 56: {lang: 0x4b4, script: 0x5, flags: 0x0}, + 57: {lang: 0x88, script: 0x22, flags: 0x0}, + 58: {lang: 0x4b4, script: 0x5, flags: 0x0}, + 59: {lang: 0x4b4, script: 0x5, flags: 0x0}, + 60: {lang: 0xbe, script: 0x22, flags: 0x0}, + 61: {lang: 0x3dc, script: 0x5a, flags: 0x0}, + 62: {lang: 0x7e, script: 0x20, flags: 0x0}, + 63: {lang: 0x3e2, script: 0x20, flags: 0x0}, + 64: {lang: 0x267, script: 0x5a, flags: 0x0}, + 65: {lang: 0x444, script: 0x5a, flags: 0x0}, + 66: {lang: 0x512, script: 0x3e, flags: 0x0}, + 67: {lang: 0x412, script: 0x5a, flags: 0x0}, + 68: {lang: 0x4ae, script: 0x20, flags: 0x0}, + 69: {lang: 0x3a, script: 0x5, flags: 0x0}, + 70: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 71: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 72: {lang: 0x35, script: 0x5, flags: 0x0}, + 73: {lang: 0x46b, script: 0xeb, flags: 0x0}, + 74: {lang: 0x2ec, script: 0x5, flags: 0x0}, + 75: {lang: 0x30f, script: 0x75, flags: 0x0}, + 76: {lang: 0x467, script: 0x20, flags: 0x0}, + 77: {lang: 0x148, script: 0x5, flags: 0x0}, + 78: {lang: 0x3a, script: 0x5, flags: 0x0}, + 79: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 80: {lang: 0x48a, script: 0x5a, flags: 0x0}, + 81: {lang: 0x58, script: 0x5, flags: 0x0}, + 82: {lang: 0x219, script: 0x20, flags: 0x0}, + 83: {lang: 0x81, script: 0x34, flags: 0x0}, + 84: {lang: 0x529, script: 0x3c, flags: 0x0}, + 85: {lang: 0x48c, script: 0x5a, flags: 0x0}, + 86: {lang: 0x4ae, script: 0x20, flags: 0x0}, + 87: {lang: 0x512, script: 0x3e, flags: 0x0}, + 88: {lang: 0x3b3, script: 0x5a, flags: 0x0}, + 89: {lang: 0x431, script: 0x5a, flags: 0x0}, + 90: {lang: 0x432, script: 0x20, flags: 0x0}, + 91: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 92: {lang: 0x446, script: 0x5, flags: 0x0}, +} + +type likelyTag struct { + lang uint16 + region uint16 + script uint16 +} + +// Size: 198 bytes, 33 elements +var likelyRegionGroup = [33]likelyTag{ + 1: {lang: 0x139, region: 0xd6, script: 0x5a}, + 2: {lang: 0x139, region: 0x135, script: 0x5a}, + 3: {lang: 0x3c0, region: 0x41, script: 0x5a}, + 4: {lang: 0x139, region: 0x2f, script: 0x5a}, + 5: {lang: 0x139, region: 0xd6, script: 0x5a}, + 6: {lang: 0x13e, region: 0xcf, script: 0x5a}, + 7: {lang: 0x445, region: 0x12f, script: 0x5a}, + 8: {lang: 0x3a, region: 0x6b, script: 0x5}, + 9: {lang: 0x445, region: 0x4b, script: 0x5a}, + 10: {lang: 0x139, region: 0x161, script: 0x5a}, + 11: {lang: 0x139, region: 0x135, script: 0x5a}, + 12: {lang: 0x139, region: 0x135, script: 0x5a}, + 13: {lang: 0x13e, region: 0x59, script: 0x5a}, + 14: {lang: 0x529, region: 0x53, script: 0x3b}, + 15: {lang: 0x1be, region: 0x99, script: 0x22}, + 16: {lang: 0x1e1, region: 0x95, script: 0x5a}, + 17: {lang: 0x1f9, region: 0x9e, script: 0x5a}, + 18: {lang: 0x139, region: 0x2f, script: 0x5a}, + 19: {lang: 0x139, region: 0xe6, script: 0x5a}, + 20: {lang: 0x139, region: 0x8a, script: 0x5a}, + 21: {lang: 0x41b, region: 0x142, script: 0x5a}, + 22: {lang: 0x529, region: 0x53, script: 0x3b}, + 23: {lang: 0x4bc, region: 0x137, script: 0x5a}, + 24: {lang: 0x3a, region: 0x108, script: 0x5}, + 25: {lang: 0x3e2, region: 0x106, script: 0x20}, + 26: {lang: 0x3e2, region: 0x106, script: 0x20}, + 27: {lang: 0x139, region: 0x7b, script: 0x5a}, + 28: {lang: 0x10d, region: 0x60, script: 0x5a}, + 29: {lang: 0x139, region: 0xd6, script: 0x5a}, + 30: {lang: 0x13e, region: 0x1f, script: 0x5a}, + 31: {lang: 0x139, region: 0x9a, script: 0x5a}, + 32: {lang: 0x139, region: 0x7b, script: 0x5a}, +} + +// Size: 264 bytes, 33 elements +var regionContainment = [33]uint64{ + // Entry 0 - 1F + 0x00000001ffffffff, 0x00000000200007a2, 0x0000000000003044, 0x0000000000000008, + 0x00000000803c0010, 0x0000000000000020, 0x0000000000000040, 0x0000000000000080, + 0x0000000000000100, 0x0000000000000200, 0x0000000000000400, 0x000000004000384c, + 0x0000000000001000, 0x0000000000002000, 0x0000000000004000, 0x0000000000008000, + 0x0000000000010000, 0x0000000000020000, 0x0000000000040000, 0x0000000000080000, + 0x0000000000100000, 0x0000000000200000, 0x0000000001c1c000, 0x0000000000800000, + 0x0000000001000000, 0x000000001e020000, 0x0000000004000000, 0x0000000008000000, + 0x0000000010000000, 0x00000000200006a0, 0x0000000040002048, 0x0000000080000000, + // Entry 20 - 3F + 0x0000000100000000, +} + +// regionInclusion maps region identifiers to sets of regions in regionInclusionBits, +// where each set holds all groupings that are directly connected in a region +// containment graph. +// Size: 358 bytes, 358 elements +var regionInclusion = [358]uint8{ + // Entry 0 - 3F + 0x00, 0x00, 0x01, 0x02, 0x03, 0x04, 0x05, 0x06, + 0x07, 0x08, 0x09, 0x0a, 0x0b, 0x0c, 0x0d, 0x0e, + 0x0f, 0x10, 0x11, 0x12, 0x13, 0x14, 0x15, 0x16, + 0x17, 0x18, 0x19, 0x1a, 0x1b, 0x1c, 0x1d, 0x1e, + 0x21, 0x22, 0x23, 0x24, 0x25, 0x26, 0x26, 0x23, + 0x24, 0x26, 0x27, 0x22, 0x28, 0x29, 0x2a, 0x2b, + 0x26, 0x2c, 0x24, 0x23, 0x26, 0x25, 0x2a, 0x2d, + 0x2e, 0x24, 0x2f, 0x2d, 0x26, 0x30, 0x31, 0x28, + // Entry 40 - 7F + 0x26, 0x28, 0x26, 0x25, 0x31, 0x22, 0x32, 0x33, + 0x34, 0x30, 0x22, 0x27, 0x27, 0x27, 0x35, 0x2d, + 0x29, 0x28, 0x27, 0x36, 0x28, 0x22, 0x34, 0x23, + 0x21, 0x26, 0x2d, 0x26, 0x22, 0x37, 0x2e, 0x35, + 0x2a, 0x22, 0x2f, 0x38, 0x26, 0x26, 0x21, 0x39, + 0x39, 0x28, 0x38, 0x39, 0x39, 0x2f, 0x3a, 0x2f, + 0x20, 0x21, 0x38, 0x3b, 0x28, 0x3c, 0x2c, 0x21, + 0x2a, 0x35, 0x27, 0x38, 0x26, 0x24, 0x28, 0x2c, + // Entry 80 - BF + 0x2d, 0x23, 0x30, 0x2d, 0x2d, 0x26, 0x27, 0x3a, + 0x22, 0x34, 0x3c, 0x2d, 0x28, 0x36, 0x22, 0x34, + 0x3a, 0x26, 0x2e, 0x21, 0x39, 0x31, 0x38, 0x24, + 0x2c, 0x25, 0x22, 0x24, 0x25, 0x2c, 0x3a, 0x2c, + 0x26, 0x24, 0x36, 0x21, 0x2f, 0x3d, 0x31, 0x3c, + 0x2f, 0x26, 0x36, 0x36, 0x24, 0x26, 0x3d, 0x31, + 0x24, 0x26, 0x35, 0x25, 0x2d, 0x32, 0x38, 0x2a, + 0x38, 0x39, 0x39, 0x35, 0x33, 0x23, 0x26, 0x2f, + // Entry C0 - FF + 0x3c, 0x21, 0x23, 0x2d, 0x31, 0x36, 0x36, 0x3c, + 0x26, 0x2d, 0x26, 0x3a, 0x2f, 0x25, 0x2f, 0x34, + 0x31, 0x2f, 0x32, 0x3b, 0x2d, 0x2b, 0x2d, 0x21, + 0x34, 0x2a, 0x2c, 0x25, 0x21, 0x3c, 0x24, 0x29, + 0x2b, 0x24, 0x34, 0x21, 0x28, 0x29, 0x3b, 0x31, + 0x25, 0x2e, 0x30, 0x29, 0x26, 0x24, 0x3a, 0x21, + 0x3c, 0x28, 0x21, 0x24, 0x21, 0x21, 0x1f, 0x21, + 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, + // Entry 100 - 13F + 0x21, 0x21, 0x2f, 0x21, 0x2e, 0x23, 0x33, 0x2f, + 0x24, 0x3b, 0x2f, 0x39, 0x38, 0x31, 0x2d, 0x3a, + 0x2c, 0x2e, 0x2d, 0x23, 0x2d, 0x2f, 0x28, 0x2f, + 0x27, 0x33, 0x34, 0x26, 0x24, 0x32, 0x22, 0x26, + 0x27, 0x22, 0x2d, 0x31, 0x3d, 0x29, 0x31, 0x3d, + 0x39, 0x29, 0x31, 0x24, 0x26, 0x29, 0x36, 0x2f, + 0x33, 0x2f, 0x21, 0x22, 0x21, 0x30, 0x28, 0x3d, + 0x23, 0x26, 0x21, 0x28, 0x26, 0x26, 0x31, 0x3b, + // Entry 140 - 17F + 0x29, 0x21, 0x29, 0x21, 0x21, 0x21, 0x21, 0x21, + 0x21, 0x21, 0x21, 0x21, 0x21, 0x23, 0x21, 0x21, + 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, + 0x21, 0x21, 0x21, 0x21, 0x21, 0x24, 0x24, 0x2f, + 0x23, 0x32, 0x2f, 0x27, 0x2f, 0x21, +} + +// regionInclusionBits is an array of bit vectors where every vector represents +// a set of region groupings. These sets are used to compute the distance +// between two regions for the purpose of language matching. +// Size: 584 bytes, 73 elements +var regionInclusionBits = [73]uint64{ + // Entry 0 - 1F + 0x0000000102400813, 0x00000000200007a3, 0x0000000000003844, 0x0000000040000808, + 0x00000000803c0011, 0x0000000020000022, 0x0000000040000844, 0x0000000020000082, + 0x0000000000000102, 0x0000000020000202, 0x0000000020000402, 0x000000004000384d, + 0x0000000000001804, 0x0000000040002804, 0x0000000000404000, 0x0000000000408000, + 0x0000000000410000, 0x0000000002020000, 0x0000000000040010, 0x0000000000080010, + 0x0000000000100010, 0x0000000000200010, 0x0000000001c1c001, 0x0000000000c00000, + 0x0000000001400000, 0x000000001e020001, 0x0000000006000000, 0x000000000a000000, + 0x0000000012000000, 0x00000000200006a2, 0x0000000040002848, 0x0000000080000010, + // Entry 20 - 3F + 0x0000000100000001, 0x0000000000000001, 0x0000000080000000, 0x0000000000020000, + 0x0000000001000000, 0x0000000000008000, 0x0000000000002000, 0x0000000000000200, + 0x0000000000000008, 0x0000000000200000, 0x0000000110000000, 0x0000000000040000, + 0x0000000008000000, 0x0000000000000020, 0x0000000104000000, 0x0000000000000080, + 0x0000000000001000, 0x0000000000010000, 0x0000000000000400, 0x0000000004000000, + 0x0000000000000040, 0x0000000010000000, 0x0000000000004000, 0x0000000101000000, + 0x0000000108000000, 0x0000000000000100, 0x0000000100020000, 0x0000000000080000, + 0x0000000000100000, 0x0000000000800000, 0x00000001ffffffff, 0x0000000122400fb3, + // Entry 40 - 5F + 0x00000001827c0813, 0x000000014240385f, 0x0000000103c1c813, 0x000000011e420813, + 0x0000000112000001, 0x0000000106000001, 0x0000000101400001, 0x000000010a000001, + 0x0000000102020001, +} + +// regionInclusionNext marks, for each entry in regionInclusionBits, the set of +// all groups that are reachable from the groups set in the respective entry. +// Size: 73 bytes, 73 elements +var regionInclusionNext = [73]uint8{ + // Entry 0 - 3F + 0x3e, 0x3f, 0x0b, 0x0b, 0x40, 0x01, 0x0b, 0x01, + 0x01, 0x01, 0x01, 0x41, 0x0b, 0x0b, 0x16, 0x16, + 0x16, 0x19, 0x04, 0x04, 0x04, 0x04, 0x42, 0x16, + 0x16, 0x43, 0x19, 0x19, 0x19, 0x01, 0x0b, 0x04, + 0x00, 0x00, 0x1f, 0x11, 0x18, 0x0f, 0x0d, 0x09, + 0x03, 0x15, 0x44, 0x12, 0x1b, 0x05, 0x45, 0x07, + 0x0c, 0x10, 0x0a, 0x1a, 0x06, 0x1c, 0x0e, 0x46, + 0x47, 0x08, 0x48, 0x13, 0x14, 0x17, 0x3e, 0x3e, + // Entry 40 - 7F + 0x3e, 0x3e, 0x3e, 0x3e, 0x43, 0x43, 0x42, 0x43, + 0x43, +} + +type parentRel struct { + lang uint16 + script uint16 + maxScript uint16 + toRegion uint16 + fromRegion []uint16 +} + +// Size: 414 bytes, 5 elements +var parents = [5]parentRel{ + 0: {lang: 0x139, script: 0x0, maxScript: 0x5a, toRegion: 0x1, fromRegion: []uint16{0x1a, 0x25, 0x26, 0x2f, 0x34, 0x36, 0x3d, 0x42, 0x46, 0x48, 0x49, 0x4a, 0x50, 0x52, 0x5c, 0x5d, 0x61, 0x64, 0x6d, 0x73, 0x74, 0x75, 0x7b, 0x7c, 0x7f, 0x80, 0x81, 0x83, 0x8c, 0x8d, 0x96, 0x97, 0x98, 0x99, 0x9a, 0x9f, 0xa0, 0xa4, 0xa7, 0xa9, 0xad, 0xb1, 0xb4, 0xb5, 0xbf, 0xc6, 0xca, 0xcb, 0xcc, 0xce, 0xd0, 0xd2, 0xd5, 0xd6, 0xdd, 0xdf, 0xe0, 0xe6, 0xe7, 0xe8, 0xeb, 0xf0, 0x107, 0x109, 0x10a, 0x10b, 0x10d, 0x10e, 0x112, 0x117, 0x11b, 0x11d, 0x11f, 0x125, 0x129, 0x12c, 0x12d, 0x12f, 0x131, 0x139, 0x13c, 0x13f, 0x142, 0x161, 0x162, 0x164}}, + 1: {lang: 0x139, script: 0x0, maxScript: 0x5a, toRegion: 0x1a, fromRegion: []uint16{0x2e, 0x4e, 0x60, 0x63, 0x72, 0xd9, 0x10c, 0x10f}}, + 2: {lang: 0x13e, script: 0x0, maxScript: 0x5a, toRegion: 0x1f, fromRegion: []uint16{0x2c, 0x3f, 0x41, 0x48, 0x51, 0x54, 0x56, 0x59, 0x65, 0x69, 0x89, 0x8f, 0xcf, 0xd8, 0xe2, 0xe4, 0xec, 0xf1, 0x11a, 0x135, 0x136, 0x13b}}, + 3: {lang: 0x3c0, script: 0x0, maxScript: 0x5a, toRegion: 0xee, fromRegion: []uint16{0x2a, 0x4e, 0x5a, 0x86, 0x8b, 0xb7, 0xc6, 0xd1, 0x118, 0x126}}, + 4: {lang: 0x529, script: 0x3c, maxScript: 0x3c, toRegion: 0x8d, fromRegion: []uint16{0xc6}}, +} + +// Total table size 30244 bytes (29KiB); checksum: B6B15F30 diff --git a/vendor/golang.org/x/text/internal/language/tags.go b/vendor/golang.org/x/text/internal/language/tags.go new file mode 100644 index 00000000..e7afd318 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/tags.go @@ -0,0 +1,48 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +// MustParse is like Parse, but panics if the given BCP 47 tag cannot be parsed. +// It simplifies safe initialization of Tag values. +func MustParse(s string) Tag { + t, err := Parse(s) + if err != nil { + panic(err) + } + return t +} + +// MustParseBase is like ParseBase, but panics if the given base cannot be parsed. +// It simplifies safe initialization of Base values. +func MustParseBase(s string) Language { + b, err := ParseBase(s) + if err != nil { + panic(err) + } + return b +} + +// MustParseScript is like ParseScript, but panics if the given script cannot be +// parsed. It simplifies safe initialization of Script values. +func MustParseScript(s string) Script { + scr, err := ParseScript(s) + if err != nil { + panic(err) + } + return scr +} + +// MustParseRegion is like ParseRegion, but panics if the given region cannot be +// parsed. It simplifies safe initialization of Region values. +func MustParseRegion(s string) Region { + r, err := ParseRegion(s) + if err != nil { + panic(err) + } + return r +} + +// Und is the root language. +var Und Tag diff --git a/vendor/golang.org/x/text/internal/match.go b/vendor/golang.org/x/text/internal/match.go new file mode 100644 index 00000000..1cc004a6 --- /dev/null +++ b/vendor/golang.org/x/text/internal/match.go @@ -0,0 +1,67 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package internal + +// This file contains matchers that implement CLDR inheritance. +// +// See https://unicode.org/reports/tr35/#Locale_Inheritance. +// +// Some of the inheritance described in this document is already handled by +// the cldr package. + +import ( + "golang.org/x/text/language" +) + +// TODO: consider if (some of the) matching algorithm needs to be public after +// getting some feel about what is generic and what is specific. + +// NewInheritanceMatcher returns a matcher that matches based on the inheritance +// chain. +// +// The matcher uses canonicalization and the parent relationship to find a +// match. The resulting match will always be either Und or a language with the +// same language and script as the requested language. It will not match +// languages for which there is understood to be mutual or one-directional +// intelligibility. +// +// A Match will indicate an Exact match if the language matches after +// canonicalization and High if the matched tag is a parent. +func NewInheritanceMatcher(t []language.Tag) *InheritanceMatcher { + tags := &InheritanceMatcher{make(map[language.Tag]int)} + for i, tag := range t { + ct, err := language.All.Canonicalize(tag) + if err != nil { + ct = tag + } + tags.index[ct] = i + } + return tags +} + +type InheritanceMatcher struct { + index map[language.Tag]int +} + +func (m InheritanceMatcher) Match(want ...language.Tag) (language.Tag, int, language.Confidence) { + for _, t := range want { + ct, err := language.All.Canonicalize(t) + if err != nil { + ct = t + } + conf := language.Exact + for { + if index, ok := m.index[ct]; ok { + return ct, index, conf + } + if ct == language.Und { + break + } + ct = ct.Parent() + conf = language.High + } + } + return language.Und, 0, language.No +} diff --git a/vendor/golang.org/x/text/internal/tag/tag.go b/vendor/golang.org/x/text/internal/tag/tag.go new file mode 100644 index 00000000..b5d34889 --- /dev/null +++ b/vendor/golang.org/x/text/internal/tag/tag.go @@ -0,0 +1,100 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Package tag contains functionality handling tags and related data. +package tag // import "golang.org/x/text/internal/tag" + +import "sort" + +// An Index converts tags to a compact numeric value. +// +// All elements are of size 4. Tags may be up to 4 bytes long. Excess bytes can +// be used to store additional information about the tag. +type Index string + +// Elem returns the element data at the given index. +func (s Index) Elem(x int) string { + return string(s[x*4 : x*4+4]) +} + +// Index reports the index of the given key or -1 if it could not be found. +// Only the first len(key) bytes from the start of the 4-byte entries will be +// considered for the search and the first match in Index will be returned. +func (s Index) Index(key []byte) int { + n := len(key) + // search the index of the first entry with an equal or higher value than + // key in s. + index := sort.Search(len(s)/4, func(i int) bool { + return cmp(s[i*4:i*4+n], key) != -1 + }) + i := index * 4 + if cmp(s[i:i+len(key)], key) != 0 { + return -1 + } + return index +} + +// Next finds the next occurrence of key after index x, which must have been +// obtained from a call to Index using the same key. It returns x+1 or -1. +func (s Index) Next(key []byte, x int) int { + if x++; x*4 < len(s) && cmp(s[x*4:x*4+len(key)], key) == 0 { + return x + } + return -1 +} + +// cmp returns an integer comparing a and b lexicographically. +func cmp(a Index, b []byte) int { + n := len(a) + if len(b) < n { + n = len(b) + } + for i, c := range b[:n] { + switch { + case a[i] > c: + return 1 + case a[i] < c: + return -1 + } + } + switch { + case len(a) < len(b): + return -1 + case len(a) > len(b): + return 1 + } + return 0 +} + +// Compare returns an integer comparing a and b lexicographically. +func Compare(a string, b []byte) int { + return cmp(Index(a), b) +} + +// FixCase reformats b to the same pattern of cases as form. +// If returns false if string b is malformed. +func FixCase(form string, b []byte) bool { + if len(form) != len(b) { + return false + } + for i, c := range b { + if form[i] <= 'Z' { + if c >= 'a' { + c -= 'z' - 'Z' + } + if c < 'A' || 'Z' < c { + return false + } + } else { + if c <= 'Z' { + c += 'z' - 'Z' + } + if c < 'a' || 'z' < c { + return false + } + } + b[i] = c + } + return true +} diff --git a/vendor/golang.org/x/text/language/coverage.go b/vendor/golang.org/x/text/language/coverage.go new file mode 100644 index 00000000..a24fd1a4 --- /dev/null +++ b/vendor/golang.org/x/text/language/coverage.go @@ -0,0 +1,187 @@ +// Copyright 2014 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import ( + "fmt" + "sort" + + "golang.org/x/text/internal/language" +) + +// The Coverage interface is used to define the level of coverage of an +// internationalization service. Note that not all types are supported by all +// services. As lists may be generated on the fly, it is recommended that users +// of a Coverage cache the results. +type Coverage interface { + // Tags returns the list of supported tags. + Tags() []Tag + + // BaseLanguages returns the list of supported base languages. + BaseLanguages() []Base + + // Scripts returns the list of supported scripts. + Scripts() []Script + + // Regions returns the list of supported regions. + Regions() []Region +} + +var ( + // Supported defines a Coverage that lists all supported subtags. Tags + // always returns nil. + Supported Coverage = allSubtags{} +) + +// TODO: +// - Support Variants, numbering systems. +// - CLDR coverage levels. +// - Set of common tags defined in this package. + +type allSubtags struct{} + +// Regions returns the list of supported regions. As all regions are in a +// consecutive range, it simply returns a slice of numbers in increasing order. +// The "undefined" region is not returned. +func (s allSubtags) Regions() []Region { + reg := make([]Region, language.NumRegions) + for i := range reg { + reg[i] = Region{language.Region(i + 1)} + } + return reg +} + +// Scripts returns the list of supported scripts. As all scripts are in a +// consecutive range, it simply returns a slice of numbers in increasing order. +// The "undefined" script is not returned. +func (s allSubtags) Scripts() []Script { + scr := make([]Script, language.NumScripts) + for i := range scr { + scr[i] = Script{language.Script(i + 1)} + } + return scr +} + +// BaseLanguages returns the list of all supported base languages. It generates +// the list by traversing the internal structures. +func (s allSubtags) BaseLanguages() []Base { + bs := language.BaseLanguages() + base := make([]Base, len(bs)) + for i, b := range bs { + base[i] = Base{b} + } + return base +} + +// Tags always returns nil. +func (s allSubtags) Tags() []Tag { + return nil +} + +// coverage is used by NewCoverage which is used as a convenient way for +// creating Coverage implementations for partially defined data. Very often a +// package will only need to define a subset of slices. coverage provides a +// convenient way to do this. Moreover, packages using NewCoverage, instead of +// their own implementation, will not break if later new slice types are added. +type coverage struct { + tags func() []Tag + bases func() []Base + scripts func() []Script + regions func() []Region +} + +func (s *coverage) Tags() []Tag { + if s.tags == nil { + return nil + } + return s.tags() +} + +// bases implements sort.Interface and is used to sort base languages. +type bases []Base + +func (b bases) Len() int { + return len(b) +} + +func (b bases) Swap(i, j int) { + b[i], b[j] = b[j], b[i] +} + +func (b bases) Less(i, j int) bool { + return b[i].langID < b[j].langID +} + +// BaseLanguages returns the result from calling s.bases if it is specified or +// otherwise derives the set of supported base languages from tags. +func (s *coverage) BaseLanguages() []Base { + if s.bases == nil { + tags := s.Tags() + if len(tags) == 0 { + return nil + } + a := make([]Base, len(tags)) + for i, t := range tags { + a[i] = Base{language.Language(t.lang())} + } + sort.Sort(bases(a)) + k := 0 + for i := 1; i < len(a); i++ { + if a[k] != a[i] { + k++ + a[k] = a[i] + } + } + return a[:k+1] + } + return s.bases() +} + +func (s *coverage) Scripts() []Script { + if s.scripts == nil { + return nil + } + return s.scripts() +} + +func (s *coverage) Regions() []Region { + if s.regions == nil { + return nil + } + return s.regions() +} + +// NewCoverage returns a Coverage for the given lists. It is typically used by +// packages providing internationalization services to define their level of +// coverage. A list may be of type []T or func() []T, where T is either Tag, +// Base, Script or Region. The returned Coverage derives the value for Bases +// from Tags if no func or slice for []Base is specified. For other unspecified +// types the returned Coverage will return nil for the respective methods. +func NewCoverage(list ...interface{}) Coverage { + s := &coverage{} + for _, x := range list { + switch v := x.(type) { + case func() []Base: + s.bases = v + case func() []Script: + s.scripts = v + case func() []Region: + s.regions = v + case func() []Tag: + s.tags = v + case []Base: + s.bases = func() []Base { return v } + case []Script: + s.scripts = func() []Script { return v } + case []Region: + s.regions = func() []Region { return v } + case []Tag: + s.tags = func() []Tag { return v } + default: + panic(fmt.Sprintf("language: unsupported set type %T", v)) + } + } + return s +} diff --git a/vendor/golang.org/x/text/language/doc.go b/vendor/golang.org/x/text/language/doc.go new file mode 100644 index 00000000..212b77c9 --- /dev/null +++ b/vendor/golang.org/x/text/language/doc.go @@ -0,0 +1,98 @@ +// Copyright 2017 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Package language implements BCP 47 language tags and related functionality. +// +// The most important function of package language is to match a list of +// user-preferred languages to a list of supported languages. +// It alleviates the developer of dealing with the complexity of this process +// and provides the user with the best experience +// (see https://blog.golang.org/matchlang). +// +// # Matching preferred against supported languages +// +// A Matcher for an application that supports English, Australian English, +// Danish, and standard Mandarin can be created as follows: +// +// var matcher = language.NewMatcher([]language.Tag{ +// language.English, // The first language is used as fallback. +// language.MustParse("en-AU"), +// language.Danish, +// language.Chinese, +// }) +// +// This list of supported languages is typically implied by the languages for +// which there exists translations of the user interface. +// +// User-preferred languages usually come as a comma-separated list of BCP 47 +// language tags. +// The MatchString finds best matches for such strings: +// +// handler(w http.ResponseWriter, r *http.Request) { +// lang, _ := r.Cookie("lang") +// accept := r.Header.Get("Accept-Language") +// tag, _ := language.MatchStrings(matcher, lang.String(), accept) +// +// // tag should now be used for the initialization of any +// // locale-specific service. +// } +// +// The Matcher's Match method can be used to match Tags directly. +// +// Matchers are aware of the intricacies of equivalence between languages, such +// as deprecated subtags, legacy tags, macro languages, mutual +// intelligibility between scripts and languages, and transparently passing +// BCP 47 user configuration. +// For instance, it will know that a reader of Bokmål Danish can read Norwegian +// and will know that Cantonese ("yue") is a good match for "zh-HK". +// +// # Using match results +// +// To guarantee a consistent user experience to the user it is important to +// use the same language tag for the selection of any locale-specific services. +// For example, it is utterly confusing to substitute spelled-out numbers +// or dates in one language in text of another language. +// More subtly confusing is using the wrong sorting order or casing +// algorithm for a certain language. +// +// All the packages in x/text that provide locale-specific services +// (e.g. collate, cases) should be initialized with the tag that was +// obtained at the start of an interaction with the user. +// +// Note that Tag that is returned by Match and MatchString may differ from any +// of the supported languages, as it may contain carried over settings from +// the user tags. +// This may be inconvenient when your application has some additional +// locale-specific data for your supported languages. +// Match and MatchString both return the index of the matched supported tag +// to simplify associating such data with the matched tag. +// +// # Canonicalization +// +// If one uses the Matcher to compare languages one does not need to +// worry about canonicalization. +// +// The meaning of a Tag varies per application. The language package +// therefore delays canonicalization and preserves information as much +// as possible. The Matcher, however, will always take into account that +// two different tags may represent the same language. +// +// By default, only legacy and deprecated tags are converted into their +// canonical equivalent. All other information is preserved. This approach makes +// the confidence scores more accurate and allows matchers to distinguish +// between variants that are otherwise lost. +// +// As a consequence, two tags that should be treated as identical according to +// BCP 47 or CLDR, like "en-Latn" and "en", will be represented differently. The +// Matcher handles such distinctions, though, and is aware of the +// equivalence relations. The CanonType type can be used to alter the +// canonicalization form. +// +// # References +// +// BCP 47 - Tags for Identifying Languages http://tools.ietf.org/html/bcp47 +package language // import "golang.org/x/text/language" + +// TODO: explanation on how to match languages for your own locale-specific +// service. diff --git a/vendor/golang.org/x/text/language/language.go b/vendor/golang.org/x/text/language/language.go new file mode 100644 index 00000000..289b3a36 --- /dev/null +++ b/vendor/golang.org/x/text/language/language.go @@ -0,0 +1,605 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:generate go run gen.go -output tables.go + +package language + +// TODO: Remove above NOTE after: +// - verifying that tables are dropped correctly (most notably matcher tables). + +import ( + "strings" + + "golang.org/x/text/internal/language" + "golang.org/x/text/internal/language/compact" +) + +// Tag represents a BCP 47 language tag. It is used to specify an instance of a +// specific language or locale. All language tag values are guaranteed to be +// well-formed. +type Tag compact.Tag + +func makeTag(t language.Tag) (tag Tag) { + return Tag(compact.Make(t)) +} + +func (t *Tag) tag() language.Tag { + return (*compact.Tag)(t).Tag() +} + +func (t *Tag) isCompact() bool { + return (*compact.Tag)(t).IsCompact() +} + +// TODO: improve performance. +func (t *Tag) lang() language.Language { return t.tag().LangID } +func (t *Tag) region() language.Region { return t.tag().RegionID } +func (t *Tag) script() language.Script { return t.tag().ScriptID } + +// Make is a convenience wrapper for Parse that omits the error. +// In case of an error, a sensible default is returned. +func Make(s string) Tag { + return Default.Make(s) +} + +// Make is a convenience wrapper for c.Parse that omits the error. +// In case of an error, a sensible default is returned. +func (c CanonType) Make(s string) Tag { + t, _ := c.Parse(s) + return t +} + +// Raw returns the raw base language, script and region, without making an +// attempt to infer their values. +func (t Tag) Raw() (b Base, s Script, r Region) { + tt := t.tag() + return Base{tt.LangID}, Script{tt.ScriptID}, Region{tt.RegionID} +} + +// IsRoot returns true if t is equal to language "und". +func (t Tag) IsRoot() bool { + return compact.Tag(t).IsRoot() +} + +// CanonType can be used to enable or disable various types of canonicalization. +type CanonType int + +const ( + // Replace deprecated base languages with their preferred replacements. + DeprecatedBase CanonType = 1 << iota + // Replace deprecated scripts with their preferred replacements. + DeprecatedScript + // Replace deprecated regions with their preferred replacements. + DeprecatedRegion + // Remove redundant scripts. + SuppressScript + // Normalize legacy encodings. This includes legacy languages defined in + // CLDR as well as bibliographic codes defined in ISO-639. + Legacy + // Map the dominant language of a macro language group to the macro language + // subtag. For example cmn -> zh. + Macro + // The CLDR flag should be used if full compatibility with CLDR is required. + // There are a few cases where language.Tag may differ from CLDR. To follow all + // of CLDR's suggestions, use All|CLDR. + CLDR + + // Raw can be used to Compose or Parse without Canonicalization. + Raw CanonType = 0 + + // Replace all deprecated tags with their preferred replacements. + Deprecated = DeprecatedBase | DeprecatedScript | DeprecatedRegion + + // All canonicalizations recommended by BCP 47. + BCP47 = Deprecated | SuppressScript + + // All canonicalizations. + All = BCP47 | Legacy | Macro + + // Default is the canonicalization used by Parse, Make and Compose. To + // preserve as much information as possible, canonicalizations that remove + // potentially valuable information are not included. The Matcher is + // designed to recognize similar tags that would be the same if + // they were canonicalized using All. + Default = Deprecated | Legacy + + canonLang = DeprecatedBase | Legacy | Macro + + // TODO: LikelyScript, LikelyRegion: suppress similar to ICU. +) + +// canonicalize returns the canonicalized equivalent of the tag and +// whether there was any change. +func canonicalize(c CanonType, t language.Tag) (language.Tag, bool) { + if c == Raw { + return t, false + } + changed := false + if c&SuppressScript != 0 { + if t.LangID.SuppressScript() == t.ScriptID { + t.ScriptID = 0 + changed = true + } + } + if c&canonLang != 0 { + for { + if l, aliasType := t.LangID.Canonicalize(); l != t.LangID { + switch aliasType { + case language.Legacy: + if c&Legacy != 0 { + if t.LangID == _sh && t.ScriptID == 0 { + t.ScriptID = _Latn + } + t.LangID = l + changed = true + } + case language.Macro: + if c&Macro != 0 { + // We deviate here from CLDR. The mapping "nb" -> "no" + // qualifies as a typical Macro language mapping. However, + // for legacy reasons, CLDR maps "no", the macro language + // code for Norwegian, to the dominant variant "nb". This + // change is currently under consideration for CLDR as well. + // See https://unicode.org/cldr/trac/ticket/2698 and also + // https://unicode.org/cldr/trac/ticket/1790 for some of the + // practical implications. TODO: this check could be removed + // if CLDR adopts this change. + if c&CLDR == 0 || t.LangID != _nb { + changed = true + t.LangID = l + } + } + case language.Deprecated: + if c&DeprecatedBase != 0 { + if t.LangID == _mo && t.RegionID == 0 { + t.RegionID = _MD + } + t.LangID = l + changed = true + // Other canonicalization types may still apply. + continue + } + } + } else if c&Legacy != 0 && t.LangID == _no && c&CLDR != 0 { + t.LangID = _nb + changed = true + } + break + } + } + if c&DeprecatedScript != 0 { + if t.ScriptID == _Qaai { + changed = true + t.ScriptID = _Zinh + } + } + if c&DeprecatedRegion != 0 { + if r := t.RegionID.Canonicalize(); r != t.RegionID { + changed = true + t.RegionID = r + } + } + return t, changed +} + +// Canonicalize returns the canonicalized equivalent of the tag. +func (c CanonType) Canonicalize(t Tag) (Tag, error) { + // First try fast path. + if t.isCompact() { + if _, changed := canonicalize(c, compact.Tag(t).Tag()); !changed { + return t, nil + } + } + // It is unlikely that one will canonicalize a tag after matching. So do + // a slow but simple approach here. + if tag, changed := canonicalize(c, t.tag()); changed { + tag.RemakeString() + return makeTag(tag), nil + } + return t, nil + +} + +// Confidence indicates the level of certainty for a given return value. +// For example, Serbian may be written in Cyrillic or Latin script. +// The confidence level indicates whether a value was explicitly specified, +// whether it is typically the only possible value, or whether there is +// an ambiguity. +type Confidence int + +const ( + No Confidence = iota // full confidence that there was no match + Low // most likely value picked out of a set of alternatives + High // value is generally assumed to be the correct match + Exact // exact match or explicitly specified value +) + +var confName = []string{"No", "Low", "High", "Exact"} + +func (c Confidence) String() string { + return confName[c] +} + +// String returns the canonical string representation of the language tag. +func (t Tag) String() string { + return t.tag().String() +} + +// MarshalText implements encoding.TextMarshaler. +func (t Tag) MarshalText() (text []byte, err error) { + return t.tag().MarshalText() +} + +// UnmarshalText implements encoding.TextUnmarshaler. +func (t *Tag) UnmarshalText(text []byte) error { + var tag language.Tag + err := tag.UnmarshalText(text) + *t = makeTag(tag) + return err +} + +// Base returns the base language of the language tag. If the base language is +// unspecified, an attempt will be made to infer it from the context. +// It uses a variant of CLDR's Add Likely Subtags algorithm. This is subject to change. +func (t Tag) Base() (Base, Confidence) { + if b := t.lang(); b != 0 { + return Base{b}, Exact + } + tt := t.tag() + c := High + if tt.ScriptID == 0 && !tt.RegionID.IsCountry() { + c = Low + } + if tag, err := tt.Maximize(); err == nil && tag.LangID != 0 { + return Base{tag.LangID}, c + } + return Base{0}, No +} + +// Script infers the script for the language tag. If it was not explicitly given, it will infer +// a most likely candidate. +// If more than one script is commonly used for a language, the most likely one +// is returned with a low confidence indication. For example, it returns (Cyrl, Low) +// for Serbian. +// If a script cannot be inferred (Zzzz, No) is returned. We do not use Zyyy (undetermined) +// as one would suspect from the IANA registry for BCP 47. In a Unicode context Zyyy marks +// common characters (like 1, 2, 3, '.', etc.) and is therefore more like multiple scripts. +// See https://www.unicode.org/reports/tr24/#Values for more details. Zzzz is also used for +// unknown value in CLDR. (Zzzz, Exact) is returned if Zzzz was explicitly specified. +// Note that an inferred script is never guaranteed to be the correct one. Latin is +// almost exclusively used for Afrikaans, but Arabic has been used for some texts +// in the past. Also, the script that is commonly used may change over time. +// It uses a variant of CLDR's Add Likely Subtags algorithm. This is subject to change. +func (t Tag) Script() (Script, Confidence) { + if scr := t.script(); scr != 0 { + return Script{scr}, Exact + } + tt := t.tag() + sc, c := language.Script(_Zzzz), No + if scr := tt.LangID.SuppressScript(); scr != 0 { + // Note: it is not always the case that a language with a suppress + // script value is only written in one script (e.g. kk, ms, pa). + if tt.RegionID == 0 { + return Script{scr}, High + } + sc, c = scr, High + } + if tag, err := tt.Maximize(); err == nil { + if tag.ScriptID != sc { + sc, c = tag.ScriptID, Low + } + } else { + tt, _ = canonicalize(Deprecated|Macro, tt) + if tag, err := tt.Maximize(); err == nil && tag.ScriptID != sc { + sc, c = tag.ScriptID, Low + } + } + return Script{sc}, c +} + +// Region returns the region for the language tag. If it was not explicitly given, it will +// infer a most likely candidate from the context. +// It uses a variant of CLDR's Add Likely Subtags algorithm. This is subject to change. +func (t Tag) Region() (Region, Confidence) { + if r := t.region(); r != 0 { + return Region{r}, Exact + } + tt := t.tag() + if tt, err := tt.Maximize(); err == nil { + return Region{tt.RegionID}, Low // TODO: differentiate between high and low. + } + tt, _ = canonicalize(Deprecated|Macro, tt) + if tag, err := tt.Maximize(); err == nil { + return Region{tag.RegionID}, Low + } + return Region{_ZZ}, No // TODO: return world instead of undetermined? +} + +// Variants returns the variants specified explicitly for this language tag. +// or nil if no variant was specified. +func (t Tag) Variants() []Variant { + if !compact.Tag(t).MayHaveVariants() { + return nil + } + v := []Variant{} + x, str := "", t.tag().Variants() + for str != "" { + x, str = nextToken(str) + v = append(v, Variant{x}) + } + return v +} + +// Parent returns the CLDR parent of t. In CLDR, missing fields in data for a +// specific language are substituted with fields from the parent language. +// The parent for a language may change for newer versions of CLDR. +// +// Parent returns a tag for a less specific language that is mutually +// intelligible or Und if there is no such language. This may not be the same as +// simply stripping the last BCP 47 subtag. For instance, the parent of "zh-TW" +// is "zh-Hant", and the parent of "zh-Hant" is "und". +func (t Tag) Parent() Tag { + return Tag(compact.Tag(t).Parent()) +} + +// returns token t and the rest of the string. +func nextToken(s string) (t, tail string) { + p := strings.Index(s[1:], "-") + if p == -1 { + return s[1:], "" + } + p++ + return s[1:p], s[p:] +} + +// Extension is a single BCP 47 extension. +type Extension struct { + s string +} + +// String returns the string representation of the extension, including the +// type tag. +func (e Extension) String() string { + return e.s +} + +// ParseExtension parses s as an extension and returns it on success. +func ParseExtension(s string) (e Extension, err error) { + ext, err := language.ParseExtension(s) + return Extension{ext}, err +} + +// Type returns the one-byte extension type of e. It returns 0 for the zero +// exception. +func (e Extension) Type() byte { + if e.s == "" { + return 0 + } + return e.s[0] +} + +// Tokens returns the list of tokens of e. +func (e Extension) Tokens() []string { + return strings.Split(e.s, "-") +} + +// Extension returns the extension of type x for tag t. It will return +// false for ok if t does not have the requested extension. The returned +// extension will be invalid in this case. +func (t Tag) Extension(x byte) (ext Extension, ok bool) { + if !compact.Tag(t).MayHaveExtensions() { + return Extension{}, false + } + e, ok := t.tag().Extension(x) + return Extension{e}, ok +} + +// Extensions returns all extensions of t. +func (t Tag) Extensions() []Extension { + if !compact.Tag(t).MayHaveExtensions() { + return nil + } + e := []Extension{} + for _, ext := range t.tag().Extensions() { + e = append(e, Extension{ext}) + } + return e +} + +// TypeForKey returns the type associated with the given key, where key and type +// are of the allowed values defined for the Unicode locale extension ('u') in +// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +// TypeForKey will traverse the inheritance chain to get the correct value. +// +// If there are multiple types associated with a key, only the first will be +// returned. If there is no type associated with a key, it returns the empty +// string. +func (t Tag) TypeForKey(key string) string { + if !compact.Tag(t).MayHaveExtensions() { + if key != "rg" && key != "va" { + return "" + } + } + return t.tag().TypeForKey(key) +} + +// SetTypeForKey returns a new Tag with the key set to type, where key and type +// are of the allowed values defined for the Unicode locale extension ('u') in +// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +// An empty value removes an existing pair with the same key. +func (t Tag) SetTypeForKey(key, value string) (Tag, error) { + tt, err := t.tag().SetTypeForKey(key, value) + return makeTag(tt), err +} + +// NumCompactTags is the number of compact tags. The maximum tag is +// NumCompactTags-1. +const NumCompactTags = compact.NumCompactTags + +// CompactIndex returns an index, where 0 <= index < NumCompactTags, for tags +// for which data exists in the text repository.The index will change over time +// and should not be stored in persistent storage. If t does not match a compact +// index, exact will be false and the compact index will be returned for the +// first match after repeatedly taking the Parent of t. +func CompactIndex(t Tag) (index int, exact bool) { + id, exact := compact.LanguageID(compact.Tag(t)) + return int(id), exact +} + +var root = language.Tag{} + +// Base is an ISO 639 language code, used for encoding the base language +// of a language tag. +type Base struct { + langID language.Language +} + +// ParseBase parses a 2- or 3-letter ISO 639 code. +// It returns a ValueError if s is a well-formed but unknown language identifier +// or another error if another error occurred. +func ParseBase(s string) (Base, error) { + l, err := language.ParseBase(s) + return Base{l}, err +} + +// String returns the BCP 47 representation of the base language. +func (b Base) String() string { + return b.langID.String() +} + +// ISO3 returns the ISO 639-3 language code. +func (b Base) ISO3() string { + return b.langID.ISO3() +} + +// IsPrivateUse reports whether this language code is reserved for private use. +func (b Base) IsPrivateUse() bool { + return b.langID.IsPrivateUse() +} + +// Script is a 4-letter ISO 15924 code for representing scripts. +// It is idiomatically represented in title case. +type Script struct { + scriptID language.Script +} + +// ParseScript parses a 4-letter ISO 15924 code. +// It returns a ValueError if s is a well-formed but unknown script identifier +// or another error if another error occurred. +func ParseScript(s string) (Script, error) { + sc, err := language.ParseScript(s) + return Script{sc}, err +} + +// String returns the script code in title case. +// It returns "Zzzz" for an unspecified script. +func (s Script) String() string { + return s.scriptID.String() +} + +// IsPrivateUse reports whether this script code is reserved for private use. +func (s Script) IsPrivateUse() bool { + return s.scriptID.IsPrivateUse() +} + +// Region is an ISO 3166-1 or UN M.49 code for representing countries and regions. +type Region struct { + regionID language.Region +} + +// EncodeM49 returns the Region for the given UN M.49 code. +// It returns an error if r is not a valid code. +func EncodeM49(r int) (Region, error) { + rid, err := language.EncodeM49(r) + return Region{rid}, err +} + +// ParseRegion parses a 2- or 3-letter ISO 3166-1 or a UN M.49 code. +// It returns a ValueError if s is a well-formed but unknown region identifier +// or another error if another error occurred. +func ParseRegion(s string) (Region, error) { + r, err := language.ParseRegion(s) + return Region{r}, err +} + +// String returns the BCP 47 representation for the region. +// It returns "ZZ" for an unspecified region. +func (r Region) String() string { + return r.regionID.String() +} + +// ISO3 returns the 3-letter ISO code of r. +// Note that not all regions have a 3-letter ISO code. +// In such cases this method returns "ZZZ". +func (r Region) ISO3() string { + return r.regionID.ISO3() +} + +// M49 returns the UN M.49 encoding of r, or 0 if this encoding +// is not defined for r. +func (r Region) M49() int { + return r.regionID.M49() +} + +// IsPrivateUse reports whether r has the ISO 3166 User-assigned status. This +// may include private-use tags that are assigned by CLDR and used in this +// implementation. So IsPrivateUse and IsCountry can be simultaneously true. +func (r Region) IsPrivateUse() bool { + return r.regionID.IsPrivateUse() +} + +// IsCountry returns whether this region is a country or autonomous area. This +// includes non-standard definitions from CLDR. +func (r Region) IsCountry() bool { + return r.regionID.IsCountry() +} + +// IsGroup returns whether this region defines a collection of regions. This +// includes non-standard definitions from CLDR. +func (r Region) IsGroup() bool { + return r.regionID.IsGroup() +} + +// Contains returns whether Region c is contained by Region r. It returns true +// if c == r. +func (r Region) Contains(c Region) bool { + return r.regionID.Contains(c.regionID) +} + +// TLD returns the country code top-level domain (ccTLD). UK is returned for GB. +// In all other cases it returns either the region itself or an error. +// +// This method may return an error for a region for which there exists a +// canonical form with a ccTLD. To get that ccTLD canonicalize r first. The +// region will already be canonicalized it was obtained from a Tag that was +// obtained using any of the default methods. +func (r Region) TLD() (Region, error) { + tld, err := r.regionID.TLD() + return Region{tld}, err +} + +// Canonicalize returns the region or a possible replacement if the region is +// deprecated. It will not return a replacement for deprecated regions that +// are split into multiple regions. +func (r Region) Canonicalize() Region { + return Region{r.regionID.Canonicalize()} +} + +// Variant represents a registered variant of a language as defined by BCP 47. +type Variant struct { + variant string +} + +// ParseVariant parses and returns a Variant. An error is returned if s is not +// a valid variant. +func ParseVariant(s string) (Variant, error) { + v, err := language.ParseVariant(s) + return Variant{v.String()}, err +} + +// String returns the string representation of the variant. +func (v Variant) String() string { + return v.variant +} diff --git a/vendor/golang.org/x/text/language/match.go b/vendor/golang.org/x/text/language/match.go new file mode 100644 index 00000000..ee45f494 --- /dev/null +++ b/vendor/golang.org/x/text/language/match.go @@ -0,0 +1,735 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import ( + "errors" + "strings" + + "golang.org/x/text/internal/language" +) + +// A MatchOption configures a Matcher. +type MatchOption func(*matcher) + +// PreferSameScript will, in the absence of a match, result in the first +// preferred tag with the same script as a supported tag to match this supported +// tag. The default is currently true, but this may change in the future. +func PreferSameScript(preferSame bool) MatchOption { + return func(m *matcher) { m.preferSameScript = preferSame } +} + +// TODO(v1.0.0): consider making Matcher a concrete type, instead of interface. +// There doesn't seem to be too much need for multiple types. +// Making it a concrete type allows MatchStrings to be a method, which will +// improve its discoverability. + +// MatchStrings parses and matches the given strings until one of them matches +// the language in the Matcher. A string may be an Accept-Language header as +// handled by ParseAcceptLanguage. The default language is returned if no +// other language matched. +func MatchStrings(m Matcher, lang ...string) (tag Tag, index int) { + for _, accept := range lang { + desired, _, err := ParseAcceptLanguage(accept) + if err != nil { + continue + } + if tag, index, conf := m.Match(desired...); conf != No { + return tag, index + } + } + tag, index, _ = m.Match() + return +} + +// Matcher is the interface that wraps the Match method. +// +// Match returns the best match for any of the given tags, along with +// a unique index associated with the returned tag and a confidence +// score. +type Matcher interface { + Match(t ...Tag) (tag Tag, index int, c Confidence) +} + +// Comprehends reports the confidence score for a speaker of a given language +// to being able to comprehend the written form of an alternative language. +func Comprehends(speaker, alternative Tag) Confidence { + _, _, c := NewMatcher([]Tag{alternative}).Match(speaker) + return c +} + +// NewMatcher returns a Matcher that matches an ordered list of preferred tags +// against a list of supported tags based on written intelligibility, closeness +// of dialect, equivalence of subtags and various other rules. It is initialized +// with the list of supported tags. The first element is used as the default +// value in case no match is found. +// +// Its Match method matches the first of the given Tags to reach a certain +// confidence threshold. The tags passed to Match should therefore be specified +// in order of preference. Extensions are ignored for matching. +// +// The index returned by the Match method corresponds to the index of the +// matched tag in t, but is augmented with the Unicode extension ('u')of the +// corresponding preferred tag. This allows user locale options to be passed +// transparently. +func NewMatcher(t []Tag, options ...MatchOption) Matcher { + return newMatcher(t, options) +} + +func (m *matcher) Match(want ...Tag) (t Tag, index int, c Confidence) { + var tt language.Tag + match, w, c := m.getBest(want...) + if match != nil { + tt, index = match.tag, match.index + } else { + // TODO: this should be an option + tt = m.default_.tag + if m.preferSameScript { + outer: + for _, w := range want { + script, _ := w.Script() + if script.scriptID == 0 { + // Don't do anything if there is no script, such as with + // private subtags. + continue + } + for i, h := range m.supported { + if script.scriptID == h.maxScript { + tt, index = h.tag, i + break outer + } + } + } + } + // TODO: select first language tag based on script. + } + if w.RegionID != tt.RegionID && w.RegionID != 0 { + if w.RegionID != 0 && tt.RegionID != 0 && tt.RegionID.Contains(w.RegionID) { + tt.RegionID = w.RegionID + tt.RemakeString() + } else if r := w.RegionID.String(); len(r) == 2 { + // TODO: also filter macro and deprecated. + tt, _ = tt.SetTypeForKey("rg", strings.ToLower(r)+"zzzz") + } + } + // Copy options from the user-provided tag into the result tag. This is hard + // to do after the fact, so we do it here. + // TODO: add in alternative variants to -u-va-. + // TODO: add preferred region to -u-rg-. + if e := w.Extensions(); len(e) > 0 { + b := language.Builder{} + b.SetTag(tt) + for _, e := range e { + b.AddExt(e) + } + tt = b.Make() + } + return makeTag(tt), index, c +} + +// ErrMissingLikelyTagsData indicates no information was available +// to compute likely values of missing tags. +var ErrMissingLikelyTagsData = errors.New("missing likely tags data") + +// func (t *Tag) setTagsFrom(id Tag) { +// t.LangID = id.LangID +// t.ScriptID = id.ScriptID +// t.RegionID = id.RegionID +// } + +// Tag Matching +// CLDR defines an algorithm for finding the best match between two sets of language +// tags. The basic algorithm defines how to score a possible match and then find +// the match with the best score +// (see https://www.unicode.org/reports/tr35/#LanguageMatching). +// Using scoring has several disadvantages. The scoring obfuscates the importance of +// the various factors considered, making the algorithm harder to understand. Using +// scoring also requires the full score to be computed for each pair of tags. +// +// We will use a different algorithm which aims to have the following properties: +// - clarity on the precedence of the various selection factors, and +// - improved performance by allowing early termination of a comparison. +// +// Matching algorithm (overview) +// Input: +// - supported: a set of supported tags +// - default: the default tag to return in case there is no match +// - desired: list of desired tags, ordered by preference, starting with +// the most-preferred. +// +// Algorithm: +// 1) Set the best match to the lowest confidence level +// 2) For each tag in "desired": +// a) For each tag in "supported": +// 1) compute the match between the two tags. +// 2) if the match is better than the previous best match, replace it +// with the new match. (see next section) +// b) if the current best match is Exact and pin is true the result will be +// frozen to the language found thusfar, although better matches may +// still be found for the same language. +// 3) If the best match so far is below a certain threshold, return "default". +// +// Ranking: +// We use two phases to determine whether one pair of tags are a better match +// than another pair of tags. First, we determine a rough confidence level. If the +// levels are different, the one with the highest confidence wins. +// Second, if the rough confidence levels are identical, we use a set of tie-breaker +// rules. +// +// The confidence level of matching a pair of tags is determined by finding the +// lowest confidence level of any matches of the corresponding subtags (the +// result is deemed as good as its weakest link). +// We define the following levels: +// Exact - An exact match of a subtag, before adding likely subtags. +// MaxExact - An exact match of a subtag, after adding likely subtags. +// [See Note 2]. +// High - High level of mutual intelligibility between different subtag +// variants. +// Low - Low level of mutual intelligibility between different subtag +// variants. +// No - No mutual intelligibility. +// +// The following levels can occur for each type of subtag: +// Base: Exact, MaxExact, High, Low, No +// Script: Exact, MaxExact [see Note 3], Low, No +// Region: Exact, MaxExact, High +// Variant: Exact, High +// Private: Exact, No +// +// Any result with a confidence level of Low or higher is deemed a possible match. +// Once a desired tag matches any of the supported tags with a level of MaxExact +// or higher, the next desired tag is not considered (see Step 2.b). +// Note that CLDR provides languageMatching data that defines close equivalence +// classes for base languages, scripts and regions. +// +// Tie-breaking +// If we get the same confidence level for two matches, we apply a sequence of +// tie-breaking rules. The first that succeeds defines the result. The rules are +// applied in the following order. +// 1) Original language was defined and was identical. +// 2) Original region was defined and was identical. +// 3) Distance between two maximized regions was the smallest. +// 4) Original script was defined and was identical. +// 5) Distance from want tag to have tag using the parent relation [see Note 5.] +// If there is still no winner after these rules are applied, the first match +// found wins. +// +// Notes: +// [2] In practice, as matching of Exact is done in a separate phase from +// matching the other levels, we reuse the Exact level to mean MaxExact in +// the second phase. As a consequence, we only need the levels defined by +// the Confidence type. The MaxExact confidence level is mapped to High in +// the public API. +// [3] We do not differentiate between maximized script values that were derived +// from suppressScript versus most likely tag data. We determined that in +// ranking the two, one ranks just after the other. Moreover, the two cannot +// occur concurrently. As a consequence, they are identical for practical +// purposes. +// [4] In case of deprecated, macro-equivalents and legacy mappings, we assign +// the MaxExact level to allow iw vs he to still be a closer match than +// en-AU vs en-US, for example. +// [5] In CLDR a locale inherits fields that are unspecified for this locale +// from its parent. Therefore, if a locale is a parent of another locale, +// it is a strong measure for closeness, especially when no other tie +// breaker rule applies. One could also argue it is inconsistent, for +// example, when pt-AO matches pt (which CLDR equates with pt-BR), even +// though its parent is pt-PT according to the inheritance rules. +// +// Implementation Details: +// There are several performance considerations worth pointing out. Most notably, +// we preprocess as much as possible (within reason) at the time of creation of a +// matcher. This includes: +// - creating a per-language map, which includes data for the raw base language +// and its canonicalized variant (if applicable), +// - expanding entries for the equivalence classes defined in CLDR's +// languageMatch data. +// The per-language map ensures that typically only a very small number of tags +// need to be considered. The pre-expansion of canonicalized subtags and +// equivalence classes reduces the amount of map lookups that need to be done at +// runtime. + +// matcher keeps a set of supported language tags, indexed by language. +type matcher struct { + default_ *haveTag + supported []*haveTag + index map[language.Language]*matchHeader + passSettings bool + preferSameScript bool +} + +// matchHeader has the lists of tags for exact matches and matches based on +// maximized and canonicalized tags for a given language. +type matchHeader struct { + haveTags []*haveTag + original bool +} + +// haveTag holds a supported Tag and its maximized script and region. The maximized +// or canonicalized language is not stored as it is not needed during matching. +type haveTag struct { + tag language.Tag + + // index of this tag in the original list of supported tags. + index int + + // conf is the maximum confidence that can result from matching this haveTag. + // When conf < Exact this means it was inserted after applying a CLDR equivalence rule. + conf Confidence + + // Maximized region and script. + maxRegion language.Region + maxScript language.Script + + // altScript may be checked as an alternative match to maxScript. If altScript + // matches, the confidence level for this match is Low. Theoretically there + // could be multiple alternative scripts. This does not occur in practice. + altScript language.Script + + // nextMax is the index of the next haveTag with the same maximized tags. + nextMax uint16 +} + +func makeHaveTag(tag language.Tag, index int) (haveTag, language.Language) { + max := tag + if tag.LangID != 0 || tag.RegionID != 0 || tag.ScriptID != 0 { + max, _ = canonicalize(All, max) + max, _ = max.Maximize() + max.RemakeString() + } + return haveTag{tag, index, Exact, max.RegionID, max.ScriptID, altScript(max.LangID, max.ScriptID), 0}, max.LangID +} + +// altScript returns an alternative script that may match the given script with +// a low confidence. At the moment, the langMatch data allows for at most one +// script to map to another and we rely on this to keep the code simple. +func altScript(l language.Language, s language.Script) language.Script { + for _, alt := range matchScript { + // TODO: also match cases where language is not the same. + if (language.Language(alt.wantLang) == l || language.Language(alt.haveLang) == l) && + language.Script(alt.haveScript) == s { + return language.Script(alt.wantScript) + } + } + return 0 +} + +// addIfNew adds a haveTag to the list of tags only if it is a unique tag. +// Tags that have the same maximized values are linked by index. +func (h *matchHeader) addIfNew(n haveTag, exact bool) { + h.original = h.original || exact + // Don't add new exact matches. + for _, v := range h.haveTags { + if equalsRest(v.tag, n.tag) { + return + } + } + // Allow duplicate maximized tags, but create a linked list to allow quickly + // comparing the equivalents and bail out. + for i, v := range h.haveTags { + if v.maxScript == n.maxScript && + v.maxRegion == n.maxRegion && + v.tag.VariantOrPrivateUseTags() == n.tag.VariantOrPrivateUseTags() { + for h.haveTags[i].nextMax != 0 { + i = int(h.haveTags[i].nextMax) + } + h.haveTags[i].nextMax = uint16(len(h.haveTags)) + break + } + } + h.haveTags = append(h.haveTags, &n) +} + +// header returns the matchHeader for the given language. It creates one if +// it doesn't already exist. +func (m *matcher) header(l language.Language) *matchHeader { + if h := m.index[l]; h != nil { + return h + } + h := &matchHeader{} + m.index[l] = h + return h +} + +func toConf(d uint8) Confidence { + if d <= 10 { + return High + } + if d < 30 { + return Low + } + return No +} + +// newMatcher builds an index for the given supported tags and returns it as +// a matcher. It also expands the index by considering various equivalence classes +// for a given tag. +func newMatcher(supported []Tag, options []MatchOption) *matcher { + m := &matcher{ + index: make(map[language.Language]*matchHeader), + preferSameScript: true, + } + for _, o := range options { + o(m) + } + if len(supported) == 0 { + m.default_ = &haveTag{} + return m + } + // Add supported languages to the index. Add exact matches first to give + // them precedence. + for i, tag := range supported { + tt := tag.tag() + pair, _ := makeHaveTag(tt, i) + m.header(tt.LangID).addIfNew(pair, true) + m.supported = append(m.supported, &pair) + } + m.default_ = m.header(supported[0].lang()).haveTags[0] + // Keep these in two different loops to support the case that two equivalent + // languages are distinguished, such as iw and he. + for i, tag := range supported { + tt := tag.tag() + pair, max := makeHaveTag(tt, i) + if max != tt.LangID { + m.header(max).addIfNew(pair, true) + } + } + + // update is used to add indexes in the map for equivalent languages. + // update will only add entries to original indexes, thus not computing any + // transitive relations. + update := func(want, have uint16, conf Confidence) { + if hh := m.index[language.Language(have)]; hh != nil { + if !hh.original { + return + } + hw := m.header(language.Language(want)) + for _, ht := range hh.haveTags { + v := *ht + if conf < v.conf { + v.conf = conf + } + v.nextMax = 0 // this value needs to be recomputed + if v.altScript != 0 { + v.altScript = altScript(language.Language(want), v.maxScript) + } + hw.addIfNew(v, conf == Exact && hh.original) + } + } + } + + // Add entries for languages with mutual intelligibility as defined by CLDR's + // languageMatch data. + for _, ml := range matchLang { + update(ml.want, ml.have, toConf(ml.distance)) + if !ml.oneway { + update(ml.have, ml.want, toConf(ml.distance)) + } + } + + // Add entries for possible canonicalizations. This is an optimization to + // ensure that only one map lookup needs to be done at runtime per desired tag. + // First we match deprecated equivalents. If they are perfect equivalents + // (their canonicalization simply substitutes a different language code, but + // nothing else), the match confidence is Exact, otherwise it is High. + for i, lm := range language.AliasMap { + // If deprecated codes match and there is no fiddling with the script or + // or region, we consider it an exact match. + conf := Exact + if language.AliasTypes[i] != language.Macro { + if !isExactEquivalent(language.Language(lm.From)) { + conf = High + } + update(lm.To, lm.From, conf) + } + update(lm.From, lm.To, conf) + } + return m +} + +// getBest gets the best matching tag in m for any of the given tags, taking into +// account the order of preference of the given tags. +func (m *matcher) getBest(want ...Tag) (got *haveTag, orig language.Tag, c Confidence) { + best := bestMatch{} + for i, ww := range want { + w := ww.tag() + var max language.Tag + // Check for exact match first. + h := m.index[w.LangID] + if w.LangID != 0 { + if h == nil { + continue + } + // Base language is defined. + max, _ = canonicalize(Legacy|Deprecated|Macro, w) + // A region that is added through canonicalization is stronger than + // a maximized region: set it in the original (e.g. mo -> ro-MD). + if w.RegionID != max.RegionID { + w.RegionID = max.RegionID + } + // TODO: should we do the same for scripts? + // See test case: en, sr, nl ; sh ; sr + max, _ = max.Maximize() + } else { + // Base language is not defined. + if h != nil { + for i := range h.haveTags { + have := h.haveTags[i] + if equalsRest(have.tag, w) { + return have, w, Exact + } + } + } + if w.ScriptID == 0 && w.RegionID == 0 { + // We skip all tags matching und for approximate matching, including + // private tags. + continue + } + max, _ = w.Maximize() + if h = m.index[max.LangID]; h == nil { + continue + } + } + pin := true + for _, t := range want[i+1:] { + if w.LangID == t.lang() { + pin = false + break + } + } + // Check for match based on maximized tag. + for i := range h.haveTags { + have := h.haveTags[i] + best.update(have, w, max.ScriptID, max.RegionID, pin) + if best.conf == Exact { + for have.nextMax != 0 { + have = h.haveTags[have.nextMax] + best.update(have, w, max.ScriptID, max.RegionID, pin) + } + return best.have, best.want, best.conf + } + } + } + if best.conf <= No { + if len(want) != 0 { + return nil, want[0].tag(), No + } + return nil, language.Tag{}, No + } + return best.have, best.want, best.conf +} + +// bestMatch accumulates the best match so far. +type bestMatch struct { + have *haveTag + want language.Tag + conf Confidence + pinnedRegion language.Region + pinLanguage bool + sameRegionGroup bool + // Cached results from applying tie-breaking rules. + origLang bool + origReg bool + paradigmReg bool + regGroupDist uint8 + origScript bool +} + +// update updates the existing best match if the new pair is considered to be a +// better match. To determine if the given pair is a better match, it first +// computes the rough confidence level. If this surpasses the current match, it +// will replace it and update the tie-breaker rule cache. If there is a tie, it +// proceeds with applying a series of tie-breaker rules. If there is no +// conclusive winner after applying the tie-breaker rules, it leaves the current +// match as the preferred match. +// +// If pin is true and have and tag are a strong match, it will henceforth only +// consider matches for this language. This corresponds to the idea that most +// users have a strong preference for the first defined language. A user can +// still prefer a second language over a dialect of the preferred language by +// explicitly specifying dialects, e.g. "en, nl, en-GB". In this case pin should +// be false. +func (m *bestMatch) update(have *haveTag, tag language.Tag, maxScript language.Script, maxRegion language.Region, pin bool) { + // Bail if the maximum attainable confidence is below that of the current best match. + c := have.conf + if c < m.conf { + return + } + // Don't change the language once we already have found an exact match. + if m.pinLanguage && tag.LangID != m.want.LangID { + return + } + // Pin the region group if we are comparing tags for the same language. + if tag.LangID == m.want.LangID && m.sameRegionGroup { + _, sameGroup := regionGroupDist(m.pinnedRegion, have.maxRegion, have.maxScript, m.want.LangID) + if !sameGroup { + return + } + } + if c == Exact && have.maxScript == maxScript { + // If there is another language and then another entry of this language, + // don't pin anything, otherwise pin the language. + m.pinLanguage = pin + } + if equalsRest(have.tag, tag) { + } else if have.maxScript != maxScript { + // There is usually very little comprehension between different scripts. + // In a few cases there may still be Low comprehension. This possibility + // is pre-computed and stored in have.altScript. + if Low < m.conf || have.altScript != maxScript { + return + } + c = Low + } else if have.maxRegion != maxRegion { + if High < c { + // There is usually a small difference between languages across regions. + c = High + } + } + + // We store the results of the computations of the tie-breaker rules along + // with the best match. There is no need to do the checks once we determine + // we have a winner, but we do still need to do the tie-breaker computations. + // We use "beaten" to keep track if we still need to do the checks. + beaten := false // true if the new pair defeats the current one. + if c != m.conf { + if c < m.conf { + return + } + beaten = true + } + + // Tie-breaker rules: + // We prefer if the pre-maximized language was specified and identical. + origLang := have.tag.LangID == tag.LangID && tag.LangID != 0 + if !beaten && m.origLang != origLang { + if m.origLang { + return + } + beaten = true + } + + // We prefer if the pre-maximized region was specified and identical. + origReg := have.tag.RegionID == tag.RegionID && tag.RegionID != 0 + if !beaten && m.origReg != origReg { + if m.origReg { + return + } + beaten = true + } + + regGroupDist, sameGroup := regionGroupDist(have.maxRegion, maxRegion, maxScript, tag.LangID) + if !beaten && m.regGroupDist != regGroupDist { + if regGroupDist > m.regGroupDist { + return + } + beaten = true + } + + paradigmReg := isParadigmLocale(tag.LangID, have.maxRegion) + if !beaten && m.paradigmReg != paradigmReg { + if !paradigmReg { + return + } + beaten = true + } + + // Next we prefer if the pre-maximized script was specified and identical. + origScript := have.tag.ScriptID == tag.ScriptID && tag.ScriptID != 0 + if !beaten && m.origScript != origScript { + if m.origScript { + return + } + beaten = true + } + + // Update m to the newly found best match. + if beaten { + m.have = have + m.want = tag + m.conf = c + m.pinnedRegion = maxRegion + m.sameRegionGroup = sameGroup + m.origLang = origLang + m.origReg = origReg + m.paradigmReg = paradigmReg + m.origScript = origScript + m.regGroupDist = regGroupDist + } +} + +func isParadigmLocale(lang language.Language, r language.Region) bool { + for _, e := range paradigmLocales { + if language.Language(e[0]) == lang && (r == language.Region(e[1]) || r == language.Region(e[2])) { + return true + } + } + return false +} + +// regionGroupDist computes the distance between two regions based on their +// CLDR grouping. +func regionGroupDist(a, b language.Region, script language.Script, lang language.Language) (dist uint8, same bool) { + const defaultDistance = 4 + + aGroup := uint(regionToGroups[a]) << 1 + bGroup := uint(regionToGroups[b]) << 1 + for _, ri := range matchRegion { + if language.Language(ri.lang) == lang && (ri.script == 0 || language.Script(ri.script) == script) { + group := uint(1 << (ri.group &^ 0x80)) + if 0x80&ri.group == 0 { + if aGroup&bGroup&group != 0 { // Both regions are in the group. + return ri.distance, ri.distance == defaultDistance + } + } else { + if (aGroup|bGroup)&group == 0 { // Both regions are not in the group. + return ri.distance, ri.distance == defaultDistance + } + } + } + } + return defaultDistance, true +} + +// equalsRest compares everything except the language. +func equalsRest(a, b language.Tag) bool { + // TODO: don't include extensions in this comparison. To do this efficiently, + // though, we should handle private tags separately. + return a.ScriptID == b.ScriptID && a.RegionID == b.RegionID && a.VariantOrPrivateUseTags() == b.VariantOrPrivateUseTags() +} + +// isExactEquivalent returns true if canonicalizing the language will not alter +// the script or region of a tag. +func isExactEquivalent(l language.Language) bool { + for _, o := range notEquivalent { + if o == l { + return false + } + } + return true +} + +var notEquivalent []language.Language + +func init() { + // Create a list of all languages for which canonicalization may alter the + // script or region. + for _, lm := range language.AliasMap { + tag := language.Tag{LangID: language.Language(lm.From)} + if tag, _ = canonicalize(All, tag); tag.ScriptID != 0 || tag.RegionID != 0 { + notEquivalent = append(notEquivalent, language.Language(lm.From)) + } + } + // Maximize undefined regions of paradigm locales. + for i, v := range paradigmLocales { + t := language.Tag{LangID: language.Language(v[0])} + max, _ := t.Maximize() + if v[1] == 0 { + paradigmLocales[i][1] = uint16(max.RegionID) + } + if v[2] == 0 { + paradigmLocales[i][2] = uint16(max.RegionID) + } + } +} diff --git a/vendor/golang.org/x/text/language/parse.go b/vendor/golang.org/x/text/language/parse.go new file mode 100644 index 00000000..4d57222e --- /dev/null +++ b/vendor/golang.org/x/text/language/parse.go @@ -0,0 +1,256 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import ( + "errors" + "sort" + "strconv" + "strings" + + "golang.org/x/text/internal/language" +) + +// ValueError is returned by any of the parsing functions when the +// input is well-formed but the respective subtag is not recognized +// as a valid value. +type ValueError interface { + error + + // Subtag returns the subtag for which the error occurred. + Subtag() string +} + +// Parse parses the given BCP 47 string and returns a valid Tag. If parsing +// failed it returns an error and any part of the tag that could be parsed. +// If parsing succeeded but an unknown value was found, it returns +// ValueError. The Tag returned in this case is just stripped of the unknown +// value. All other values are preserved. It accepts tags in the BCP 47 format +// and extensions to this standard defined in +// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +// The resulting tag is canonicalized using the default canonicalization type. +func Parse(s string) (t Tag, err error) { + return Default.Parse(s) +} + +// Parse parses the given BCP 47 string and returns a valid Tag. If parsing +// failed it returns an error and any part of the tag that could be parsed. +// If parsing succeeded but an unknown value was found, it returns +// ValueError. The Tag returned in this case is just stripped of the unknown +// value. All other values are preserved. It accepts tags in the BCP 47 format +// and extensions to this standard defined in +// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +// The resulting tag is canonicalized using the canonicalization type c. +func (c CanonType) Parse(s string) (t Tag, err error) { + defer func() { + if recover() != nil { + t = Tag{} + err = language.ErrSyntax + } + }() + + tt, err := language.Parse(s) + if err != nil { + return makeTag(tt), err + } + tt, changed := canonicalize(c, tt) + if changed { + tt.RemakeString() + } + return makeTag(tt), err +} + +// Compose creates a Tag from individual parts, which may be of type Tag, Base, +// Script, Region, Variant, []Variant, Extension, []Extension or error. If a +// Base, Script or Region or slice of type Variant or Extension is passed more +// than once, the latter will overwrite the former. Variants and Extensions are +// accumulated, but if two extensions of the same type are passed, the latter +// will replace the former. For -u extensions, though, the key-type pairs are +// added, where later values overwrite older ones. A Tag overwrites all former +// values and typically only makes sense as the first argument. The resulting +// tag is returned after canonicalizing using the Default CanonType. If one or +// more errors are encountered, one of the errors is returned. +func Compose(part ...interface{}) (t Tag, err error) { + return Default.Compose(part...) +} + +// Compose creates a Tag from individual parts, which may be of type Tag, Base, +// Script, Region, Variant, []Variant, Extension, []Extension or error. If a +// Base, Script or Region or slice of type Variant or Extension is passed more +// than once, the latter will overwrite the former. Variants and Extensions are +// accumulated, but if two extensions of the same type are passed, the latter +// will replace the former. For -u extensions, though, the key-type pairs are +// added, where later values overwrite older ones. A Tag overwrites all former +// values and typically only makes sense as the first argument. The resulting +// tag is returned after canonicalizing using CanonType c. If one or more errors +// are encountered, one of the errors is returned. +func (c CanonType) Compose(part ...interface{}) (t Tag, err error) { + defer func() { + if recover() != nil { + t = Tag{} + err = language.ErrSyntax + } + }() + + var b language.Builder + if err = update(&b, part...); err != nil { + return und, err + } + b.Tag, _ = canonicalize(c, b.Tag) + return makeTag(b.Make()), err +} + +var errInvalidArgument = errors.New("invalid Extension or Variant") + +func update(b *language.Builder, part ...interface{}) (err error) { + for _, x := range part { + switch v := x.(type) { + case Tag: + b.SetTag(v.tag()) + case Base: + b.Tag.LangID = v.langID + case Script: + b.Tag.ScriptID = v.scriptID + case Region: + b.Tag.RegionID = v.regionID + case Variant: + if v.variant == "" { + err = errInvalidArgument + break + } + b.AddVariant(v.variant) + case Extension: + if v.s == "" { + err = errInvalidArgument + break + } + b.SetExt(v.s) + case []Variant: + b.ClearVariants() + for _, v := range v { + b.AddVariant(v.variant) + } + case []Extension: + b.ClearExtensions() + for _, e := range v { + b.SetExt(e.s) + } + // TODO: support parsing of raw strings based on morphology or just extensions? + case error: + if v != nil { + err = v + } + } + } + return +} + +var errInvalidWeight = errors.New("ParseAcceptLanguage: invalid weight") +var errTagListTooLarge = errors.New("tag list exceeds max length") + +// ParseAcceptLanguage parses the contents of an Accept-Language header as +// defined in http://www.ietf.org/rfc/rfc2616.txt and returns a list of Tags and +// a list of corresponding quality weights. It is more permissive than RFC 2616 +// and may return non-nil slices even if the input is not valid. +// The Tags will be sorted by highest weight first and then by first occurrence. +// Tags with a weight of zero will be dropped. An error will be returned if the +// input could not be parsed. +func ParseAcceptLanguage(s string) (tag []Tag, q []float32, err error) { + defer func() { + if recover() != nil { + tag = nil + q = nil + err = language.ErrSyntax + } + }() + + if strings.Count(s, "-") > 1000 { + return nil, nil, errTagListTooLarge + } + + var entry string + for s != "" { + if entry, s = split(s, ','); entry == "" { + continue + } + + entry, weight := split(entry, ';') + + // Scan the language. + t, err := Parse(entry) + if err != nil { + id, ok := acceptFallback[entry] + if !ok { + return nil, nil, err + } + t = makeTag(language.Tag{LangID: id}) + } + + // Scan the optional weight. + w := 1.0 + if weight != "" { + weight = consume(weight, 'q') + weight = consume(weight, '=') + // consume returns the empty string when a token could not be + // consumed, resulting in an error for ParseFloat. + if w, err = strconv.ParseFloat(weight, 32); err != nil { + return nil, nil, errInvalidWeight + } + // Drop tags with a quality weight of 0. + if w <= 0 { + continue + } + } + + tag = append(tag, t) + q = append(q, float32(w)) + } + sort.Stable(&tagSort{tag, q}) + return tag, q, nil +} + +// consume removes a leading token c from s and returns the result or the empty +// string if there is no such token. +func consume(s string, c byte) string { + if s == "" || s[0] != c { + return "" + } + return strings.TrimSpace(s[1:]) +} + +func split(s string, c byte) (head, tail string) { + if i := strings.IndexByte(s, c); i >= 0 { + return strings.TrimSpace(s[:i]), strings.TrimSpace(s[i+1:]) + } + return strings.TrimSpace(s), "" +} + +// Add hack mapping to deal with a small number of cases that occur +// in Accept-Language (with reasonable frequency). +var acceptFallback = map[string]language.Language{ + "english": _en, + "deutsch": _de, + "italian": _it, + "french": _fr, + "*": _mul, // defined in the spec to match all languages. +} + +type tagSort struct { + tag []Tag + q []float32 +} + +func (s *tagSort) Len() int { + return len(s.q) +} + +func (s *tagSort) Less(i, j int) bool { + return s.q[i] > s.q[j] +} + +func (s *tagSort) Swap(i, j int) { + s.tag[i], s.tag[j] = s.tag[j], s.tag[i] + s.q[i], s.q[j] = s.q[j], s.q[i] +} diff --git a/vendor/golang.org/x/text/language/tables.go b/vendor/golang.org/x/text/language/tables.go new file mode 100644 index 00000000..34a732b6 --- /dev/null +++ b/vendor/golang.org/x/text/language/tables.go @@ -0,0 +1,298 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +package language + +// CLDRVersion is the CLDR version from which the tables in this package are derived. +const CLDRVersion = "32" + +const ( + _de = 269 + _en = 313 + _fr = 350 + _it = 505 + _mo = 784 + _no = 879 + _nb = 839 + _pt = 960 + _sh = 1031 + _mul = 806 + _und = 0 +) +const ( + _001 = 1 + _419 = 31 + _BR = 65 + _CA = 73 + _ES = 110 + _GB = 123 + _MD = 188 + _PT = 238 + _UK = 306 + _US = 309 + _ZZ = 357 + _XA = 323 + _XC = 325 + _XK = 333 +) +const ( + _Latn = 90 + _Hani = 57 + _Hans = 59 + _Hant = 60 + _Qaaa = 147 + _Qaai = 155 + _Qabx = 196 + _Zinh = 252 + _Zyyy = 257 + _Zzzz = 258 +) + +var regionToGroups = []uint8{ // 358 elements + // Entry 0 - 3F + 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x04, + 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x04, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, + 0x00, 0x04, 0x00, 0x00, 0x04, 0x01, 0x00, 0x00, + 0x04, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x04, + // Entry 40 - 7F + 0x04, 0x04, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x04, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, + 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x08, + 0x00, 0x04, 0x00, 0x00, 0x08, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, + // Entry 80 - BF + 0x00, 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, 0x00, + 0x00, 0x04, 0x01, 0x00, 0x04, 0x02, 0x00, 0x04, + 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x04, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, + 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x08, 0x08, 0x00, 0x00, 0x00, 0x04, 0x00, + // Entry C0 - FF + 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x02, 0x01, + 0x04, 0x08, 0x04, 0x00, 0x00, 0x00, 0x00, 0x04, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x04, 0x00, 0x05, 0x00, 0x00, 0x00, + 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 100 - 13F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, + 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x00, 0x04, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x08, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x01, 0x00, 0x05, 0x04, 0x00, + 0x00, 0x04, 0x00, 0x04, 0x04, 0x05, 0x00, 0x00, + // Entry 140 - 17F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, +} // Size: 382 bytes + +var paradigmLocales = [][3]uint16{ // 3 elements + 0: [3]uint16{0x139, 0x0, 0x7b}, + 1: [3]uint16{0x13e, 0x0, 0x1f}, + 2: [3]uint16{0x3c0, 0x41, 0xee}, +} // Size: 42 bytes + +type mutualIntelligibility struct { + want uint16 + have uint16 + distance uint8 + oneway bool +} +type scriptIntelligibility struct { + wantLang uint16 + haveLang uint16 + wantScript uint8 + haveScript uint8 + distance uint8 +} +type regionIntelligibility struct { + lang uint16 + script uint8 + group uint8 + distance uint8 +} + +// matchLang holds pairs of langIDs of base languages that are typically +// mutually intelligible. Each pair is associated with a confidence and +// whether the intelligibility goes one or both ways. +var matchLang = []mutualIntelligibility{ // 113 elements + 0: {want: 0x1d1, have: 0xb7, distance: 0x4, oneway: false}, + 1: {want: 0x407, have: 0xb7, distance: 0x4, oneway: false}, + 2: {want: 0x407, have: 0x1d1, distance: 0x4, oneway: false}, + 3: {want: 0x407, have: 0x432, distance: 0x4, oneway: false}, + 4: {want: 0x43a, have: 0x1, distance: 0x4, oneway: false}, + 5: {want: 0x1a3, have: 0x10d, distance: 0x4, oneway: true}, + 6: {want: 0x295, have: 0x10d, distance: 0x4, oneway: true}, + 7: {want: 0x101, have: 0x36f, distance: 0x8, oneway: false}, + 8: {want: 0x101, have: 0x347, distance: 0x8, oneway: false}, + 9: {want: 0x5, have: 0x3e2, distance: 0xa, oneway: true}, + 10: {want: 0xd, have: 0x139, distance: 0xa, oneway: true}, + 11: {want: 0x16, have: 0x367, distance: 0xa, oneway: true}, + 12: {want: 0x21, have: 0x139, distance: 0xa, oneway: true}, + 13: {want: 0x56, have: 0x13e, distance: 0xa, oneway: true}, + 14: {want: 0x58, have: 0x3e2, distance: 0xa, oneway: true}, + 15: {want: 0x71, have: 0x3e2, distance: 0xa, oneway: true}, + 16: {want: 0x75, have: 0x139, distance: 0xa, oneway: true}, + 17: {want: 0x82, have: 0x1be, distance: 0xa, oneway: true}, + 18: {want: 0xa5, have: 0x139, distance: 0xa, oneway: true}, + 19: {want: 0xb2, have: 0x15e, distance: 0xa, oneway: true}, + 20: {want: 0xdd, have: 0x153, distance: 0xa, oneway: true}, + 21: {want: 0xe5, have: 0x139, distance: 0xa, oneway: true}, + 22: {want: 0xe9, have: 0x3a, distance: 0xa, oneway: true}, + 23: {want: 0xf0, have: 0x15e, distance: 0xa, oneway: true}, + 24: {want: 0xf9, have: 0x15e, distance: 0xa, oneway: true}, + 25: {want: 0x100, have: 0x139, distance: 0xa, oneway: true}, + 26: {want: 0x130, have: 0x139, distance: 0xa, oneway: true}, + 27: {want: 0x13c, have: 0x139, distance: 0xa, oneway: true}, + 28: {want: 0x140, have: 0x151, distance: 0xa, oneway: true}, + 29: {want: 0x145, have: 0x13e, distance: 0xa, oneway: true}, + 30: {want: 0x158, have: 0x101, distance: 0xa, oneway: true}, + 31: {want: 0x16d, have: 0x367, distance: 0xa, oneway: true}, + 32: {want: 0x16e, have: 0x139, distance: 0xa, oneway: true}, + 33: {want: 0x16f, have: 0x139, distance: 0xa, oneway: true}, + 34: {want: 0x17e, have: 0x139, distance: 0xa, oneway: true}, + 35: {want: 0x190, have: 0x13e, distance: 0xa, oneway: true}, + 36: {want: 0x194, have: 0x13e, distance: 0xa, oneway: true}, + 37: {want: 0x1a4, have: 0x1be, distance: 0xa, oneway: true}, + 38: {want: 0x1b4, have: 0x139, distance: 0xa, oneway: true}, + 39: {want: 0x1b8, have: 0x139, distance: 0xa, oneway: true}, + 40: {want: 0x1d4, have: 0x15e, distance: 0xa, oneway: true}, + 41: {want: 0x1d7, have: 0x3e2, distance: 0xa, oneway: true}, + 42: {want: 0x1d9, have: 0x139, distance: 0xa, oneway: true}, + 43: {want: 0x1e7, have: 0x139, distance: 0xa, oneway: true}, + 44: {want: 0x1f8, have: 0x139, distance: 0xa, oneway: true}, + 45: {want: 0x20e, have: 0x1e1, distance: 0xa, oneway: true}, + 46: {want: 0x210, have: 0x139, distance: 0xa, oneway: true}, + 47: {want: 0x22d, have: 0x15e, distance: 0xa, oneway: true}, + 48: {want: 0x242, have: 0x3e2, distance: 0xa, oneway: true}, + 49: {want: 0x24a, have: 0x139, distance: 0xa, oneway: true}, + 50: {want: 0x251, have: 0x139, distance: 0xa, oneway: true}, + 51: {want: 0x265, have: 0x139, distance: 0xa, oneway: true}, + 52: {want: 0x274, have: 0x48a, distance: 0xa, oneway: true}, + 53: {want: 0x28a, have: 0x3e2, distance: 0xa, oneway: true}, + 54: {want: 0x28e, have: 0x1f9, distance: 0xa, oneway: true}, + 55: {want: 0x2a3, have: 0x139, distance: 0xa, oneway: true}, + 56: {want: 0x2b5, have: 0x15e, distance: 0xa, oneway: true}, + 57: {want: 0x2b8, have: 0x139, distance: 0xa, oneway: true}, + 58: {want: 0x2be, have: 0x139, distance: 0xa, oneway: true}, + 59: {want: 0x2c3, have: 0x15e, distance: 0xa, oneway: true}, + 60: {want: 0x2ed, have: 0x139, distance: 0xa, oneway: true}, + 61: {want: 0x2f1, have: 0x15e, distance: 0xa, oneway: true}, + 62: {want: 0x2fa, have: 0x139, distance: 0xa, oneway: true}, + 63: {want: 0x2ff, have: 0x7e, distance: 0xa, oneway: true}, + 64: {want: 0x304, have: 0x139, distance: 0xa, oneway: true}, + 65: {want: 0x30b, have: 0x3e2, distance: 0xa, oneway: true}, + 66: {want: 0x31b, have: 0x1be, distance: 0xa, oneway: true}, + 67: {want: 0x31f, have: 0x1e1, distance: 0xa, oneway: true}, + 68: {want: 0x320, have: 0x139, distance: 0xa, oneway: true}, + 69: {want: 0x331, have: 0x139, distance: 0xa, oneway: true}, + 70: {want: 0x351, have: 0x139, distance: 0xa, oneway: true}, + 71: {want: 0x36a, have: 0x347, distance: 0xa, oneway: false}, + 72: {want: 0x36a, have: 0x36f, distance: 0xa, oneway: true}, + 73: {want: 0x37a, have: 0x139, distance: 0xa, oneway: true}, + 74: {want: 0x387, have: 0x139, distance: 0xa, oneway: true}, + 75: {want: 0x389, have: 0x139, distance: 0xa, oneway: true}, + 76: {want: 0x38b, have: 0x15e, distance: 0xa, oneway: true}, + 77: {want: 0x390, have: 0x139, distance: 0xa, oneway: true}, + 78: {want: 0x395, have: 0x139, distance: 0xa, oneway: true}, + 79: {want: 0x39d, have: 0x139, distance: 0xa, oneway: true}, + 80: {want: 0x3a5, have: 0x139, distance: 0xa, oneway: true}, + 81: {want: 0x3be, have: 0x139, distance: 0xa, oneway: true}, + 82: {want: 0x3c4, have: 0x13e, distance: 0xa, oneway: true}, + 83: {want: 0x3d4, have: 0x10d, distance: 0xa, oneway: true}, + 84: {want: 0x3d9, have: 0x139, distance: 0xa, oneway: true}, + 85: {want: 0x3e5, have: 0x15e, distance: 0xa, oneway: true}, + 86: {want: 0x3e9, have: 0x1be, distance: 0xa, oneway: true}, + 87: {want: 0x3fa, have: 0x139, distance: 0xa, oneway: true}, + 88: {want: 0x40c, have: 0x139, distance: 0xa, oneway: true}, + 89: {want: 0x423, have: 0x139, distance: 0xa, oneway: true}, + 90: {want: 0x429, have: 0x139, distance: 0xa, oneway: true}, + 91: {want: 0x431, have: 0x139, distance: 0xa, oneway: true}, + 92: {want: 0x43b, have: 0x139, distance: 0xa, oneway: true}, + 93: {want: 0x43e, have: 0x1e1, distance: 0xa, oneway: true}, + 94: {want: 0x445, have: 0x139, distance: 0xa, oneway: true}, + 95: {want: 0x450, have: 0x139, distance: 0xa, oneway: true}, + 96: {want: 0x461, have: 0x139, distance: 0xa, oneway: true}, + 97: {want: 0x467, have: 0x3e2, distance: 0xa, oneway: true}, + 98: {want: 0x46f, have: 0x139, distance: 0xa, oneway: true}, + 99: {want: 0x476, have: 0x3e2, distance: 0xa, oneway: true}, + 100: {want: 0x3883, have: 0x139, distance: 0xa, oneway: true}, + 101: {want: 0x480, have: 0x139, distance: 0xa, oneway: true}, + 102: {want: 0x482, have: 0x139, distance: 0xa, oneway: true}, + 103: {want: 0x494, have: 0x3e2, distance: 0xa, oneway: true}, + 104: {want: 0x49d, have: 0x139, distance: 0xa, oneway: true}, + 105: {want: 0x4ac, have: 0x529, distance: 0xa, oneway: true}, + 106: {want: 0x4b4, have: 0x139, distance: 0xa, oneway: true}, + 107: {want: 0x4bc, have: 0x3e2, distance: 0xa, oneway: true}, + 108: {want: 0x4e5, have: 0x15e, distance: 0xa, oneway: true}, + 109: {want: 0x4f2, have: 0x139, distance: 0xa, oneway: true}, + 110: {want: 0x512, have: 0x139, distance: 0xa, oneway: true}, + 111: {want: 0x518, have: 0x139, distance: 0xa, oneway: true}, + 112: {want: 0x52f, have: 0x139, distance: 0xa, oneway: true}, +} // Size: 702 bytes + +// matchScript holds pairs of scriptIDs where readers of one script +// can typically also read the other. Each is associated with a confidence. +var matchScript = []scriptIntelligibility{ // 26 elements + 0: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x5a, haveScript: 0x20, distance: 0x5}, + 1: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x20, haveScript: 0x5a, distance: 0x5}, + 2: {wantLang: 0x58, haveLang: 0x3e2, wantScript: 0x5a, haveScript: 0x20, distance: 0xa}, + 3: {wantLang: 0xa5, haveLang: 0x139, wantScript: 0xe, haveScript: 0x5a, distance: 0xa}, + 4: {wantLang: 0x1d7, haveLang: 0x3e2, wantScript: 0x8, haveScript: 0x20, distance: 0xa}, + 5: {wantLang: 0x210, haveLang: 0x139, wantScript: 0x2e, haveScript: 0x5a, distance: 0xa}, + 6: {wantLang: 0x24a, haveLang: 0x139, wantScript: 0x4e, haveScript: 0x5a, distance: 0xa}, + 7: {wantLang: 0x251, haveLang: 0x139, wantScript: 0x52, haveScript: 0x5a, distance: 0xa}, + 8: {wantLang: 0x2b8, haveLang: 0x139, wantScript: 0x57, haveScript: 0x5a, distance: 0xa}, + 9: {wantLang: 0x304, haveLang: 0x139, wantScript: 0x6e, haveScript: 0x5a, distance: 0xa}, + 10: {wantLang: 0x331, haveLang: 0x139, wantScript: 0x75, haveScript: 0x5a, distance: 0xa}, + 11: {wantLang: 0x351, haveLang: 0x139, wantScript: 0x22, haveScript: 0x5a, distance: 0xa}, + 12: {wantLang: 0x395, haveLang: 0x139, wantScript: 0x81, haveScript: 0x5a, distance: 0xa}, + 13: {wantLang: 0x39d, haveLang: 0x139, wantScript: 0x36, haveScript: 0x5a, distance: 0xa}, + 14: {wantLang: 0x3be, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5a, distance: 0xa}, + 15: {wantLang: 0x3fa, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5a, distance: 0xa}, + 16: {wantLang: 0x40c, haveLang: 0x139, wantScript: 0xd4, haveScript: 0x5a, distance: 0xa}, + 17: {wantLang: 0x450, haveLang: 0x139, wantScript: 0xe3, haveScript: 0x5a, distance: 0xa}, + 18: {wantLang: 0x461, haveLang: 0x139, wantScript: 0xe6, haveScript: 0x5a, distance: 0xa}, + 19: {wantLang: 0x46f, haveLang: 0x139, wantScript: 0x2c, haveScript: 0x5a, distance: 0xa}, + 20: {wantLang: 0x476, haveLang: 0x3e2, wantScript: 0x5a, haveScript: 0x20, distance: 0xa}, + 21: {wantLang: 0x4b4, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5a, distance: 0xa}, + 22: {wantLang: 0x4bc, haveLang: 0x3e2, wantScript: 0x5a, haveScript: 0x20, distance: 0xa}, + 23: {wantLang: 0x512, haveLang: 0x139, wantScript: 0x3e, haveScript: 0x5a, distance: 0xa}, + 24: {wantLang: 0x529, haveLang: 0x529, wantScript: 0x3b, haveScript: 0x3c, distance: 0xf}, + 25: {wantLang: 0x529, haveLang: 0x529, wantScript: 0x3c, haveScript: 0x3b, distance: 0x13}, +} // Size: 232 bytes + +var matchRegion = []regionIntelligibility{ // 15 elements + 0: {lang: 0x3a, script: 0x0, group: 0x4, distance: 0x4}, + 1: {lang: 0x3a, script: 0x0, group: 0x84, distance: 0x4}, + 2: {lang: 0x139, script: 0x0, group: 0x1, distance: 0x4}, + 3: {lang: 0x139, script: 0x0, group: 0x81, distance: 0x4}, + 4: {lang: 0x13e, script: 0x0, group: 0x3, distance: 0x4}, + 5: {lang: 0x13e, script: 0x0, group: 0x83, distance: 0x4}, + 6: {lang: 0x3c0, script: 0x0, group: 0x3, distance: 0x4}, + 7: {lang: 0x3c0, script: 0x0, group: 0x83, distance: 0x4}, + 8: {lang: 0x529, script: 0x3c, group: 0x2, distance: 0x4}, + 9: {lang: 0x529, script: 0x3c, group: 0x82, distance: 0x4}, + 10: {lang: 0x3a, script: 0x0, group: 0x80, distance: 0x5}, + 11: {lang: 0x139, script: 0x0, group: 0x80, distance: 0x5}, + 12: {lang: 0x13e, script: 0x0, group: 0x80, distance: 0x5}, + 13: {lang: 0x3c0, script: 0x0, group: 0x80, distance: 0x5}, + 14: {lang: 0x529, script: 0x3c, group: 0x80, distance: 0x5}, +} // Size: 114 bytes + +// Total table size 1472 bytes (1KiB); checksum: F86C669 diff --git a/vendor/golang.org/x/text/language/tags.go b/vendor/golang.org/x/text/language/tags.go new file mode 100644 index 00000000..42ea7926 --- /dev/null +++ b/vendor/golang.org/x/text/language/tags.go @@ -0,0 +1,145 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import "golang.org/x/text/internal/language/compact" + +// TODO: Various sets of commonly use tags and regions. + +// MustParse is like Parse, but panics if the given BCP 47 tag cannot be parsed. +// It simplifies safe initialization of Tag values. +func MustParse(s string) Tag { + t, err := Parse(s) + if err != nil { + panic(err) + } + return t +} + +// MustParse is like Parse, but panics if the given BCP 47 tag cannot be parsed. +// It simplifies safe initialization of Tag values. +func (c CanonType) MustParse(s string) Tag { + t, err := c.Parse(s) + if err != nil { + panic(err) + } + return t +} + +// MustParseBase is like ParseBase, but panics if the given base cannot be parsed. +// It simplifies safe initialization of Base values. +func MustParseBase(s string) Base { + b, err := ParseBase(s) + if err != nil { + panic(err) + } + return b +} + +// MustParseScript is like ParseScript, but panics if the given script cannot be +// parsed. It simplifies safe initialization of Script values. +func MustParseScript(s string) Script { + scr, err := ParseScript(s) + if err != nil { + panic(err) + } + return scr +} + +// MustParseRegion is like ParseRegion, but panics if the given region cannot be +// parsed. It simplifies safe initialization of Region values. +func MustParseRegion(s string) Region { + r, err := ParseRegion(s) + if err != nil { + panic(err) + } + return r +} + +var ( + und = Tag{} + + Und Tag = Tag{} + + Afrikaans Tag = Tag(compact.Afrikaans) + Amharic Tag = Tag(compact.Amharic) + Arabic Tag = Tag(compact.Arabic) + ModernStandardArabic Tag = Tag(compact.ModernStandardArabic) + Azerbaijani Tag = Tag(compact.Azerbaijani) + Bulgarian Tag = Tag(compact.Bulgarian) + Bengali Tag = Tag(compact.Bengali) + Catalan Tag = Tag(compact.Catalan) + Czech Tag = Tag(compact.Czech) + Danish Tag = Tag(compact.Danish) + German Tag = Tag(compact.German) + Greek Tag = Tag(compact.Greek) + English Tag = Tag(compact.English) + AmericanEnglish Tag = Tag(compact.AmericanEnglish) + BritishEnglish Tag = Tag(compact.BritishEnglish) + Spanish Tag = Tag(compact.Spanish) + EuropeanSpanish Tag = Tag(compact.EuropeanSpanish) + LatinAmericanSpanish Tag = Tag(compact.LatinAmericanSpanish) + Estonian Tag = Tag(compact.Estonian) + Persian Tag = Tag(compact.Persian) + Finnish Tag = Tag(compact.Finnish) + Filipino Tag = Tag(compact.Filipino) + French Tag = Tag(compact.French) + CanadianFrench Tag = Tag(compact.CanadianFrench) + Gujarati Tag = Tag(compact.Gujarati) + Hebrew Tag = Tag(compact.Hebrew) + Hindi Tag = Tag(compact.Hindi) + Croatian Tag = Tag(compact.Croatian) + Hungarian Tag = Tag(compact.Hungarian) + Armenian Tag = Tag(compact.Armenian) + Indonesian Tag = Tag(compact.Indonesian) + Icelandic Tag = Tag(compact.Icelandic) + Italian Tag = Tag(compact.Italian) + Japanese Tag = Tag(compact.Japanese) + Georgian Tag = Tag(compact.Georgian) + Kazakh Tag = Tag(compact.Kazakh) + Khmer Tag = Tag(compact.Khmer) + Kannada Tag = Tag(compact.Kannada) + Korean Tag = Tag(compact.Korean) + Kirghiz Tag = Tag(compact.Kirghiz) + Lao Tag = Tag(compact.Lao) + Lithuanian Tag = Tag(compact.Lithuanian) + Latvian Tag = Tag(compact.Latvian) + Macedonian Tag = Tag(compact.Macedonian) + Malayalam Tag = Tag(compact.Malayalam) + Mongolian Tag = Tag(compact.Mongolian) + Marathi Tag = Tag(compact.Marathi) + Malay Tag = Tag(compact.Malay) + Burmese Tag = Tag(compact.Burmese) + Nepali Tag = Tag(compact.Nepali) + Dutch Tag = Tag(compact.Dutch) + Norwegian Tag = Tag(compact.Norwegian) + Punjabi Tag = Tag(compact.Punjabi) + Polish Tag = Tag(compact.Polish) + Portuguese Tag = Tag(compact.Portuguese) + BrazilianPortuguese Tag = Tag(compact.BrazilianPortuguese) + EuropeanPortuguese Tag = Tag(compact.EuropeanPortuguese) + Romanian Tag = Tag(compact.Romanian) + Russian Tag = Tag(compact.Russian) + Sinhala Tag = Tag(compact.Sinhala) + Slovak Tag = Tag(compact.Slovak) + Slovenian Tag = Tag(compact.Slovenian) + Albanian Tag = Tag(compact.Albanian) + Serbian Tag = Tag(compact.Serbian) + SerbianLatin Tag = Tag(compact.SerbianLatin) + Swedish Tag = Tag(compact.Swedish) + Swahili Tag = Tag(compact.Swahili) + Tamil Tag = Tag(compact.Tamil) + Telugu Tag = Tag(compact.Telugu) + Thai Tag = Tag(compact.Thai) + Turkish Tag = Tag(compact.Turkish) + Ukrainian Tag = Tag(compact.Ukrainian) + Urdu Tag = Tag(compact.Urdu) + Uzbek Tag = Tag(compact.Uzbek) + Vietnamese Tag = Tag(compact.Vietnamese) + Chinese Tag = Tag(compact.Chinese) + SimplifiedChinese Tag = Tag(compact.SimplifiedChinese) + TraditionalChinese Tag = Tag(compact.TraditionalChinese) + Zulu Tag = Tag(compact.Zulu) +) diff --git a/vendor/google.golang.org/protobuf/AUTHORS b/vendor/google.golang.org/protobuf/AUTHORS deleted file mode 100644 index 2b00ddba..00000000 --- a/vendor/google.golang.org/protobuf/AUTHORS +++ /dev/null @@ -1,3 +0,0 @@ -# This source code refers to The Go Authors for copyright purposes. -# The master list of authors is in the main Go distribution, -# visible at https://tip.golang.org/AUTHORS. diff --git a/vendor/google.golang.org/protobuf/CONTRIBUTORS b/vendor/google.golang.org/protobuf/CONTRIBUTORS deleted file mode 100644 index 1fbd3e97..00000000 --- a/vendor/google.golang.org/protobuf/CONTRIBUTORS +++ /dev/null @@ -1,3 +0,0 @@ -# This source code was written by the Go contributors. -# The master list of contributors is in the main Go distribution, -# visible at https://tip.golang.org/CONTRIBUTORS. diff --git a/vendor/google.golang.org/protobuf/encoding/protojson/decode.go b/vendor/google.golang.org/protobuf/encoding/protojson/decode.go index 07da5db3..5f28148d 100644 --- a/vendor/google.golang.org/protobuf/encoding/protojson/decode.go +++ b/vendor/google.golang.org/protobuf/encoding/protojson/decode.go @@ -19,7 +19,7 @@ import ( "google.golang.org/protobuf/internal/pragma" "google.golang.org/protobuf/internal/set" "google.golang.org/protobuf/proto" - pref "google.golang.org/protobuf/reflect/protoreflect" + "google.golang.org/protobuf/reflect/protoreflect" "google.golang.org/protobuf/reflect/protoregistry" ) @@ -113,7 +113,7 @@ func (d decoder) syntaxError(pos int, f string, x ...interface{}) error { } // unmarshalMessage unmarshals a message into the given protoreflect.Message. -func (d decoder) unmarshalMessage(m pref.Message, skipTypeURL bool) error { +func (d decoder) unmarshalMessage(m protoreflect.Message, skipTypeURL bool) error { if unmarshal := wellKnownTypeUnmarshaler(m.Descriptor().FullName()); unmarshal != nil { return unmarshal(d, m) } @@ -159,10 +159,10 @@ func (d decoder) unmarshalMessage(m pref.Message, skipTypeURL bool) error { } // Get the FieldDescriptor. - var fd pref.FieldDescriptor + var fd protoreflect.FieldDescriptor if strings.HasPrefix(name, "[") && strings.HasSuffix(name, "]") { // Only extension names are in [name] format. - extName := pref.FullName(name[1 : len(name)-1]) + extName := protoreflect.FullName(name[1 : len(name)-1]) extType, err := d.opts.Resolver.FindExtensionByName(extName) if err != nil && err != protoregistry.NotFound { return d.newError(tok.Pos(), "unable to resolve %s: %v", tok.RawString(), err) @@ -240,23 +240,23 @@ func (d decoder) unmarshalMessage(m pref.Message, skipTypeURL bool) error { } } -func isKnownValue(fd pref.FieldDescriptor) bool { +func isKnownValue(fd protoreflect.FieldDescriptor) bool { md := fd.Message() return md != nil && md.FullName() == genid.Value_message_fullname } -func isNullValue(fd pref.FieldDescriptor) bool { +func isNullValue(fd protoreflect.FieldDescriptor) bool { ed := fd.Enum() return ed != nil && ed.FullName() == genid.NullValue_enum_fullname } // unmarshalSingular unmarshals to the non-repeated field specified // by the given FieldDescriptor. -func (d decoder) unmarshalSingular(m pref.Message, fd pref.FieldDescriptor) error { - var val pref.Value +func (d decoder) unmarshalSingular(m protoreflect.Message, fd protoreflect.FieldDescriptor) error { + var val protoreflect.Value var err error switch fd.Kind() { - case pref.MessageKind, pref.GroupKind: + case protoreflect.MessageKind, protoreflect.GroupKind: val = m.NewField(fd) err = d.unmarshalMessage(val.Message(), false) default: @@ -272,63 +272,63 @@ func (d decoder) unmarshalSingular(m pref.Message, fd pref.FieldDescriptor) erro // unmarshalScalar unmarshals to a scalar/enum protoreflect.Value specified by // the given FieldDescriptor. -func (d decoder) unmarshalScalar(fd pref.FieldDescriptor) (pref.Value, error) { +func (d decoder) unmarshalScalar(fd protoreflect.FieldDescriptor) (protoreflect.Value, error) { const b32 int = 32 const b64 int = 64 tok, err := d.Read() if err != nil { - return pref.Value{}, err + return protoreflect.Value{}, err } kind := fd.Kind() switch kind { - case pref.BoolKind: + case protoreflect.BoolKind: if tok.Kind() == json.Bool { - return pref.ValueOfBool(tok.Bool()), nil + return protoreflect.ValueOfBool(tok.Bool()), nil } - case pref.Int32Kind, pref.Sint32Kind, pref.Sfixed32Kind: + case protoreflect.Int32Kind, protoreflect.Sint32Kind, protoreflect.Sfixed32Kind: if v, ok := unmarshalInt(tok, b32); ok { return v, nil } - case pref.Int64Kind, pref.Sint64Kind, pref.Sfixed64Kind: + case protoreflect.Int64Kind, protoreflect.Sint64Kind, protoreflect.Sfixed64Kind: if v, ok := unmarshalInt(tok, b64); ok { return v, nil } - case pref.Uint32Kind, pref.Fixed32Kind: + case protoreflect.Uint32Kind, protoreflect.Fixed32Kind: if v, ok := unmarshalUint(tok, b32); ok { return v, nil } - case pref.Uint64Kind, pref.Fixed64Kind: + case protoreflect.Uint64Kind, protoreflect.Fixed64Kind: if v, ok := unmarshalUint(tok, b64); ok { return v, nil } - case pref.FloatKind: + case protoreflect.FloatKind: if v, ok := unmarshalFloat(tok, b32); ok { return v, nil } - case pref.DoubleKind: + case protoreflect.DoubleKind: if v, ok := unmarshalFloat(tok, b64); ok { return v, nil } - case pref.StringKind: + case protoreflect.StringKind: if tok.Kind() == json.String { - return pref.ValueOfString(tok.ParsedString()), nil + return protoreflect.ValueOfString(tok.ParsedString()), nil } - case pref.BytesKind: + case protoreflect.BytesKind: if v, ok := unmarshalBytes(tok); ok { return v, nil } - case pref.EnumKind: + case protoreflect.EnumKind: if v, ok := unmarshalEnum(tok, fd); ok { return v, nil } @@ -337,10 +337,10 @@ func (d decoder) unmarshalScalar(fd pref.FieldDescriptor) (pref.Value, error) { panic(fmt.Sprintf("unmarshalScalar: invalid scalar kind %v", kind)) } - return pref.Value{}, d.newError(tok.Pos(), "invalid value for %v type: %v", kind, tok.RawString()) + return protoreflect.Value{}, d.newError(tok.Pos(), "invalid value for %v type: %v", kind, tok.RawString()) } -func unmarshalInt(tok json.Token, bitSize int) (pref.Value, bool) { +func unmarshalInt(tok json.Token, bitSize int) (protoreflect.Value, bool) { switch tok.Kind() { case json.Number: return getInt(tok, bitSize) @@ -349,30 +349,30 @@ func unmarshalInt(tok json.Token, bitSize int) (pref.Value, bool) { // Decode number from string. s := strings.TrimSpace(tok.ParsedString()) if len(s) != len(tok.ParsedString()) { - return pref.Value{}, false + return protoreflect.Value{}, false } dec := json.NewDecoder([]byte(s)) tok, err := dec.Read() if err != nil { - return pref.Value{}, false + return protoreflect.Value{}, false } return getInt(tok, bitSize) } - return pref.Value{}, false + return protoreflect.Value{}, false } -func getInt(tok json.Token, bitSize int) (pref.Value, bool) { +func getInt(tok json.Token, bitSize int) (protoreflect.Value, bool) { n, ok := tok.Int(bitSize) if !ok { - return pref.Value{}, false + return protoreflect.Value{}, false } if bitSize == 32 { - return pref.ValueOfInt32(int32(n)), true + return protoreflect.ValueOfInt32(int32(n)), true } - return pref.ValueOfInt64(n), true + return protoreflect.ValueOfInt64(n), true } -func unmarshalUint(tok json.Token, bitSize int) (pref.Value, bool) { +func unmarshalUint(tok json.Token, bitSize int) (protoreflect.Value, bool) { switch tok.Kind() { case json.Number: return getUint(tok, bitSize) @@ -381,30 +381,30 @@ func unmarshalUint(tok json.Token, bitSize int) (pref.Value, bool) { // Decode number from string. s := strings.TrimSpace(tok.ParsedString()) if len(s) != len(tok.ParsedString()) { - return pref.Value{}, false + return protoreflect.Value{}, false } dec := json.NewDecoder([]byte(s)) tok, err := dec.Read() if err != nil { - return pref.Value{}, false + return protoreflect.Value{}, false } return getUint(tok, bitSize) } - return pref.Value{}, false + return protoreflect.Value{}, false } -func getUint(tok json.Token, bitSize int) (pref.Value, bool) { +func getUint(tok json.Token, bitSize int) (protoreflect.Value, bool) { n, ok := tok.Uint(bitSize) if !ok { - return pref.Value{}, false + return protoreflect.Value{}, false } if bitSize == 32 { - return pref.ValueOfUint32(uint32(n)), true + return protoreflect.ValueOfUint32(uint32(n)), true } - return pref.ValueOfUint64(n), true + return protoreflect.ValueOfUint64(n), true } -func unmarshalFloat(tok json.Token, bitSize int) (pref.Value, bool) { +func unmarshalFloat(tok json.Token, bitSize int) (protoreflect.Value, bool) { switch tok.Kind() { case json.Number: return getFloat(tok, bitSize) @@ -414,49 +414,49 @@ func unmarshalFloat(tok json.Token, bitSize int) (pref.Value, bool) { switch s { case "NaN": if bitSize == 32 { - return pref.ValueOfFloat32(float32(math.NaN())), true + return protoreflect.ValueOfFloat32(float32(math.NaN())), true } - return pref.ValueOfFloat64(math.NaN()), true + return protoreflect.ValueOfFloat64(math.NaN()), true case "Infinity": if bitSize == 32 { - return pref.ValueOfFloat32(float32(math.Inf(+1))), true + return protoreflect.ValueOfFloat32(float32(math.Inf(+1))), true } - return pref.ValueOfFloat64(math.Inf(+1)), true + return protoreflect.ValueOfFloat64(math.Inf(+1)), true case "-Infinity": if bitSize == 32 { - return pref.ValueOfFloat32(float32(math.Inf(-1))), true + return protoreflect.ValueOfFloat32(float32(math.Inf(-1))), true } - return pref.ValueOfFloat64(math.Inf(-1)), true + return protoreflect.ValueOfFloat64(math.Inf(-1)), true } // Decode number from string. if len(s) != len(strings.TrimSpace(s)) { - return pref.Value{}, false + return protoreflect.Value{}, false } dec := json.NewDecoder([]byte(s)) tok, err := dec.Read() if err != nil { - return pref.Value{}, false + return protoreflect.Value{}, false } return getFloat(tok, bitSize) } - return pref.Value{}, false + return protoreflect.Value{}, false } -func getFloat(tok json.Token, bitSize int) (pref.Value, bool) { +func getFloat(tok json.Token, bitSize int) (protoreflect.Value, bool) { n, ok := tok.Float(bitSize) if !ok { - return pref.Value{}, false + return protoreflect.Value{}, false } if bitSize == 32 { - return pref.ValueOfFloat32(float32(n)), true + return protoreflect.ValueOfFloat32(float32(n)), true } - return pref.ValueOfFloat64(n), true + return protoreflect.ValueOfFloat64(n), true } -func unmarshalBytes(tok json.Token) (pref.Value, bool) { +func unmarshalBytes(tok json.Token) (protoreflect.Value, bool) { if tok.Kind() != json.String { - return pref.Value{}, false + return protoreflect.Value{}, false } s := tok.ParsedString() @@ -469,36 +469,36 @@ func unmarshalBytes(tok json.Token) (pref.Value, bool) { } b, err := enc.DecodeString(s) if err != nil { - return pref.Value{}, false + return protoreflect.Value{}, false } - return pref.ValueOfBytes(b), true + return protoreflect.ValueOfBytes(b), true } -func unmarshalEnum(tok json.Token, fd pref.FieldDescriptor) (pref.Value, bool) { +func unmarshalEnum(tok json.Token, fd protoreflect.FieldDescriptor) (protoreflect.Value, bool) { switch tok.Kind() { case json.String: // Lookup EnumNumber based on name. s := tok.ParsedString() - if enumVal := fd.Enum().Values().ByName(pref.Name(s)); enumVal != nil { - return pref.ValueOfEnum(enumVal.Number()), true + if enumVal := fd.Enum().Values().ByName(protoreflect.Name(s)); enumVal != nil { + return protoreflect.ValueOfEnum(enumVal.Number()), true } case json.Number: if n, ok := tok.Int(32); ok { - return pref.ValueOfEnum(pref.EnumNumber(n)), true + return protoreflect.ValueOfEnum(protoreflect.EnumNumber(n)), true } case json.Null: // This is only valid for google.protobuf.NullValue. if isNullValue(fd) { - return pref.ValueOfEnum(0), true + return protoreflect.ValueOfEnum(0), true } } - return pref.Value{}, false + return protoreflect.Value{}, false } -func (d decoder) unmarshalList(list pref.List, fd pref.FieldDescriptor) error { +func (d decoder) unmarshalList(list protoreflect.List, fd protoreflect.FieldDescriptor) error { tok, err := d.Read() if err != nil { return err @@ -508,7 +508,7 @@ func (d decoder) unmarshalList(list pref.List, fd pref.FieldDescriptor) error { } switch fd.Kind() { - case pref.MessageKind, pref.GroupKind: + case protoreflect.MessageKind, protoreflect.GroupKind: for { tok, err := d.Peek() if err != nil { @@ -549,7 +549,7 @@ func (d decoder) unmarshalList(list pref.List, fd pref.FieldDescriptor) error { return nil } -func (d decoder) unmarshalMap(mmap pref.Map, fd pref.FieldDescriptor) error { +func (d decoder) unmarshalMap(mmap protoreflect.Map, fd protoreflect.FieldDescriptor) error { tok, err := d.Read() if err != nil { return err @@ -561,18 +561,18 @@ func (d decoder) unmarshalMap(mmap pref.Map, fd pref.FieldDescriptor) error { // Determine ahead whether map entry is a scalar type or a message type in // order to call the appropriate unmarshalMapValue func inside the for loop // below. - var unmarshalMapValue func() (pref.Value, error) + var unmarshalMapValue func() (protoreflect.Value, error) switch fd.MapValue().Kind() { - case pref.MessageKind, pref.GroupKind: - unmarshalMapValue = func() (pref.Value, error) { + case protoreflect.MessageKind, protoreflect.GroupKind: + unmarshalMapValue = func() (protoreflect.Value, error) { val := mmap.NewValue() if err := d.unmarshalMessage(val.Message(), false); err != nil { - return pref.Value{}, err + return protoreflect.Value{}, err } return val, nil } default: - unmarshalMapValue = func() (pref.Value, error) { + unmarshalMapValue = func() (protoreflect.Value, error) { return d.unmarshalScalar(fd.MapValue()) } } @@ -618,7 +618,7 @@ Loop: // unmarshalMapKey converts given token of Name kind into a protoreflect.MapKey. // A map key type is any integral or string type. -func (d decoder) unmarshalMapKey(tok json.Token, fd pref.FieldDescriptor) (pref.MapKey, error) { +func (d decoder) unmarshalMapKey(tok json.Token, fd protoreflect.FieldDescriptor) (protoreflect.MapKey, error) { const b32 = 32 const b64 = 64 const base10 = 10 @@ -626,40 +626,40 @@ func (d decoder) unmarshalMapKey(tok json.Token, fd pref.FieldDescriptor) (pref. name := tok.Name() kind := fd.Kind() switch kind { - case pref.StringKind: - return pref.ValueOfString(name).MapKey(), nil + case protoreflect.StringKind: + return protoreflect.ValueOfString(name).MapKey(), nil - case pref.BoolKind: + case protoreflect.BoolKind: switch name { case "true": - return pref.ValueOfBool(true).MapKey(), nil + return protoreflect.ValueOfBool(true).MapKey(), nil case "false": - return pref.ValueOfBool(false).MapKey(), nil + return protoreflect.ValueOfBool(false).MapKey(), nil } - case pref.Int32Kind, pref.Sint32Kind, pref.Sfixed32Kind: + case protoreflect.Int32Kind, protoreflect.Sint32Kind, protoreflect.Sfixed32Kind: if n, err := strconv.ParseInt(name, base10, b32); err == nil { - return pref.ValueOfInt32(int32(n)).MapKey(), nil + return protoreflect.ValueOfInt32(int32(n)).MapKey(), nil } - case pref.Int64Kind, pref.Sint64Kind, pref.Sfixed64Kind: + case protoreflect.Int64Kind, protoreflect.Sint64Kind, protoreflect.Sfixed64Kind: if n, err := strconv.ParseInt(name, base10, b64); err == nil { - return pref.ValueOfInt64(int64(n)).MapKey(), nil + return protoreflect.ValueOfInt64(int64(n)).MapKey(), nil } - case pref.Uint32Kind, pref.Fixed32Kind: + case protoreflect.Uint32Kind, protoreflect.Fixed32Kind: if n, err := strconv.ParseUint(name, base10, b32); err == nil { - return pref.ValueOfUint32(uint32(n)).MapKey(), nil + return protoreflect.ValueOfUint32(uint32(n)).MapKey(), nil } - case pref.Uint64Kind, pref.Fixed64Kind: + case protoreflect.Uint64Kind, protoreflect.Fixed64Kind: if n, err := strconv.ParseUint(name, base10, b64); err == nil { - return pref.ValueOfUint64(uint64(n)).MapKey(), nil + return protoreflect.ValueOfUint64(uint64(n)).MapKey(), nil } default: panic(fmt.Sprintf("invalid kind for map key: %v", kind)) } - return pref.MapKey{}, d.newError(tok.Pos(), "invalid value for %v key: %s", kind, tok.RawString()) + return protoreflect.MapKey{}, d.newError(tok.Pos(), "invalid value for %v key: %s", kind, tok.RawString()) } diff --git a/vendor/google.golang.org/protobuf/encoding/protojson/encode.go b/vendor/google.golang.org/protobuf/encoding/protojson/encode.go index ba971f07..d09d22e1 100644 --- a/vendor/google.golang.org/protobuf/encoding/protojson/encode.go +++ b/vendor/google.golang.org/protobuf/encoding/protojson/encode.go @@ -18,7 +18,6 @@ import ( "google.golang.org/protobuf/internal/pragma" "google.golang.org/protobuf/proto" "google.golang.org/protobuf/reflect/protoreflect" - pref "google.golang.org/protobuf/reflect/protoreflect" "google.golang.org/protobuf/reflect/protoregistry" ) @@ -164,8 +163,8 @@ type typeURLFieldRanger struct { typeURL string } -func (m typeURLFieldRanger) Range(f func(pref.FieldDescriptor, pref.Value) bool) { - if !f(typeFieldDesc, pref.ValueOfString(m.typeURL)) { +func (m typeURLFieldRanger) Range(f func(protoreflect.FieldDescriptor, protoreflect.Value) bool) { + if !f(typeFieldDesc, protoreflect.ValueOfString(m.typeURL)) { return } m.FieldRanger.Range(f) @@ -173,9 +172,9 @@ func (m typeURLFieldRanger) Range(f func(pref.FieldDescriptor, pref.Value) bool) // unpopulatedFieldRanger wraps a protoreflect.Message and modifies its Range // method to additionally iterate over unpopulated fields. -type unpopulatedFieldRanger struct{ pref.Message } +type unpopulatedFieldRanger struct{ protoreflect.Message } -func (m unpopulatedFieldRanger) Range(f func(pref.FieldDescriptor, pref.Value) bool) { +func (m unpopulatedFieldRanger) Range(f func(protoreflect.FieldDescriptor, protoreflect.Value) bool) { fds := m.Descriptor().Fields() for i := 0; i < fds.Len(); i++ { fd := fds.Get(i) @@ -184,10 +183,10 @@ func (m unpopulatedFieldRanger) Range(f func(pref.FieldDescriptor, pref.Value) b } v := m.Get(fd) - isProto2Scalar := fd.Syntax() == pref.Proto2 && fd.Default().IsValid() - isSingularMessage := fd.Cardinality() != pref.Repeated && fd.Message() != nil + isProto2Scalar := fd.Syntax() == protoreflect.Proto2 && fd.Default().IsValid() + isSingularMessage := fd.Cardinality() != protoreflect.Repeated && fd.Message() != nil if isProto2Scalar || isSingularMessage { - v = pref.Value{} // use invalid value to emit null + v = protoreflect.Value{} // use invalid value to emit null } if !f(fd, v) { return @@ -199,7 +198,7 @@ func (m unpopulatedFieldRanger) Range(f func(pref.FieldDescriptor, pref.Value) b // marshalMessage marshals the fields in the given protoreflect.Message. // If the typeURL is non-empty, then a synthetic "@type" field is injected // containing the URL as the value. -func (e encoder) marshalMessage(m pref.Message, typeURL string) error { +func (e encoder) marshalMessage(m protoreflect.Message, typeURL string) error { if !flags.ProtoLegacy && messageset.IsMessageSet(m.Descriptor()) { return errors.New("no support for proto1 MessageSets") } @@ -220,7 +219,7 @@ func (e encoder) marshalMessage(m pref.Message, typeURL string) error { } var err error - order.RangeFields(fields, order.IndexNameFieldOrder, func(fd pref.FieldDescriptor, v pref.Value) bool { + order.RangeFields(fields, order.IndexNameFieldOrder, func(fd protoreflect.FieldDescriptor, v protoreflect.Value) bool { name := fd.JSONName() if e.opts.UseProtoNames { name = fd.TextName() @@ -238,7 +237,7 @@ func (e encoder) marshalMessage(m pref.Message, typeURL string) error { } // marshalValue marshals the given protoreflect.Value. -func (e encoder) marshalValue(val pref.Value, fd pref.FieldDescriptor) error { +func (e encoder) marshalValue(val protoreflect.Value, fd protoreflect.FieldDescriptor) error { switch { case fd.IsList(): return e.marshalList(val.List(), fd) @@ -251,44 +250,44 @@ func (e encoder) marshalValue(val pref.Value, fd pref.FieldDescriptor) error { // marshalSingular marshals the given non-repeated field value. This includes // all scalar types, enums, messages, and groups. -func (e encoder) marshalSingular(val pref.Value, fd pref.FieldDescriptor) error { +func (e encoder) marshalSingular(val protoreflect.Value, fd protoreflect.FieldDescriptor) error { if !val.IsValid() { e.WriteNull() return nil } switch kind := fd.Kind(); kind { - case pref.BoolKind: + case protoreflect.BoolKind: e.WriteBool(val.Bool()) - case pref.StringKind: + case protoreflect.StringKind: if e.WriteString(val.String()) != nil { return errors.InvalidUTF8(string(fd.FullName())) } - case pref.Int32Kind, pref.Sint32Kind, pref.Sfixed32Kind: + case protoreflect.Int32Kind, protoreflect.Sint32Kind, protoreflect.Sfixed32Kind: e.WriteInt(val.Int()) - case pref.Uint32Kind, pref.Fixed32Kind: + case protoreflect.Uint32Kind, protoreflect.Fixed32Kind: e.WriteUint(val.Uint()) - case pref.Int64Kind, pref.Sint64Kind, pref.Uint64Kind, - pref.Sfixed64Kind, pref.Fixed64Kind: + case protoreflect.Int64Kind, protoreflect.Sint64Kind, protoreflect.Uint64Kind, + protoreflect.Sfixed64Kind, protoreflect.Fixed64Kind: // 64-bit integers are written out as JSON string. e.WriteString(val.String()) - case pref.FloatKind: + case protoreflect.FloatKind: // Encoder.WriteFloat handles the special numbers NaN and infinites. e.WriteFloat(val.Float(), 32) - case pref.DoubleKind: + case protoreflect.DoubleKind: // Encoder.WriteFloat handles the special numbers NaN and infinites. e.WriteFloat(val.Float(), 64) - case pref.BytesKind: + case protoreflect.BytesKind: e.WriteString(base64.StdEncoding.EncodeToString(val.Bytes())) - case pref.EnumKind: + case protoreflect.EnumKind: if fd.Enum().FullName() == genid.NullValue_enum_fullname { e.WriteNull() } else { @@ -300,7 +299,7 @@ func (e encoder) marshalSingular(val pref.Value, fd pref.FieldDescriptor) error } } - case pref.MessageKind, pref.GroupKind: + case protoreflect.MessageKind, protoreflect.GroupKind: if err := e.marshalMessage(val.Message(), ""); err != nil { return err } @@ -312,7 +311,7 @@ func (e encoder) marshalSingular(val pref.Value, fd pref.FieldDescriptor) error } // marshalList marshals the given protoreflect.List. -func (e encoder) marshalList(list pref.List, fd pref.FieldDescriptor) error { +func (e encoder) marshalList(list protoreflect.List, fd protoreflect.FieldDescriptor) error { e.StartArray() defer e.EndArray() @@ -326,12 +325,12 @@ func (e encoder) marshalList(list pref.List, fd pref.FieldDescriptor) error { } // marshalMap marshals given protoreflect.Map. -func (e encoder) marshalMap(mmap pref.Map, fd pref.FieldDescriptor) error { +func (e encoder) marshalMap(mmap protoreflect.Map, fd protoreflect.FieldDescriptor) error { e.StartObject() defer e.EndObject() var err error - order.RangeEntries(mmap, order.GenericKeyOrder, func(k pref.MapKey, v pref.Value) bool { + order.RangeEntries(mmap, order.GenericKeyOrder, func(k protoreflect.MapKey, v protoreflect.Value) bool { if err = e.WriteName(k.String()); err != nil { return false } diff --git a/vendor/google.golang.org/protobuf/encoding/protojson/well_known_types.go b/vendor/google.golang.org/protobuf/encoding/protojson/well_known_types.go index 72924a90..c85f8469 100644 --- a/vendor/google.golang.org/protobuf/encoding/protojson/well_known_types.go +++ b/vendor/google.golang.org/protobuf/encoding/protojson/well_known_types.go @@ -17,14 +17,14 @@ import ( "google.golang.org/protobuf/internal/genid" "google.golang.org/protobuf/internal/strs" "google.golang.org/protobuf/proto" - pref "google.golang.org/protobuf/reflect/protoreflect" + "google.golang.org/protobuf/reflect/protoreflect" ) -type marshalFunc func(encoder, pref.Message) error +type marshalFunc func(encoder, protoreflect.Message) error // wellKnownTypeMarshaler returns a marshal function if the message type // has specialized serialization behavior. It returns nil otherwise. -func wellKnownTypeMarshaler(name pref.FullName) marshalFunc { +func wellKnownTypeMarshaler(name protoreflect.FullName) marshalFunc { if name.Parent() == genid.GoogleProtobuf_package { switch name.Name() { case genid.Any_message_name: @@ -58,11 +58,11 @@ func wellKnownTypeMarshaler(name pref.FullName) marshalFunc { return nil } -type unmarshalFunc func(decoder, pref.Message) error +type unmarshalFunc func(decoder, protoreflect.Message) error // wellKnownTypeUnmarshaler returns a unmarshal function if the message type // has specialized serialization behavior. It returns nil otherwise. -func wellKnownTypeUnmarshaler(name pref.FullName) unmarshalFunc { +func wellKnownTypeUnmarshaler(name protoreflect.FullName) unmarshalFunc { if name.Parent() == genid.GoogleProtobuf_package { switch name.Name() { case genid.Any_message_name: @@ -102,7 +102,7 @@ func wellKnownTypeUnmarshaler(name pref.FullName) unmarshalFunc { // custom JSON representation, that representation will be embedded adding a // field `value` which holds the custom JSON in addition to the `@type` field. -func (e encoder) marshalAny(m pref.Message) error { +func (e encoder) marshalAny(m protoreflect.Message) error { fds := m.Descriptor().Fields() fdType := fds.ByNumber(genid.Any_TypeUrl_field_number) fdValue := fds.ByNumber(genid.Any_Value_field_number) @@ -163,7 +163,7 @@ func (e encoder) marshalAny(m pref.Message) error { return nil } -func (d decoder) unmarshalAny(m pref.Message) error { +func (d decoder) unmarshalAny(m protoreflect.Message) error { // Peek to check for json.ObjectOpen to avoid advancing a read. start, err := d.Peek() if err != nil { @@ -233,8 +233,8 @@ func (d decoder) unmarshalAny(m pref.Message) error { fdType := fds.ByNumber(genid.Any_TypeUrl_field_number) fdValue := fds.ByNumber(genid.Any_Value_field_number) - m.Set(fdType, pref.ValueOfString(typeURL)) - m.Set(fdValue, pref.ValueOfBytes(b)) + m.Set(fdType, protoreflect.ValueOfString(typeURL)) + m.Set(fdValue, protoreflect.ValueOfBytes(b)) return nil } @@ -354,7 +354,7 @@ func (d decoder) skipJSONValue() error { // unmarshalAnyValue unmarshals the given custom-type message from the JSON // object's "value" field. -func (d decoder) unmarshalAnyValue(unmarshal unmarshalFunc, m pref.Message) error { +func (d decoder) unmarshalAnyValue(unmarshal unmarshalFunc, m protoreflect.Message) error { // Skip ObjectOpen, and start reading the fields. d.Read() @@ -402,13 +402,13 @@ func (d decoder) unmarshalAnyValue(unmarshal unmarshalFunc, m pref.Message) erro // Wrapper types are encoded as JSON primitives like string, number or boolean. -func (e encoder) marshalWrapperType(m pref.Message) error { +func (e encoder) marshalWrapperType(m protoreflect.Message) error { fd := m.Descriptor().Fields().ByNumber(genid.WrapperValue_Value_field_number) val := m.Get(fd) return e.marshalSingular(val, fd) } -func (d decoder) unmarshalWrapperType(m pref.Message) error { +func (d decoder) unmarshalWrapperType(m protoreflect.Message) error { fd := m.Descriptor().Fields().ByNumber(genid.WrapperValue_Value_field_number) val, err := d.unmarshalScalar(fd) if err != nil { @@ -420,13 +420,13 @@ func (d decoder) unmarshalWrapperType(m pref.Message) error { // The JSON representation for Empty is an empty JSON object. -func (e encoder) marshalEmpty(pref.Message) error { +func (e encoder) marshalEmpty(protoreflect.Message) error { e.StartObject() e.EndObject() return nil } -func (d decoder) unmarshalEmpty(pref.Message) error { +func (d decoder) unmarshalEmpty(protoreflect.Message) error { tok, err := d.Read() if err != nil { return err @@ -462,12 +462,12 @@ func (d decoder) unmarshalEmpty(pref.Message) error { // The JSON representation for Struct is a JSON object that contains the encoded // Struct.fields map and follows the serialization rules for a map. -func (e encoder) marshalStruct(m pref.Message) error { +func (e encoder) marshalStruct(m protoreflect.Message) error { fd := m.Descriptor().Fields().ByNumber(genid.Struct_Fields_field_number) return e.marshalMap(m.Get(fd).Map(), fd) } -func (d decoder) unmarshalStruct(m pref.Message) error { +func (d decoder) unmarshalStruct(m protoreflect.Message) error { fd := m.Descriptor().Fields().ByNumber(genid.Struct_Fields_field_number) return d.unmarshalMap(m.Mutable(fd).Map(), fd) } @@ -476,12 +476,12 @@ func (d decoder) unmarshalStruct(m pref.Message) error { // ListValue.values repeated field and follows the serialization rules for a // repeated field. -func (e encoder) marshalListValue(m pref.Message) error { +func (e encoder) marshalListValue(m protoreflect.Message) error { fd := m.Descriptor().Fields().ByNumber(genid.ListValue_Values_field_number) return e.marshalList(m.Get(fd).List(), fd) } -func (d decoder) unmarshalListValue(m pref.Message) error { +func (d decoder) unmarshalListValue(m protoreflect.Message) error { fd := m.Descriptor().Fields().ByNumber(genid.ListValue_Values_field_number) return d.unmarshalList(m.Mutable(fd).List(), fd) } @@ -490,7 +490,7 @@ func (d decoder) unmarshalListValue(m pref.Message) error { // set. Each of the field in the oneof has its own custom serialization rule. A // Value message needs to be a oneof field set, else it is an error. -func (e encoder) marshalKnownValue(m pref.Message) error { +func (e encoder) marshalKnownValue(m protoreflect.Message) error { od := m.Descriptor().Oneofs().ByName(genid.Value_Kind_oneof_name) fd := m.WhichOneof(od) if fd == nil { @@ -504,19 +504,19 @@ func (e encoder) marshalKnownValue(m pref.Message) error { return e.marshalSingular(m.Get(fd), fd) } -func (d decoder) unmarshalKnownValue(m pref.Message) error { +func (d decoder) unmarshalKnownValue(m protoreflect.Message) error { tok, err := d.Peek() if err != nil { return err } - var fd pref.FieldDescriptor - var val pref.Value + var fd protoreflect.FieldDescriptor + var val protoreflect.Value switch tok.Kind() { case json.Null: d.Read() fd = m.Descriptor().Fields().ByNumber(genid.Value_NullValue_field_number) - val = pref.ValueOfEnum(0) + val = protoreflect.ValueOfEnum(0) case json.Bool: tok, err := d.Read() @@ -524,7 +524,7 @@ func (d decoder) unmarshalKnownValue(m pref.Message) error { return err } fd = m.Descriptor().Fields().ByNumber(genid.Value_BoolValue_field_number) - val = pref.ValueOfBool(tok.Bool()) + val = protoreflect.ValueOfBool(tok.Bool()) case json.Number: tok, err := d.Read() @@ -550,7 +550,7 @@ func (d decoder) unmarshalKnownValue(m pref.Message) error { return err } fd = m.Descriptor().Fields().ByNumber(genid.Value_StringValue_field_number) - val = pref.ValueOfString(tok.ParsedString()) + val = protoreflect.ValueOfString(tok.ParsedString()) case json.ObjectOpen: fd = m.Descriptor().Fields().ByNumber(genid.Value_StructValue_field_number) @@ -591,7 +591,7 @@ const ( maxSecondsInDuration = 315576000000 ) -func (e encoder) marshalDuration(m pref.Message) error { +func (e encoder) marshalDuration(m protoreflect.Message) error { fds := m.Descriptor().Fields() fdSeconds := fds.ByNumber(genid.Duration_Seconds_field_number) fdNanos := fds.ByNumber(genid.Duration_Nanos_field_number) @@ -623,7 +623,7 @@ func (e encoder) marshalDuration(m pref.Message) error { return nil } -func (d decoder) unmarshalDuration(m pref.Message) error { +func (d decoder) unmarshalDuration(m protoreflect.Message) error { tok, err := d.Read() if err != nil { return err @@ -646,8 +646,8 @@ func (d decoder) unmarshalDuration(m pref.Message) error { fdSeconds := fds.ByNumber(genid.Duration_Seconds_field_number) fdNanos := fds.ByNumber(genid.Duration_Nanos_field_number) - m.Set(fdSeconds, pref.ValueOfInt64(secs)) - m.Set(fdNanos, pref.ValueOfInt32(nanos)) + m.Set(fdSeconds, protoreflect.ValueOfInt64(secs)) + m.Set(fdNanos, protoreflect.ValueOfInt32(nanos)) return nil } @@ -779,7 +779,7 @@ const ( minTimestampSeconds = -62135596800 ) -func (e encoder) marshalTimestamp(m pref.Message) error { +func (e encoder) marshalTimestamp(m protoreflect.Message) error { fds := m.Descriptor().Fields() fdSeconds := fds.ByNumber(genid.Timestamp_Seconds_field_number) fdNanos := fds.ByNumber(genid.Timestamp_Nanos_field_number) @@ -805,7 +805,7 @@ func (e encoder) marshalTimestamp(m pref.Message) error { return nil } -func (d decoder) unmarshalTimestamp(m pref.Message) error { +func (d decoder) unmarshalTimestamp(m protoreflect.Message) error { tok, err := d.Read() if err != nil { return err @@ -829,8 +829,8 @@ func (d decoder) unmarshalTimestamp(m pref.Message) error { fdSeconds := fds.ByNumber(genid.Timestamp_Seconds_field_number) fdNanos := fds.ByNumber(genid.Timestamp_Nanos_field_number) - m.Set(fdSeconds, pref.ValueOfInt64(secs)) - m.Set(fdNanos, pref.ValueOfInt32(int32(t.Nanosecond()))) + m.Set(fdSeconds, protoreflect.ValueOfInt64(secs)) + m.Set(fdNanos, protoreflect.ValueOfInt32(int32(t.Nanosecond()))) return nil } @@ -839,14 +839,14 @@ func (d decoder) unmarshalTimestamp(m pref.Message) error { // lower-camel naming conventions. Encoding should fail if the path name would // end up differently after a round-trip. -func (e encoder) marshalFieldMask(m pref.Message) error { +func (e encoder) marshalFieldMask(m protoreflect.Message) error { fd := m.Descriptor().Fields().ByNumber(genid.FieldMask_Paths_field_number) list := m.Get(fd).List() paths := make([]string, 0, list.Len()) for i := 0; i < list.Len(); i++ { s := list.Get(i).String() - if !pref.FullName(s).IsValid() { + if !protoreflect.FullName(s).IsValid() { return errors.New("%s contains invalid path: %q", genid.FieldMask_Paths_field_fullname, s) } // Return error if conversion to camelCase is not reversible. @@ -861,7 +861,7 @@ func (e encoder) marshalFieldMask(m pref.Message) error { return nil } -func (d decoder) unmarshalFieldMask(m pref.Message) error { +func (d decoder) unmarshalFieldMask(m protoreflect.Message) error { tok, err := d.Read() if err != nil { return err @@ -880,10 +880,10 @@ func (d decoder) unmarshalFieldMask(m pref.Message) error { for _, s0 := range paths { s := strs.JSONSnakeCase(s0) - if strings.Contains(s0, "_") || !pref.FullName(s).IsValid() { + if strings.Contains(s0, "_") || !protoreflect.FullName(s).IsValid() { return d.newError(tok.Pos(), "%v contains invalid path: %q", genid.FieldMask_Paths_field_fullname, s0) } - list.Append(pref.ValueOfString(s)) + list.Append(protoreflect.ValueOfString(s)) } return nil } diff --git a/vendor/google.golang.org/protobuf/encoding/prototext/decode.go b/vendor/google.golang.org/protobuf/encoding/prototext/decode.go index 179d6e8f..4921b2d4 100644 --- a/vendor/google.golang.org/protobuf/encoding/prototext/decode.go +++ b/vendor/google.golang.org/protobuf/encoding/prototext/decode.go @@ -17,7 +17,7 @@ import ( "google.golang.org/protobuf/internal/set" "google.golang.org/protobuf/internal/strs" "google.golang.org/protobuf/proto" - pref "google.golang.org/protobuf/reflect/protoreflect" + "google.golang.org/protobuf/reflect/protoreflect" "google.golang.org/protobuf/reflect/protoregistry" ) @@ -103,7 +103,7 @@ func (d decoder) syntaxError(pos int, f string, x ...interface{}) error { } // unmarshalMessage unmarshals into the given protoreflect.Message. -func (d decoder) unmarshalMessage(m pref.Message, checkDelims bool) error { +func (d decoder) unmarshalMessage(m protoreflect.Message, checkDelims bool) error { messageDesc := m.Descriptor() if !flags.ProtoLegacy && messageset.IsMessageSet(messageDesc) { return errors.New("no support for proto1 MessageSets") @@ -150,24 +150,24 @@ func (d decoder) unmarshalMessage(m pref.Message, checkDelims bool) error { } // Resolve the field descriptor. - var name pref.Name - var fd pref.FieldDescriptor - var xt pref.ExtensionType + var name protoreflect.Name + var fd protoreflect.FieldDescriptor + var xt protoreflect.ExtensionType var xtErr error var isFieldNumberName bool switch tok.NameKind() { case text.IdentName: - name = pref.Name(tok.IdentName()) + name = protoreflect.Name(tok.IdentName()) fd = fieldDescs.ByTextName(string(name)) case text.TypeName: // Handle extensions only. This code path is not for Any. - xt, xtErr = d.opts.Resolver.FindExtensionByName(pref.FullName(tok.TypeName())) + xt, xtErr = d.opts.Resolver.FindExtensionByName(protoreflect.FullName(tok.TypeName())) case text.FieldNumber: isFieldNumberName = true - num := pref.FieldNumber(tok.FieldNumber()) + num := protoreflect.FieldNumber(tok.FieldNumber()) if !num.IsValid() { return d.newError(tok.Pos(), "invalid field number: %d", num) } @@ -215,7 +215,7 @@ func (d decoder) unmarshalMessage(m pref.Message, checkDelims bool) error { switch { case fd.IsList(): kind := fd.Kind() - if kind != pref.MessageKind && kind != pref.GroupKind && !tok.HasSeparator() { + if kind != protoreflect.MessageKind && kind != protoreflect.GroupKind && !tok.HasSeparator() { return d.syntaxError(tok.Pos(), "missing field separator :") } @@ -232,7 +232,7 @@ func (d decoder) unmarshalMessage(m pref.Message, checkDelims bool) error { default: kind := fd.Kind() - if kind != pref.MessageKind && kind != pref.GroupKind && !tok.HasSeparator() { + if kind != protoreflect.MessageKind && kind != protoreflect.GroupKind && !tok.HasSeparator() { return d.syntaxError(tok.Pos(), "missing field separator :") } @@ -262,11 +262,11 @@ func (d decoder) unmarshalMessage(m pref.Message, checkDelims bool) error { // unmarshalSingular unmarshals a non-repeated field value specified by the // given FieldDescriptor. -func (d decoder) unmarshalSingular(fd pref.FieldDescriptor, m pref.Message) error { - var val pref.Value +func (d decoder) unmarshalSingular(fd protoreflect.FieldDescriptor, m protoreflect.Message) error { + var val protoreflect.Value var err error switch fd.Kind() { - case pref.MessageKind, pref.GroupKind: + case protoreflect.MessageKind, protoreflect.GroupKind: val = m.NewField(fd) err = d.unmarshalMessage(val.Message(), true) default: @@ -280,94 +280,94 @@ func (d decoder) unmarshalSingular(fd pref.FieldDescriptor, m pref.Message) erro // unmarshalScalar unmarshals a scalar/enum protoreflect.Value specified by the // given FieldDescriptor. -func (d decoder) unmarshalScalar(fd pref.FieldDescriptor) (pref.Value, error) { +func (d decoder) unmarshalScalar(fd protoreflect.FieldDescriptor) (protoreflect.Value, error) { tok, err := d.Read() if err != nil { - return pref.Value{}, err + return protoreflect.Value{}, err } if tok.Kind() != text.Scalar { - return pref.Value{}, d.unexpectedTokenError(tok) + return protoreflect.Value{}, d.unexpectedTokenError(tok) } kind := fd.Kind() switch kind { - case pref.BoolKind: + case protoreflect.BoolKind: if b, ok := tok.Bool(); ok { - return pref.ValueOfBool(b), nil + return protoreflect.ValueOfBool(b), nil } - case pref.Int32Kind, pref.Sint32Kind, pref.Sfixed32Kind: + case protoreflect.Int32Kind, protoreflect.Sint32Kind, protoreflect.Sfixed32Kind: if n, ok := tok.Int32(); ok { - return pref.ValueOfInt32(n), nil + return protoreflect.ValueOfInt32(n), nil } - case pref.Int64Kind, pref.Sint64Kind, pref.Sfixed64Kind: + case protoreflect.Int64Kind, protoreflect.Sint64Kind, protoreflect.Sfixed64Kind: if n, ok := tok.Int64(); ok { - return pref.ValueOfInt64(n), nil + return protoreflect.ValueOfInt64(n), nil } - case pref.Uint32Kind, pref.Fixed32Kind: + case protoreflect.Uint32Kind, protoreflect.Fixed32Kind: if n, ok := tok.Uint32(); ok { - return pref.ValueOfUint32(n), nil + return protoreflect.ValueOfUint32(n), nil } - case pref.Uint64Kind, pref.Fixed64Kind: + case protoreflect.Uint64Kind, protoreflect.Fixed64Kind: if n, ok := tok.Uint64(); ok { - return pref.ValueOfUint64(n), nil + return protoreflect.ValueOfUint64(n), nil } - case pref.FloatKind: + case protoreflect.FloatKind: if n, ok := tok.Float32(); ok { - return pref.ValueOfFloat32(n), nil + return protoreflect.ValueOfFloat32(n), nil } - case pref.DoubleKind: + case protoreflect.DoubleKind: if n, ok := tok.Float64(); ok { - return pref.ValueOfFloat64(n), nil + return protoreflect.ValueOfFloat64(n), nil } - case pref.StringKind: + case protoreflect.StringKind: if s, ok := tok.String(); ok { if strs.EnforceUTF8(fd) && !utf8.ValidString(s) { - return pref.Value{}, d.newError(tok.Pos(), "contains invalid UTF-8") + return protoreflect.Value{}, d.newError(tok.Pos(), "contains invalid UTF-8") } - return pref.ValueOfString(s), nil + return protoreflect.ValueOfString(s), nil } - case pref.BytesKind: + case protoreflect.BytesKind: if b, ok := tok.String(); ok { - return pref.ValueOfBytes([]byte(b)), nil + return protoreflect.ValueOfBytes([]byte(b)), nil } - case pref.EnumKind: + case protoreflect.EnumKind: if lit, ok := tok.Enum(); ok { // Lookup EnumNumber based on name. - if enumVal := fd.Enum().Values().ByName(pref.Name(lit)); enumVal != nil { - return pref.ValueOfEnum(enumVal.Number()), nil + if enumVal := fd.Enum().Values().ByName(protoreflect.Name(lit)); enumVal != nil { + return protoreflect.ValueOfEnum(enumVal.Number()), nil } } if num, ok := tok.Int32(); ok { - return pref.ValueOfEnum(pref.EnumNumber(num)), nil + return protoreflect.ValueOfEnum(protoreflect.EnumNumber(num)), nil } default: panic(fmt.Sprintf("invalid scalar kind %v", kind)) } - return pref.Value{}, d.newError(tok.Pos(), "invalid value for %v type: %v", kind, tok.RawString()) + return protoreflect.Value{}, d.newError(tok.Pos(), "invalid value for %v type: %v", kind, tok.RawString()) } // unmarshalList unmarshals into given protoreflect.List. A list value can // either be in [] syntax or simply just a single scalar/message value. -func (d decoder) unmarshalList(fd pref.FieldDescriptor, list pref.List) error { +func (d decoder) unmarshalList(fd protoreflect.FieldDescriptor, list protoreflect.List) error { tok, err := d.Peek() if err != nil { return err } switch fd.Kind() { - case pref.MessageKind, pref.GroupKind: + case protoreflect.MessageKind, protoreflect.GroupKind: switch tok.Kind() { case text.ListOpen: d.Read() @@ -441,22 +441,22 @@ func (d decoder) unmarshalList(fd pref.FieldDescriptor, list pref.List) error { // unmarshalMap unmarshals into given protoreflect.Map. A map value is a // textproto message containing {key: , value: }. -func (d decoder) unmarshalMap(fd pref.FieldDescriptor, mmap pref.Map) error { +func (d decoder) unmarshalMap(fd protoreflect.FieldDescriptor, mmap protoreflect.Map) error { // Determine ahead whether map entry is a scalar type or a message type in // order to call the appropriate unmarshalMapValue func inside // unmarshalMapEntry. - var unmarshalMapValue func() (pref.Value, error) + var unmarshalMapValue func() (protoreflect.Value, error) switch fd.MapValue().Kind() { - case pref.MessageKind, pref.GroupKind: - unmarshalMapValue = func() (pref.Value, error) { + case protoreflect.MessageKind, protoreflect.GroupKind: + unmarshalMapValue = func() (protoreflect.Value, error) { pval := mmap.NewValue() if err := d.unmarshalMessage(pval.Message(), true); err != nil { - return pref.Value{}, err + return protoreflect.Value{}, err } return pval, nil } default: - unmarshalMapValue = func() (pref.Value, error) { + unmarshalMapValue = func() (protoreflect.Value, error) { return d.unmarshalScalar(fd.MapValue()) } } @@ -494,9 +494,9 @@ func (d decoder) unmarshalMap(fd pref.FieldDescriptor, mmap pref.Map) error { // unmarshalMap unmarshals into given protoreflect.Map. A map value is a // textproto message containing {key: , value: }. -func (d decoder) unmarshalMapEntry(fd pref.FieldDescriptor, mmap pref.Map, unmarshalMapValue func() (pref.Value, error)) error { - var key pref.MapKey - var pval pref.Value +func (d decoder) unmarshalMapEntry(fd protoreflect.FieldDescriptor, mmap protoreflect.Map, unmarshalMapValue func() (protoreflect.Value, error)) error { + var key protoreflect.MapKey + var pval protoreflect.Value Loop: for { // Read field name. @@ -520,7 +520,7 @@ Loop: return d.unexpectedTokenError(tok) } - switch name := pref.Name(tok.IdentName()); name { + switch name := protoreflect.Name(tok.IdentName()); name { case genid.MapEntry_Key_field_name: if !tok.HasSeparator() { return d.syntaxError(tok.Pos(), "missing field separator :") @@ -535,7 +535,7 @@ Loop: key = val.MapKey() case genid.MapEntry_Value_field_name: - if kind := fd.MapValue().Kind(); (kind != pref.MessageKind) && (kind != pref.GroupKind) { + if kind := fd.MapValue().Kind(); (kind != protoreflect.MessageKind) && (kind != protoreflect.GroupKind) { if !tok.HasSeparator() { return d.syntaxError(tok.Pos(), "missing field separator :") } @@ -561,7 +561,7 @@ Loop: } if !pval.IsValid() { switch fd.MapValue().Kind() { - case pref.MessageKind, pref.GroupKind: + case protoreflect.MessageKind, protoreflect.GroupKind: // If value field is not set for message/group types, construct an // empty one as default. pval = mmap.NewValue() @@ -575,7 +575,7 @@ Loop: // unmarshalAny unmarshals an Any textproto. It can either be in expanded form // or non-expanded form. -func (d decoder) unmarshalAny(m pref.Message, checkDelims bool) error { +func (d decoder) unmarshalAny(m protoreflect.Message, checkDelims bool) error { var typeURL string var bValue []byte var seenTypeUrl bool @@ -619,7 +619,7 @@ Loop: return d.syntaxError(tok.Pos(), "missing field separator :") } - switch name := pref.Name(tok.IdentName()); name { + switch name := protoreflect.Name(tok.IdentName()); name { case genid.Any_TypeUrl_field_name: if seenTypeUrl { return d.newError(tok.Pos(), "duplicate %v field", genid.Any_TypeUrl_field_fullname) @@ -686,10 +686,10 @@ Loop: fds := m.Descriptor().Fields() if len(typeURL) > 0 { - m.Set(fds.ByNumber(genid.Any_TypeUrl_field_number), pref.ValueOfString(typeURL)) + m.Set(fds.ByNumber(genid.Any_TypeUrl_field_number), protoreflect.ValueOfString(typeURL)) } if len(bValue) > 0 { - m.Set(fds.ByNumber(genid.Any_Value_field_number), pref.ValueOfBytes(bValue)) + m.Set(fds.ByNumber(genid.Any_Value_field_number), protoreflect.ValueOfBytes(bValue)) } return nil } diff --git a/vendor/google.golang.org/protobuf/encoding/prototext/encode.go b/vendor/google.golang.org/protobuf/encoding/prototext/encode.go index 8d5304dc..ebf6c652 100644 --- a/vendor/google.golang.org/protobuf/encoding/prototext/encode.go +++ b/vendor/google.golang.org/protobuf/encoding/prototext/encode.go @@ -20,7 +20,6 @@ import ( "google.golang.org/protobuf/internal/strs" "google.golang.org/protobuf/proto" "google.golang.org/protobuf/reflect/protoreflect" - pref "google.golang.org/protobuf/reflect/protoreflect" "google.golang.org/protobuf/reflect/protoregistry" ) @@ -150,7 +149,7 @@ type encoder struct { } // marshalMessage marshals the given protoreflect.Message. -func (e encoder) marshalMessage(m pref.Message, inclDelims bool) error { +func (e encoder) marshalMessage(m protoreflect.Message, inclDelims bool) error { messageDesc := m.Descriptor() if !flags.ProtoLegacy && messageset.IsMessageSet(messageDesc) { return errors.New("no support for proto1 MessageSets") @@ -190,7 +189,7 @@ func (e encoder) marshalMessage(m pref.Message, inclDelims bool) error { } // marshalField marshals the given field with protoreflect.Value. -func (e encoder) marshalField(name string, val pref.Value, fd pref.FieldDescriptor) error { +func (e encoder) marshalField(name string, val protoreflect.Value, fd protoreflect.FieldDescriptor) error { switch { case fd.IsList(): return e.marshalList(name, val.List(), fd) @@ -204,40 +203,40 @@ func (e encoder) marshalField(name string, val pref.Value, fd pref.FieldDescript // marshalSingular marshals the given non-repeated field value. This includes // all scalar types, enums, messages, and groups. -func (e encoder) marshalSingular(val pref.Value, fd pref.FieldDescriptor) error { +func (e encoder) marshalSingular(val protoreflect.Value, fd protoreflect.FieldDescriptor) error { kind := fd.Kind() switch kind { - case pref.BoolKind: + case protoreflect.BoolKind: e.WriteBool(val.Bool()) - case pref.StringKind: + case protoreflect.StringKind: s := val.String() if !e.opts.allowInvalidUTF8 && strs.EnforceUTF8(fd) && !utf8.ValidString(s) { return errors.InvalidUTF8(string(fd.FullName())) } e.WriteString(s) - case pref.Int32Kind, pref.Int64Kind, - pref.Sint32Kind, pref.Sint64Kind, - pref.Sfixed32Kind, pref.Sfixed64Kind: + case protoreflect.Int32Kind, protoreflect.Int64Kind, + protoreflect.Sint32Kind, protoreflect.Sint64Kind, + protoreflect.Sfixed32Kind, protoreflect.Sfixed64Kind: e.WriteInt(val.Int()) - case pref.Uint32Kind, pref.Uint64Kind, - pref.Fixed32Kind, pref.Fixed64Kind: + case protoreflect.Uint32Kind, protoreflect.Uint64Kind, + protoreflect.Fixed32Kind, protoreflect.Fixed64Kind: e.WriteUint(val.Uint()) - case pref.FloatKind: + case protoreflect.FloatKind: // Encoder.WriteFloat handles the special numbers NaN and infinites. e.WriteFloat(val.Float(), 32) - case pref.DoubleKind: + case protoreflect.DoubleKind: // Encoder.WriteFloat handles the special numbers NaN and infinites. e.WriteFloat(val.Float(), 64) - case pref.BytesKind: + case protoreflect.BytesKind: e.WriteString(string(val.Bytes())) - case pref.EnumKind: + case protoreflect.EnumKind: num := val.Enum() if desc := fd.Enum().Values().ByNumber(num); desc != nil { e.WriteLiteral(string(desc.Name())) @@ -246,7 +245,7 @@ func (e encoder) marshalSingular(val pref.Value, fd pref.FieldDescriptor) error e.WriteInt(int64(num)) } - case pref.MessageKind, pref.GroupKind: + case protoreflect.MessageKind, protoreflect.GroupKind: return e.marshalMessage(val.Message(), true) default: @@ -256,7 +255,7 @@ func (e encoder) marshalSingular(val pref.Value, fd pref.FieldDescriptor) error } // marshalList marshals the given protoreflect.List as multiple name-value fields. -func (e encoder) marshalList(name string, list pref.List, fd pref.FieldDescriptor) error { +func (e encoder) marshalList(name string, list protoreflect.List, fd protoreflect.FieldDescriptor) error { size := list.Len() for i := 0; i < size; i++ { e.WriteName(name) @@ -268,9 +267,9 @@ func (e encoder) marshalList(name string, list pref.List, fd pref.FieldDescripto } // marshalMap marshals the given protoreflect.Map as multiple name-value fields. -func (e encoder) marshalMap(name string, mmap pref.Map, fd pref.FieldDescriptor) error { +func (e encoder) marshalMap(name string, mmap protoreflect.Map, fd protoreflect.FieldDescriptor) error { var err error - order.RangeEntries(mmap, order.GenericKeyOrder, func(key pref.MapKey, val pref.Value) bool { + order.RangeEntries(mmap, order.GenericKeyOrder, func(key protoreflect.MapKey, val protoreflect.Value) bool { e.WriteName(name) e.StartMessage() defer e.EndMessage() @@ -334,7 +333,7 @@ func (e encoder) marshalUnknown(b []byte) { // marshalAny marshals the given google.protobuf.Any message in expanded form. // It returns true if it was able to marshal, else false. -func (e encoder) marshalAny(any pref.Message) bool { +func (e encoder) marshalAny(any protoreflect.Message) bool { // Construct the embedded message. fds := any.Descriptor().Fields() fdType := fds.ByNumber(genid.Any_TypeUrl_field_number) diff --git a/vendor/google.golang.org/protobuf/encoding/protowire/wire.go b/vendor/google.golang.org/protobuf/encoding/protowire/wire.go index 9c61112f..ce57f57e 100644 --- a/vendor/google.golang.org/protobuf/encoding/protowire/wire.go +++ b/vendor/google.golang.org/protobuf/encoding/protowire/wire.go @@ -516,6 +516,7 @@ func EncodeTag(num Number, typ Type) uint64 { } // DecodeZigZag decodes a zig-zag-encoded uint64 as an int64. +// // Input: {…, 5, 3, 1, 0, 2, 4, 6, …} // Output: {…, -3, -2, -1, 0, +1, +2, +3, …} func DecodeZigZag(x uint64) int64 { @@ -523,6 +524,7 @@ func DecodeZigZag(x uint64) int64 { } // EncodeZigZag encodes an int64 as a zig-zag-encoded uint64. +// // Input: {…, -3, -2, -1, 0, +1, +2, +3, …} // Output: {…, 5, 3, 1, 0, 2, 4, 6, …} func EncodeZigZag(x int64) uint64 { @@ -530,6 +532,7 @@ func EncodeZigZag(x int64) uint64 { } // DecodeBool decodes a uint64 as a bool. +// // Input: { 0, 1, 2, …} // Output: {false, true, true, …} func DecodeBool(x uint64) bool { @@ -537,6 +540,7 @@ func DecodeBool(x uint64) bool { } // EncodeBool encodes a bool as a uint64. +// // Input: {false, true} // Output: { 0, 1} func EncodeBool(x bool) uint64 { diff --git a/vendor/google.golang.org/protobuf/internal/descfmt/stringer.go b/vendor/google.golang.org/protobuf/internal/descfmt/stringer.go index 360c6332..db5248e1 100644 --- a/vendor/google.golang.org/protobuf/internal/descfmt/stringer.go +++ b/vendor/google.golang.org/protobuf/internal/descfmt/stringer.go @@ -14,7 +14,7 @@ import ( "google.golang.org/protobuf/internal/detrand" "google.golang.org/protobuf/internal/pragma" - pref "google.golang.org/protobuf/reflect/protoreflect" + "google.golang.org/protobuf/reflect/protoreflect" ) type list interface { @@ -30,17 +30,17 @@ func formatListOpt(vs list, isRoot, allowMulti bool) string { if isRoot { var name string switch vs.(type) { - case pref.Names: + case protoreflect.Names: name = "Names" - case pref.FieldNumbers: + case protoreflect.FieldNumbers: name = "FieldNumbers" - case pref.FieldRanges: + case protoreflect.FieldRanges: name = "FieldRanges" - case pref.EnumRanges: + case protoreflect.EnumRanges: name = "EnumRanges" - case pref.FileImports: + case protoreflect.FileImports: name = "FileImports" - case pref.Descriptor: + case protoreflect.Descriptor: name = reflect.ValueOf(vs).MethodByName("Get").Type().Out(0).Name() + "s" default: name = reflect.ValueOf(vs).Elem().Type().Name() @@ -50,17 +50,17 @@ func formatListOpt(vs list, isRoot, allowMulti bool) string { var ss []string switch vs := vs.(type) { - case pref.Names: + case protoreflect.Names: for i := 0; i < vs.Len(); i++ { ss = append(ss, fmt.Sprint(vs.Get(i))) } return start + joinStrings(ss, false) + end - case pref.FieldNumbers: + case protoreflect.FieldNumbers: for i := 0; i < vs.Len(); i++ { ss = append(ss, fmt.Sprint(vs.Get(i))) } return start + joinStrings(ss, false) + end - case pref.FieldRanges: + case protoreflect.FieldRanges: for i := 0; i < vs.Len(); i++ { r := vs.Get(i) if r[0]+1 == r[1] { @@ -70,7 +70,7 @@ func formatListOpt(vs list, isRoot, allowMulti bool) string { } } return start + joinStrings(ss, false) + end - case pref.EnumRanges: + case protoreflect.EnumRanges: for i := 0; i < vs.Len(); i++ { r := vs.Get(i) if r[0] == r[1] { @@ -80,7 +80,7 @@ func formatListOpt(vs list, isRoot, allowMulti bool) string { } } return start + joinStrings(ss, false) + end - case pref.FileImports: + case protoreflect.FileImports: for i := 0; i < vs.Len(); i++ { var rs records rs.Append(reflect.ValueOf(vs.Get(i)), "Path", "Package", "IsPublic", "IsWeak") @@ -88,11 +88,11 @@ func formatListOpt(vs list, isRoot, allowMulti bool) string { } return start + joinStrings(ss, allowMulti) + end default: - _, isEnumValue := vs.(pref.EnumValueDescriptors) + _, isEnumValue := vs.(protoreflect.EnumValueDescriptors) for i := 0; i < vs.Len(); i++ { m := reflect.ValueOf(vs).MethodByName("Get") v := m.Call([]reflect.Value{reflect.ValueOf(i)})[0].Interface() - ss = append(ss, formatDescOpt(v.(pref.Descriptor), false, allowMulti && !isEnumValue)) + ss = append(ss, formatDescOpt(v.(protoreflect.Descriptor), false, allowMulti && !isEnumValue)) } return start + joinStrings(ss, allowMulti && isEnumValue) + end } @@ -106,20 +106,20 @@ func formatListOpt(vs list, isRoot, allowMulti bool) string { // // Using a list allows us to print the accessors in a sensible order. var descriptorAccessors = map[reflect.Type][]string{ - reflect.TypeOf((*pref.FileDescriptor)(nil)).Elem(): {"Path", "Package", "Imports", "Messages", "Enums", "Extensions", "Services"}, - reflect.TypeOf((*pref.MessageDescriptor)(nil)).Elem(): {"IsMapEntry", "Fields", "Oneofs", "ReservedNames", "ReservedRanges", "RequiredNumbers", "ExtensionRanges", "Messages", "Enums", "Extensions"}, - reflect.TypeOf((*pref.FieldDescriptor)(nil)).Elem(): {"Number", "Cardinality", "Kind", "HasJSONName", "JSONName", "HasPresence", "IsExtension", "IsPacked", "IsWeak", "IsList", "IsMap", "MapKey", "MapValue", "HasDefault", "Default", "ContainingOneof", "ContainingMessage", "Message", "Enum"}, - reflect.TypeOf((*pref.OneofDescriptor)(nil)).Elem(): {"Fields"}, // not directly used; must keep in sync with formatDescOpt - reflect.TypeOf((*pref.EnumDescriptor)(nil)).Elem(): {"Values", "ReservedNames", "ReservedRanges"}, - reflect.TypeOf((*pref.EnumValueDescriptor)(nil)).Elem(): {"Number"}, - reflect.TypeOf((*pref.ServiceDescriptor)(nil)).Elem(): {"Methods"}, - reflect.TypeOf((*pref.MethodDescriptor)(nil)).Elem(): {"Input", "Output", "IsStreamingClient", "IsStreamingServer"}, + reflect.TypeOf((*protoreflect.FileDescriptor)(nil)).Elem(): {"Path", "Package", "Imports", "Messages", "Enums", "Extensions", "Services"}, + reflect.TypeOf((*protoreflect.MessageDescriptor)(nil)).Elem(): {"IsMapEntry", "Fields", "Oneofs", "ReservedNames", "ReservedRanges", "RequiredNumbers", "ExtensionRanges", "Messages", "Enums", "Extensions"}, + reflect.TypeOf((*protoreflect.FieldDescriptor)(nil)).Elem(): {"Number", "Cardinality", "Kind", "HasJSONName", "JSONName", "HasPresence", "IsExtension", "IsPacked", "IsWeak", "IsList", "IsMap", "MapKey", "MapValue", "HasDefault", "Default", "ContainingOneof", "ContainingMessage", "Message", "Enum"}, + reflect.TypeOf((*protoreflect.OneofDescriptor)(nil)).Elem(): {"Fields"}, // not directly used; must keep in sync with formatDescOpt + reflect.TypeOf((*protoreflect.EnumDescriptor)(nil)).Elem(): {"Values", "ReservedNames", "ReservedRanges"}, + reflect.TypeOf((*protoreflect.EnumValueDescriptor)(nil)).Elem(): {"Number"}, + reflect.TypeOf((*protoreflect.ServiceDescriptor)(nil)).Elem(): {"Methods"}, + reflect.TypeOf((*protoreflect.MethodDescriptor)(nil)).Elem(): {"Input", "Output", "IsStreamingClient", "IsStreamingServer"}, } -func FormatDesc(s fmt.State, r rune, t pref.Descriptor) { +func FormatDesc(s fmt.State, r rune, t protoreflect.Descriptor) { io.WriteString(s, formatDescOpt(t, true, r == 'v' && (s.Flag('+') || s.Flag('#')))) } -func formatDescOpt(t pref.Descriptor, isRoot, allowMulti bool) string { +func formatDescOpt(t protoreflect.Descriptor, isRoot, allowMulti bool) string { rv := reflect.ValueOf(t) rt := rv.MethodByName("ProtoType").Type().In(0) @@ -128,7 +128,7 @@ func formatDescOpt(t pref.Descriptor, isRoot, allowMulti bool) string { start = rt.Name() + "{" } - _, isFile := t.(pref.FileDescriptor) + _, isFile := t.(protoreflect.FileDescriptor) rs := records{allowMulti: allowMulti} if t.IsPlaceholder() { if isFile { @@ -146,7 +146,7 @@ func formatDescOpt(t pref.Descriptor, isRoot, allowMulti bool) string { rs.Append(rv, "Name") } switch t := t.(type) { - case pref.FieldDescriptor: + case protoreflect.FieldDescriptor: for _, s := range descriptorAccessors[rt] { switch s { case "MapKey": @@ -156,9 +156,9 @@ func formatDescOpt(t pref.Descriptor, isRoot, allowMulti bool) string { case "MapValue": if v := t.MapValue(); v != nil { switch v.Kind() { - case pref.EnumKind: + case protoreflect.EnumKind: rs.recs = append(rs.recs, [2]string{"MapValue", string(v.Enum().FullName())}) - case pref.MessageKind, pref.GroupKind: + case protoreflect.MessageKind, protoreflect.GroupKind: rs.recs = append(rs.recs, [2]string{"MapValue", string(v.Message().FullName())}) default: rs.recs = append(rs.recs, [2]string{"MapValue", v.Kind().String()}) @@ -180,7 +180,7 @@ func formatDescOpt(t pref.Descriptor, isRoot, allowMulti bool) string { rs.Append(rv, s) } } - case pref.OneofDescriptor: + case protoreflect.OneofDescriptor: var ss []string fs := t.Fields() for i := 0; i < fs.Len(); i++ { @@ -216,7 +216,7 @@ func (rs *records) Append(v reflect.Value, accessors ...string) { if !rv.IsValid() { panic(fmt.Sprintf("unknown accessor: %v.%s", v.Type(), a)) } - if _, ok := rv.Interface().(pref.Value); ok { + if _, ok := rv.Interface().(protoreflect.Value); ok { rv = rv.MethodByName("Interface").Call(nil)[0] if !rv.IsNil() { rv = rv.Elem() @@ -250,9 +250,9 @@ func (rs *records) Append(v reflect.Value, accessors ...string) { switch v := v.(type) { case list: s = formatListOpt(v, false, rs.allowMulti) - case pref.FieldDescriptor, pref.OneofDescriptor, pref.EnumValueDescriptor, pref.MethodDescriptor: - s = string(v.(pref.Descriptor).Name()) - case pref.Descriptor: + case protoreflect.FieldDescriptor, protoreflect.OneofDescriptor, protoreflect.EnumValueDescriptor, protoreflect.MethodDescriptor: + s = string(v.(protoreflect.Descriptor).Name()) + case protoreflect.Descriptor: s = string(v.FullName()) case string: s = strconv.Quote(v) diff --git a/vendor/google.golang.org/protobuf/internal/encoding/defval/default.go b/vendor/google.golang.org/protobuf/internal/encoding/defval/default.go index fdd9b13f..328dc733 100644 --- a/vendor/google.golang.org/protobuf/internal/encoding/defval/default.go +++ b/vendor/google.golang.org/protobuf/internal/encoding/defval/default.go @@ -15,8 +15,8 @@ import ( "strconv" ptext "google.golang.org/protobuf/internal/encoding/text" - errors "google.golang.org/protobuf/internal/errors" - pref "google.golang.org/protobuf/reflect/protoreflect" + "google.golang.org/protobuf/internal/errors" + "google.golang.org/protobuf/reflect/protoreflect" ) // Format is the serialization format used to represent the default value. @@ -35,56 +35,56 @@ const ( // Unmarshal deserializes the default string s according to the given kind k. // When k is an enum, a list of enum value descriptors must be provided. -func Unmarshal(s string, k pref.Kind, evs pref.EnumValueDescriptors, f Format) (pref.Value, pref.EnumValueDescriptor, error) { +func Unmarshal(s string, k protoreflect.Kind, evs protoreflect.EnumValueDescriptors, f Format) (protoreflect.Value, protoreflect.EnumValueDescriptor, error) { switch k { - case pref.BoolKind: + case protoreflect.BoolKind: if f == GoTag { switch s { case "1": - return pref.ValueOfBool(true), nil, nil + return protoreflect.ValueOfBool(true), nil, nil case "0": - return pref.ValueOfBool(false), nil, nil + return protoreflect.ValueOfBool(false), nil, nil } } else { switch s { case "true": - return pref.ValueOfBool(true), nil, nil + return protoreflect.ValueOfBool(true), nil, nil case "false": - return pref.ValueOfBool(false), nil, nil + return protoreflect.ValueOfBool(false), nil, nil } } - case pref.EnumKind: + case protoreflect.EnumKind: if f == GoTag { // Go tags use the numeric form of the enum value. if n, err := strconv.ParseInt(s, 10, 32); err == nil { - if ev := evs.ByNumber(pref.EnumNumber(n)); ev != nil { - return pref.ValueOfEnum(ev.Number()), ev, nil + if ev := evs.ByNumber(protoreflect.EnumNumber(n)); ev != nil { + return protoreflect.ValueOfEnum(ev.Number()), ev, nil } } } else { // Descriptor default_value use the enum identifier. - ev := evs.ByName(pref.Name(s)) + ev := evs.ByName(protoreflect.Name(s)) if ev != nil { - return pref.ValueOfEnum(ev.Number()), ev, nil + return protoreflect.ValueOfEnum(ev.Number()), ev, nil } } - case pref.Int32Kind, pref.Sint32Kind, pref.Sfixed32Kind: + case protoreflect.Int32Kind, protoreflect.Sint32Kind, protoreflect.Sfixed32Kind: if v, err := strconv.ParseInt(s, 10, 32); err == nil { - return pref.ValueOfInt32(int32(v)), nil, nil + return protoreflect.ValueOfInt32(int32(v)), nil, nil } - case pref.Int64Kind, pref.Sint64Kind, pref.Sfixed64Kind: + case protoreflect.Int64Kind, protoreflect.Sint64Kind, protoreflect.Sfixed64Kind: if v, err := strconv.ParseInt(s, 10, 64); err == nil { - return pref.ValueOfInt64(int64(v)), nil, nil + return protoreflect.ValueOfInt64(int64(v)), nil, nil } - case pref.Uint32Kind, pref.Fixed32Kind: + case protoreflect.Uint32Kind, protoreflect.Fixed32Kind: if v, err := strconv.ParseUint(s, 10, 32); err == nil { - return pref.ValueOfUint32(uint32(v)), nil, nil + return protoreflect.ValueOfUint32(uint32(v)), nil, nil } - case pref.Uint64Kind, pref.Fixed64Kind: + case protoreflect.Uint64Kind, protoreflect.Fixed64Kind: if v, err := strconv.ParseUint(s, 10, 64); err == nil { - return pref.ValueOfUint64(uint64(v)), nil, nil + return protoreflect.ValueOfUint64(uint64(v)), nil, nil } - case pref.FloatKind, pref.DoubleKind: + case protoreflect.FloatKind, protoreflect.DoubleKind: var v float64 var err error switch s { @@ -98,29 +98,29 @@ func Unmarshal(s string, k pref.Kind, evs pref.EnumValueDescriptors, f Format) ( v, err = strconv.ParseFloat(s, 64) } if err == nil { - if k == pref.FloatKind { - return pref.ValueOfFloat32(float32(v)), nil, nil + if k == protoreflect.FloatKind { + return protoreflect.ValueOfFloat32(float32(v)), nil, nil } else { - return pref.ValueOfFloat64(float64(v)), nil, nil + return protoreflect.ValueOfFloat64(float64(v)), nil, nil } } - case pref.StringKind: + case protoreflect.StringKind: // String values are already unescaped and can be used as is. - return pref.ValueOfString(s), nil, nil - case pref.BytesKind: + return protoreflect.ValueOfString(s), nil, nil + case protoreflect.BytesKind: if b, ok := unmarshalBytes(s); ok { - return pref.ValueOfBytes(b), nil, nil + return protoreflect.ValueOfBytes(b), nil, nil } } - return pref.Value{}, nil, errors.New("could not parse value for %v: %q", k, s) + return protoreflect.Value{}, nil, errors.New("could not parse value for %v: %q", k, s) } // Marshal serializes v as the default string according to the given kind k. // When specifying the Descriptor format for an enum kind, the associated // enum value descriptor must be provided. -func Marshal(v pref.Value, ev pref.EnumValueDescriptor, k pref.Kind, f Format) (string, error) { +func Marshal(v protoreflect.Value, ev protoreflect.EnumValueDescriptor, k protoreflect.Kind, f Format) (string, error) { switch k { - case pref.BoolKind: + case protoreflect.BoolKind: if f == GoTag { if v.Bool() { return "1", nil @@ -134,17 +134,17 @@ func Marshal(v pref.Value, ev pref.EnumValueDescriptor, k pref.Kind, f Format) ( return "false", nil } } - case pref.EnumKind: + case protoreflect.EnumKind: if f == GoTag { return strconv.FormatInt(int64(v.Enum()), 10), nil } else { return string(ev.Name()), nil } - case pref.Int32Kind, pref.Sint32Kind, pref.Sfixed32Kind, pref.Int64Kind, pref.Sint64Kind, pref.Sfixed64Kind: + case protoreflect.Int32Kind, protoreflect.Sint32Kind, protoreflect.Sfixed32Kind, protoreflect.Int64Kind, protoreflect.Sint64Kind, protoreflect.Sfixed64Kind: return strconv.FormatInt(v.Int(), 10), nil - case pref.Uint32Kind, pref.Fixed32Kind, pref.Uint64Kind, pref.Fixed64Kind: + case protoreflect.Uint32Kind, protoreflect.Fixed32Kind, protoreflect.Uint64Kind, protoreflect.Fixed64Kind: return strconv.FormatUint(v.Uint(), 10), nil - case pref.FloatKind, pref.DoubleKind: + case protoreflect.FloatKind, protoreflect.DoubleKind: f := v.Float() switch { case math.IsInf(f, -1): @@ -154,16 +154,16 @@ func Marshal(v pref.Value, ev pref.EnumValueDescriptor, k pref.Kind, f Format) ( case math.IsNaN(f): return "nan", nil default: - if k == pref.FloatKind { + if k == protoreflect.FloatKind { return strconv.FormatFloat(f, 'g', -1, 32), nil } else { return strconv.FormatFloat(f, 'g', -1, 64), nil } } - case pref.StringKind: + case protoreflect.StringKind: // String values are serialized as is without any escaping. return v.String(), nil - case pref.BytesKind: + case protoreflect.BytesKind: if s, ok := marshalBytes(v.Bytes()); ok { return s, nil } diff --git a/vendor/google.golang.org/protobuf/internal/encoding/messageset/messageset.go b/vendor/google.golang.org/protobuf/internal/encoding/messageset/messageset.go index c1866f3c..a6693f0a 100644 --- a/vendor/google.golang.org/protobuf/internal/encoding/messageset/messageset.go +++ b/vendor/google.golang.org/protobuf/internal/encoding/messageset/messageset.go @@ -10,7 +10,7 @@ import ( "google.golang.org/protobuf/encoding/protowire" "google.golang.org/protobuf/internal/errors" - pref "google.golang.org/protobuf/reflect/protoreflect" + "google.golang.org/protobuf/reflect/protoreflect" ) // The MessageSet wire format is equivalent to a message defined as follows, @@ -33,6 +33,7 @@ const ( // ExtensionName is the field name for extensions of MessageSet. // // A valid MessageSet extension must be of the form: +// // message MyMessage { // extend proto2.bridge.MessageSet { // optional MyMessage message_set_extension = 1234; @@ -42,13 +43,13 @@ const ( const ExtensionName = "message_set_extension" // IsMessageSet returns whether the message uses the MessageSet wire format. -func IsMessageSet(md pref.MessageDescriptor) bool { +func IsMessageSet(md protoreflect.MessageDescriptor) bool { xmd, ok := md.(interface{ IsMessageSet() bool }) return ok && xmd.IsMessageSet() } // IsMessageSetExtension reports this field properly extends a MessageSet. -func IsMessageSetExtension(fd pref.FieldDescriptor) bool { +func IsMessageSetExtension(fd protoreflect.FieldDescriptor) bool { switch { case fd.Name() != ExtensionName: return false diff --git a/vendor/google.golang.org/protobuf/internal/encoding/tag/tag.go b/vendor/google.golang.org/protobuf/internal/encoding/tag/tag.go index 38f1931c..373d2083 100644 --- a/vendor/google.golang.org/protobuf/internal/encoding/tag/tag.go +++ b/vendor/google.golang.org/protobuf/internal/encoding/tag/tag.go @@ -11,10 +11,10 @@ import ( "strconv" "strings" - defval "google.golang.org/protobuf/internal/encoding/defval" - fdesc "google.golang.org/protobuf/internal/filedesc" + "google.golang.org/protobuf/internal/encoding/defval" + "google.golang.org/protobuf/internal/filedesc" "google.golang.org/protobuf/internal/strs" - pref "google.golang.org/protobuf/reflect/protoreflect" + "google.golang.org/protobuf/reflect/protoreflect" ) var byteType = reflect.TypeOf(byte(0)) @@ -29,9 +29,9 @@ var byteType = reflect.TypeOf(byte(0)) // This does not populate the Enum or Message (except for weak message). // // This function is a best effort attempt; parsing errors are ignored. -func Unmarshal(tag string, goType reflect.Type, evs pref.EnumValueDescriptors) pref.FieldDescriptor { - f := new(fdesc.Field) - f.L0.ParentFile = fdesc.SurrogateProto2 +func Unmarshal(tag string, goType reflect.Type, evs protoreflect.EnumValueDescriptors) protoreflect.FieldDescriptor { + f := new(filedesc.Field) + f.L0.ParentFile = filedesc.SurrogateProto2 for len(tag) > 0 { i := strings.IndexByte(tag, ',') if i < 0 { @@ -39,68 +39,68 @@ func Unmarshal(tag string, goType reflect.Type, evs pref.EnumValueDescriptors) p } switch s := tag[:i]; { case strings.HasPrefix(s, "name="): - f.L0.FullName = pref.FullName(s[len("name="):]) + f.L0.FullName = protoreflect.FullName(s[len("name="):]) case strings.Trim(s, "0123456789") == "": n, _ := strconv.ParseUint(s, 10, 32) - f.L1.Number = pref.FieldNumber(n) + f.L1.Number = protoreflect.FieldNumber(n) case s == "opt": - f.L1.Cardinality = pref.Optional + f.L1.Cardinality = protoreflect.Optional case s == "req": - f.L1.Cardinality = pref.Required + f.L1.Cardinality = protoreflect.Required case s == "rep": - f.L1.Cardinality = pref.Repeated + f.L1.Cardinality = protoreflect.Repeated case s == "varint": switch goType.Kind() { case reflect.Bool: - f.L1.Kind = pref.BoolKind + f.L1.Kind = protoreflect.BoolKind case reflect.Int32: - f.L1.Kind = pref.Int32Kind + f.L1.Kind = protoreflect.Int32Kind case reflect.Int64: - f.L1.Kind = pref.Int64Kind + f.L1.Kind = protoreflect.Int64Kind case reflect.Uint32: - f.L1.Kind = pref.Uint32Kind + f.L1.Kind = protoreflect.Uint32Kind case reflect.Uint64: - f.L1.Kind = pref.Uint64Kind + f.L1.Kind = protoreflect.Uint64Kind } case s == "zigzag32": if goType.Kind() == reflect.Int32 { - f.L1.Kind = pref.Sint32Kind + f.L1.Kind = protoreflect.Sint32Kind } case s == "zigzag64": if goType.Kind() == reflect.Int64 { - f.L1.Kind = pref.Sint64Kind + f.L1.Kind = protoreflect.Sint64Kind } case s == "fixed32": switch goType.Kind() { case reflect.Int32: - f.L1.Kind = pref.Sfixed32Kind + f.L1.Kind = protoreflect.Sfixed32Kind case reflect.Uint32: - f.L1.Kind = pref.Fixed32Kind + f.L1.Kind = protoreflect.Fixed32Kind case reflect.Float32: - f.L1.Kind = pref.FloatKind + f.L1.Kind = protoreflect.FloatKind } case s == "fixed64": switch goType.Kind() { case reflect.Int64: - f.L1.Kind = pref.Sfixed64Kind + f.L1.Kind = protoreflect.Sfixed64Kind case reflect.Uint64: - f.L1.Kind = pref.Fixed64Kind + f.L1.Kind = protoreflect.Fixed64Kind case reflect.Float64: - f.L1.Kind = pref.DoubleKind + f.L1.Kind = protoreflect.DoubleKind } case s == "bytes": switch { case goType.Kind() == reflect.String: - f.L1.Kind = pref.StringKind + f.L1.Kind = protoreflect.StringKind case goType.Kind() == reflect.Slice && goType.Elem() == byteType: - f.L1.Kind = pref.BytesKind + f.L1.Kind = protoreflect.BytesKind default: - f.L1.Kind = pref.MessageKind + f.L1.Kind = protoreflect.MessageKind } case s == "group": - f.L1.Kind = pref.GroupKind + f.L1.Kind = protoreflect.GroupKind case strings.HasPrefix(s, "enum="): - f.L1.Kind = pref.EnumKind + f.L1.Kind = protoreflect.EnumKind case strings.HasPrefix(s, "json="): jsonName := s[len("json="):] if jsonName != strs.JSONCamelCase(string(f.L0.FullName.Name())) { @@ -111,23 +111,23 @@ func Unmarshal(tag string, goType reflect.Type, evs pref.EnumValueDescriptors) p f.L1.IsPacked = true case strings.HasPrefix(s, "weak="): f.L1.IsWeak = true - f.L1.Message = fdesc.PlaceholderMessage(pref.FullName(s[len("weak="):])) + f.L1.Message = filedesc.PlaceholderMessage(protoreflect.FullName(s[len("weak="):])) case strings.HasPrefix(s, "def="): // The default tag is special in that everything afterwards is the // default regardless of the presence of commas. s, i = tag[len("def="):], len(tag) v, ev, _ := defval.Unmarshal(s, f.L1.Kind, evs, defval.GoTag) - f.L1.Default = fdesc.DefaultValue(v, ev) + f.L1.Default = filedesc.DefaultValue(v, ev) case s == "proto3": - f.L0.ParentFile = fdesc.SurrogateProto3 + f.L0.ParentFile = filedesc.SurrogateProto3 } tag = strings.TrimPrefix(tag[i:], ",") } // The generator uses the group message name instead of the field name. // We obtain the real field name by lowercasing the group name. - if f.L1.Kind == pref.GroupKind { - f.L0.FullName = pref.FullName(strings.ToLower(string(f.L0.FullName))) + if f.L1.Kind == protoreflect.GroupKind { + f.L0.FullName = protoreflect.FullName(strings.ToLower(string(f.L0.FullName))) } return f } @@ -140,38 +140,38 @@ func Unmarshal(tag string, goType reflect.Type, evs pref.EnumValueDescriptors) p // Depending on the context on how Marshal is called, there are different ways // through which that information is determined. As such it is the caller's // responsibility to provide a function to obtain that information. -func Marshal(fd pref.FieldDescriptor, enumName string) string { +func Marshal(fd protoreflect.FieldDescriptor, enumName string) string { var tag []string switch fd.Kind() { - case pref.BoolKind, pref.EnumKind, pref.Int32Kind, pref.Uint32Kind, pref.Int64Kind, pref.Uint64Kind: + case protoreflect.BoolKind, protoreflect.EnumKind, protoreflect.Int32Kind, protoreflect.Uint32Kind, protoreflect.Int64Kind, protoreflect.Uint64Kind: tag = append(tag, "varint") - case pref.Sint32Kind: + case protoreflect.Sint32Kind: tag = append(tag, "zigzag32") - case pref.Sint64Kind: + case protoreflect.Sint64Kind: tag = append(tag, "zigzag64") - case pref.Sfixed32Kind, pref.Fixed32Kind, pref.FloatKind: + case protoreflect.Sfixed32Kind, protoreflect.Fixed32Kind, protoreflect.FloatKind: tag = append(tag, "fixed32") - case pref.Sfixed64Kind, pref.Fixed64Kind, pref.DoubleKind: + case protoreflect.Sfixed64Kind, protoreflect.Fixed64Kind, protoreflect.DoubleKind: tag = append(tag, "fixed64") - case pref.StringKind, pref.BytesKind, pref.MessageKind: + case protoreflect.StringKind, protoreflect.BytesKind, protoreflect.MessageKind: tag = append(tag, "bytes") - case pref.GroupKind: + case protoreflect.GroupKind: tag = append(tag, "group") } tag = append(tag, strconv.Itoa(int(fd.Number()))) switch fd.Cardinality() { - case pref.Optional: + case protoreflect.Optional: tag = append(tag, "opt") - case pref.Required: + case protoreflect.Required: tag = append(tag, "req") - case pref.Repeated: + case protoreflect.Repeated: tag = append(tag, "rep") } if fd.IsPacked() { tag = append(tag, "packed") } name := string(fd.Name()) - if fd.Kind() == pref.GroupKind { + if fd.Kind() == protoreflect.GroupKind { // The name of the FieldDescriptor for a group field is // lowercased. To find the original capitalization, we // look in the field's MessageType. @@ -189,10 +189,10 @@ func Marshal(fd pref.FieldDescriptor, enumName string) string { // The previous implementation does not tag extension fields as proto3, // even when the field is defined in a proto3 file. Match that behavior // for consistency. - if fd.Syntax() == pref.Proto3 && !fd.IsExtension() { + if fd.Syntax() == protoreflect.Proto3 && !fd.IsExtension() { tag = append(tag, "proto3") } - if fd.Kind() == pref.EnumKind && enumName != "" { + if fd.Kind() == protoreflect.EnumKind && enumName != "" { tag = append(tag, "enum="+enumName) } if fd.ContainingOneof() != nil { diff --git a/vendor/google.golang.org/protobuf/internal/encoding/text/decode.go b/vendor/google.golang.org/protobuf/internal/encoding/text/decode.go index 37803773..427c62d0 100644 --- a/vendor/google.golang.org/protobuf/internal/encoding/text/decode.go +++ b/vendor/google.golang.org/protobuf/internal/encoding/text/decode.go @@ -8,7 +8,6 @@ import ( "bytes" "fmt" "io" - "regexp" "strconv" "unicode/utf8" @@ -421,7 +420,7 @@ func (d *Decoder) parseFieldName() (tok Token, err error) { return Token{}, d.newSyntaxError("invalid field number: %s", d.in[:num.size]) } - return Token{}, d.newSyntaxError("invalid field name: %s", errRegexp.Find(d.in)) + return Token{}, d.newSyntaxError("invalid field name: %s", errId(d.in)) } // parseTypeName parses Any type URL or extension field name. The name is @@ -571,7 +570,7 @@ func (d *Decoder) parseScalar() (Token, error) { return tok, nil } - return Token{}, d.newSyntaxError("invalid scalar value: %s", errRegexp.Find(d.in)) + return Token{}, d.newSyntaxError("invalid scalar value: %s", errId(d.in)) } // parseLiteralValue parses a literal value. A literal value is used for @@ -653,8 +652,29 @@ func consume(b []byte, n int) []byte { return b } -// Any sequence that looks like a non-delimiter (for error reporting). -var errRegexp = regexp.MustCompile(`^([-+._a-zA-Z0-9\/]+|.)`) +// errId extracts a byte sequence that looks like an invalid ID +// (for the purposes of error reporting). +func errId(seq []byte) []byte { + const maxLen = 32 + for i := 0; i < len(seq); { + if i > maxLen { + return append(seq[:i:i], "…"...) + } + r, size := utf8.DecodeRune(seq[i:]) + if r > utf8.RuneSelf || (r != '/' && isDelim(byte(r))) { + if i == 0 { + // Either the first byte is invalid UTF-8 or a + // delimiter, or the first rune is non-ASCII. + // Return it as-is. + i = size + } + return seq[:i:i] + } + i += size + } + // No delimiter found. + return seq +} // isDelim returns true if given byte is a delimiter character. func isDelim(c byte) bool { diff --git a/vendor/google.golang.org/protobuf/internal/encoding/text/decode_number.go b/vendor/google.golang.org/protobuf/internal/encoding/text/decode_number.go index f2d90b78..81a5d8c8 100644 --- a/vendor/google.golang.org/protobuf/internal/encoding/text/decode_number.go +++ b/vendor/google.golang.org/protobuf/internal/encoding/text/decode_number.go @@ -50,8 +50,10 @@ type number struct { // parseNumber constructs a number object from given input. It allows for the // following patterns: -// integer: ^-?([1-9][0-9]*|0[xX][0-9a-fA-F]+|0[0-7]*) -// float: ^-?((0|[1-9][0-9]*)?([.][0-9]*)?([eE][+-]?[0-9]+)?[fF]?) +// +// integer: ^-?([1-9][0-9]*|0[xX][0-9a-fA-F]+|0[0-7]*) +// float: ^-?((0|[1-9][0-9]*)?([.][0-9]*)?([eE][+-]?[0-9]+)?[fF]?) +// // It also returns the number of parsed bytes for the given number, 0 if it is // not a number. func parseNumber(input []byte) number { diff --git a/vendor/google.golang.org/protobuf/internal/encoding/text/doc.go b/vendor/google.golang.org/protobuf/internal/encoding/text/doc.go index 0ce8d6fb..7ae6c2a3 100644 --- a/vendor/google.golang.org/protobuf/internal/encoding/text/doc.go +++ b/vendor/google.golang.org/protobuf/internal/encoding/text/doc.go @@ -24,6 +24,6 @@ // the Go implementation should as well. // // The text format is almost a superset of JSON except: -// * message keys are not quoted strings, but identifiers -// * the top-level value must be a message without the delimiters +// - message keys are not quoted strings, but identifiers +// - the top-level value must be a message without the delimiters package text diff --git a/vendor/google.golang.org/protobuf/internal/filedesc/build.go b/vendor/google.golang.org/protobuf/internal/filedesc/build.go index b293b694..7cac1c19 100644 --- a/vendor/google.golang.org/protobuf/internal/filedesc/build.go +++ b/vendor/google.golang.org/protobuf/internal/filedesc/build.go @@ -12,8 +12,7 @@ import ( "google.golang.org/protobuf/encoding/protowire" "google.golang.org/protobuf/internal/genid" "google.golang.org/protobuf/reflect/protoreflect" - pref "google.golang.org/protobuf/reflect/protoreflect" - preg "google.golang.org/protobuf/reflect/protoregistry" + "google.golang.org/protobuf/reflect/protoregistry" ) // Builder construct a protoreflect.FileDescriptor from the raw descriptor. @@ -38,7 +37,7 @@ type Builder struct { // TypeResolver resolves extension field types for descriptor options. // If nil, it uses protoregistry.GlobalTypes. TypeResolver interface { - preg.ExtensionTypeResolver + protoregistry.ExtensionTypeResolver } // FileRegistry is use to lookup file, enum, and message dependencies. @@ -46,8 +45,8 @@ type Builder struct { // If nil, it uses protoregistry.GlobalFiles. FileRegistry interface { FindFileByPath(string) (protoreflect.FileDescriptor, error) - FindDescriptorByName(pref.FullName) (pref.Descriptor, error) - RegisterFile(pref.FileDescriptor) error + FindDescriptorByName(protoreflect.FullName) (protoreflect.Descriptor, error) + RegisterFile(protoreflect.FileDescriptor) error } } @@ -55,8 +54,8 @@ type Builder struct { // If so, it permits looking up an enum or message dependency based on the // sub-list and element index into filetype.Builder.DependencyIndexes. type resolverByIndex interface { - FindEnumByIndex(int32, int32, []Enum, []Message) pref.EnumDescriptor - FindMessageByIndex(int32, int32, []Enum, []Message) pref.MessageDescriptor + FindEnumByIndex(int32, int32, []Enum, []Message) protoreflect.EnumDescriptor + FindMessageByIndex(int32, int32, []Enum, []Message) protoreflect.MessageDescriptor } // Indexes of each sub-list in filetype.Builder.DependencyIndexes. @@ -70,7 +69,7 @@ const ( // Out is the output of the Builder. type Out struct { - File pref.FileDescriptor + File protoreflect.FileDescriptor // Enums is all enum descriptors in "flattened ordering". Enums []Enum @@ -97,10 +96,10 @@ func (db Builder) Build() (out Out) { // Initialize resolvers and registries if unpopulated. if db.TypeResolver == nil { - db.TypeResolver = preg.GlobalTypes + db.TypeResolver = protoregistry.GlobalTypes } if db.FileRegistry == nil { - db.FileRegistry = preg.GlobalFiles + db.FileRegistry = protoregistry.GlobalFiles } fd := newRawFile(db) diff --git a/vendor/google.golang.org/protobuf/internal/filedesc/desc.go b/vendor/google.golang.org/protobuf/internal/filedesc/desc.go index 98ab142a..7c3689ba 100644 --- a/vendor/google.golang.org/protobuf/internal/filedesc/desc.go +++ b/vendor/google.golang.org/protobuf/internal/filedesc/desc.go @@ -17,7 +17,7 @@ import ( "google.golang.org/protobuf/internal/genid" "google.golang.org/protobuf/internal/pragma" "google.golang.org/protobuf/internal/strs" - pref "google.golang.org/protobuf/reflect/protoreflect" + "google.golang.org/protobuf/reflect/protoreflect" "google.golang.org/protobuf/reflect/protoregistry" ) @@ -43,9 +43,9 @@ type ( L2 *FileL2 } FileL1 struct { - Syntax pref.Syntax + Syntax protoreflect.Syntax Path string - Package pref.FullName + Package protoreflect.FullName Enums Enums Messages Messages @@ -53,36 +53,36 @@ type ( Services Services } FileL2 struct { - Options func() pref.ProtoMessage + Options func() protoreflect.ProtoMessage Imports FileImports Locations SourceLocations } ) -func (fd *File) ParentFile() pref.FileDescriptor { return fd } -func (fd *File) Parent() pref.Descriptor { return nil } -func (fd *File) Index() int { return 0 } -func (fd *File) Syntax() pref.Syntax { return fd.L1.Syntax } -func (fd *File) Name() pref.Name { return fd.L1.Package.Name() } -func (fd *File) FullName() pref.FullName { return fd.L1.Package } -func (fd *File) IsPlaceholder() bool { return false } -func (fd *File) Options() pref.ProtoMessage { +func (fd *File) ParentFile() protoreflect.FileDescriptor { return fd } +func (fd *File) Parent() protoreflect.Descriptor { return nil } +func (fd *File) Index() int { return 0 } +func (fd *File) Syntax() protoreflect.Syntax { return fd.L1.Syntax } +func (fd *File) Name() protoreflect.Name { return fd.L1.Package.Name() } +func (fd *File) FullName() protoreflect.FullName { return fd.L1.Package } +func (fd *File) IsPlaceholder() bool { return false } +func (fd *File) Options() protoreflect.ProtoMessage { if f := fd.lazyInit().Options; f != nil { return f() } return descopts.File } -func (fd *File) Path() string { return fd.L1.Path } -func (fd *File) Package() pref.FullName { return fd.L1.Package } -func (fd *File) Imports() pref.FileImports { return &fd.lazyInit().Imports } -func (fd *File) Enums() pref.EnumDescriptors { return &fd.L1.Enums } -func (fd *File) Messages() pref.MessageDescriptors { return &fd.L1.Messages } -func (fd *File) Extensions() pref.ExtensionDescriptors { return &fd.L1.Extensions } -func (fd *File) Services() pref.ServiceDescriptors { return &fd.L1.Services } -func (fd *File) SourceLocations() pref.SourceLocations { return &fd.lazyInit().Locations } -func (fd *File) Format(s fmt.State, r rune) { descfmt.FormatDesc(s, r, fd) } -func (fd *File) ProtoType(pref.FileDescriptor) {} -func (fd *File) ProtoInternal(pragma.DoNotImplement) {} +func (fd *File) Path() string { return fd.L1.Path } +func (fd *File) Package() protoreflect.FullName { return fd.L1.Package } +func (fd *File) Imports() protoreflect.FileImports { return &fd.lazyInit().Imports } +func (fd *File) Enums() protoreflect.EnumDescriptors { return &fd.L1.Enums } +func (fd *File) Messages() protoreflect.MessageDescriptors { return &fd.L1.Messages } +func (fd *File) Extensions() protoreflect.ExtensionDescriptors { return &fd.L1.Extensions } +func (fd *File) Services() protoreflect.ServiceDescriptors { return &fd.L1.Services } +func (fd *File) SourceLocations() protoreflect.SourceLocations { return &fd.lazyInit().Locations } +func (fd *File) Format(s fmt.State, r rune) { descfmt.FormatDesc(s, r, fd) } +func (fd *File) ProtoType(protoreflect.FileDescriptor) {} +func (fd *File) ProtoInternal(pragma.DoNotImplement) {} func (fd *File) lazyInit() *FileL2 { if atomic.LoadUint32(&fd.once) == 0 { @@ -119,7 +119,7 @@ type ( eagerValues bool // controls whether EnumL2.Values is already populated } EnumL2 struct { - Options func() pref.ProtoMessage + Options func() protoreflect.ProtoMessage Values EnumValues ReservedNames Names ReservedRanges EnumRanges @@ -130,41 +130,41 @@ type ( L1 EnumValueL1 } EnumValueL1 struct { - Options func() pref.ProtoMessage - Number pref.EnumNumber + Options func() protoreflect.ProtoMessage + Number protoreflect.EnumNumber } ) -func (ed *Enum) Options() pref.ProtoMessage { +func (ed *Enum) Options() protoreflect.ProtoMessage { if f := ed.lazyInit().Options; f != nil { return f() } return descopts.Enum } -func (ed *Enum) Values() pref.EnumValueDescriptors { +func (ed *Enum) Values() protoreflect.EnumValueDescriptors { if ed.L1.eagerValues { return &ed.L2.Values } return &ed.lazyInit().Values } -func (ed *Enum) ReservedNames() pref.Names { return &ed.lazyInit().ReservedNames } -func (ed *Enum) ReservedRanges() pref.EnumRanges { return &ed.lazyInit().ReservedRanges } -func (ed *Enum) Format(s fmt.State, r rune) { descfmt.FormatDesc(s, r, ed) } -func (ed *Enum) ProtoType(pref.EnumDescriptor) {} +func (ed *Enum) ReservedNames() protoreflect.Names { return &ed.lazyInit().ReservedNames } +func (ed *Enum) ReservedRanges() protoreflect.EnumRanges { return &ed.lazyInit().ReservedRanges } +func (ed *Enum) Format(s fmt.State, r rune) { descfmt.FormatDesc(s, r, ed) } +func (ed *Enum) ProtoType(protoreflect.EnumDescriptor) {} func (ed *Enum) lazyInit() *EnumL2 { ed.L0.ParentFile.lazyInit() // implicitly initializes L2 return ed.L2 } -func (ed *EnumValue) Options() pref.ProtoMessage { +func (ed *EnumValue) Options() protoreflect.ProtoMessage { if f := ed.L1.Options; f != nil { return f() } return descopts.EnumValue } -func (ed *EnumValue) Number() pref.EnumNumber { return ed.L1.Number } -func (ed *EnumValue) Format(s fmt.State, r rune) { descfmt.FormatDesc(s, r, ed) } -func (ed *EnumValue) ProtoType(pref.EnumValueDescriptor) {} +func (ed *EnumValue) Number() protoreflect.EnumNumber { return ed.L1.Number } +func (ed *EnumValue) Format(s fmt.State, r rune) { descfmt.FormatDesc(s, r, ed) } +func (ed *EnumValue) ProtoType(protoreflect.EnumValueDescriptor) {} type ( Message struct { @@ -180,14 +180,14 @@ type ( IsMessageSet bool // promoted from google.protobuf.MessageOptions } MessageL2 struct { - Options func() pref.ProtoMessage + Options func() protoreflect.ProtoMessage Fields Fields Oneofs Oneofs ReservedNames Names ReservedRanges FieldRanges RequiredNumbers FieldNumbers // must be consistent with Fields.Cardinality ExtensionRanges FieldRanges - ExtensionRangeOptions []func() pref.ProtoMessage // must be same length as ExtensionRanges + ExtensionRangeOptions []func() protoreflect.ProtoMessage // must be same length as ExtensionRanges } Field struct { @@ -195,10 +195,10 @@ type ( L1 FieldL1 } FieldL1 struct { - Options func() pref.ProtoMessage - Number pref.FieldNumber - Cardinality pref.Cardinality // must be consistent with Message.RequiredNumbers - Kind pref.Kind + Options func() protoreflect.ProtoMessage + Number protoreflect.FieldNumber + Cardinality protoreflect.Cardinality // must be consistent with Message.RequiredNumbers + Kind protoreflect.Kind StringName stringName IsProto3Optional bool // promoted from google.protobuf.FieldDescriptorProto IsWeak bool // promoted from google.protobuf.FieldOptions @@ -207,9 +207,9 @@ type ( HasEnforceUTF8 bool // promoted from google.protobuf.FieldOptions EnforceUTF8 bool // promoted from google.protobuf.FieldOptions Default defaultValue - ContainingOneof pref.OneofDescriptor // must be consistent with Message.Oneofs.Fields - Enum pref.EnumDescriptor - Message pref.MessageDescriptor + ContainingOneof protoreflect.OneofDescriptor // must be consistent with Message.Oneofs.Fields + Enum protoreflect.EnumDescriptor + Message protoreflect.MessageDescriptor } Oneof struct { @@ -217,35 +217,35 @@ type ( L1 OneofL1 } OneofL1 struct { - Options func() pref.ProtoMessage + Options func() protoreflect.ProtoMessage Fields OneofFields // must be consistent with Message.Fields.ContainingOneof } ) -func (md *Message) Options() pref.ProtoMessage { +func (md *Message) Options() protoreflect.ProtoMessage { if f := md.lazyInit().Options; f != nil { return f() } return descopts.Message } -func (md *Message) IsMapEntry() bool { return md.L1.IsMapEntry } -func (md *Message) Fields() pref.FieldDescriptors { return &md.lazyInit().Fields } -func (md *Message) Oneofs() pref.OneofDescriptors { return &md.lazyInit().Oneofs } -func (md *Message) ReservedNames() pref.Names { return &md.lazyInit().ReservedNames } -func (md *Message) ReservedRanges() pref.FieldRanges { return &md.lazyInit().ReservedRanges } -func (md *Message) RequiredNumbers() pref.FieldNumbers { return &md.lazyInit().RequiredNumbers } -func (md *Message) ExtensionRanges() pref.FieldRanges { return &md.lazyInit().ExtensionRanges } -func (md *Message) ExtensionRangeOptions(i int) pref.ProtoMessage { +func (md *Message) IsMapEntry() bool { return md.L1.IsMapEntry } +func (md *Message) Fields() protoreflect.FieldDescriptors { return &md.lazyInit().Fields } +func (md *Message) Oneofs() protoreflect.OneofDescriptors { return &md.lazyInit().Oneofs } +func (md *Message) ReservedNames() protoreflect.Names { return &md.lazyInit().ReservedNames } +func (md *Message) ReservedRanges() protoreflect.FieldRanges { return &md.lazyInit().ReservedRanges } +func (md *Message) RequiredNumbers() protoreflect.FieldNumbers { return &md.lazyInit().RequiredNumbers } +func (md *Message) ExtensionRanges() protoreflect.FieldRanges { return &md.lazyInit().ExtensionRanges } +func (md *Message) ExtensionRangeOptions(i int) protoreflect.ProtoMessage { if f := md.lazyInit().ExtensionRangeOptions[i]; f != nil { return f() } return descopts.ExtensionRange } -func (md *Message) Enums() pref.EnumDescriptors { return &md.L1.Enums } -func (md *Message) Messages() pref.MessageDescriptors { return &md.L1.Messages } -func (md *Message) Extensions() pref.ExtensionDescriptors { return &md.L1.Extensions } -func (md *Message) ProtoType(pref.MessageDescriptor) {} -func (md *Message) Format(s fmt.State, r rune) { descfmt.FormatDesc(s, r, md) } +func (md *Message) Enums() protoreflect.EnumDescriptors { return &md.L1.Enums } +func (md *Message) Messages() protoreflect.MessageDescriptors { return &md.L1.Messages } +func (md *Message) Extensions() protoreflect.ExtensionDescriptors { return &md.L1.Extensions } +func (md *Message) ProtoType(protoreflect.MessageDescriptor) {} +func (md *Message) Format(s fmt.State, r rune) { descfmt.FormatDesc(s, r, md) } func (md *Message) lazyInit() *MessageL2 { md.L0.ParentFile.lazyInit() // implicitly initializes L2 return md.L2 @@ -260,28 +260,28 @@ func (md *Message) IsMessageSet() bool { return md.L1.IsMessageSet } -func (fd *Field) Options() pref.ProtoMessage { +func (fd *Field) Options() protoreflect.ProtoMessage { if f := fd.L1.Options; f != nil { return f() } return descopts.Field } -func (fd *Field) Number() pref.FieldNumber { return fd.L1.Number } -func (fd *Field) Cardinality() pref.Cardinality { return fd.L1.Cardinality } -func (fd *Field) Kind() pref.Kind { return fd.L1.Kind } -func (fd *Field) HasJSONName() bool { return fd.L1.StringName.hasJSON } -func (fd *Field) JSONName() string { return fd.L1.StringName.getJSON(fd) } -func (fd *Field) TextName() string { return fd.L1.StringName.getText(fd) } +func (fd *Field) Number() protoreflect.FieldNumber { return fd.L1.Number } +func (fd *Field) Cardinality() protoreflect.Cardinality { return fd.L1.Cardinality } +func (fd *Field) Kind() protoreflect.Kind { return fd.L1.Kind } +func (fd *Field) HasJSONName() bool { return fd.L1.StringName.hasJSON } +func (fd *Field) JSONName() string { return fd.L1.StringName.getJSON(fd) } +func (fd *Field) TextName() string { return fd.L1.StringName.getText(fd) } func (fd *Field) HasPresence() bool { - return fd.L1.Cardinality != pref.Repeated && (fd.L0.ParentFile.L1.Syntax == pref.Proto2 || fd.L1.Message != nil || fd.L1.ContainingOneof != nil) + return fd.L1.Cardinality != protoreflect.Repeated && (fd.L0.ParentFile.L1.Syntax == protoreflect.Proto2 || fd.L1.Message != nil || fd.L1.ContainingOneof != nil) } func (fd *Field) HasOptionalKeyword() bool { - return (fd.L0.ParentFile.L1.Syntax == pref.Proto2 && fd.L1.Cardinality == pref.Optional && fd.L1.ContainingOneof == nil) || fd.L1.IsProto3Optional + return (fd.L0.ParentFile.L1.Syntax == protoreflect.Proto2 && fd.L1.Cardinality == protoreflect.Optional && fd.L1.ContainingOneof == nil) || fd.L1.IsProto3Optional } func (fd *Field) IsPacked() bool { - if !fd.L1.HasPacked && fd.L0.ParentFile.L1.Syntax != pref.Proto2 && fd.L1.Cardinality == pref.Repeated { + if !fd.L1.HasPacked && fd.L0.ParentFile.L1.Syntax != protoreflect.Proto2 && fd.L1.Cardinality == protoreflect.Repeated { switch fd.L1.Kind { - case pref.StringKind, pref.BytesKind, pref.MessageKind, pref.GroupKind: + case protoreflect.StringKind, protoreflect.BytesKind, protoreflect.MessageKind, protoreflect.GroupKind: default: return true } @@ -290,40 +290,40 @@ func (fd *Field) IsPacked() bool { } func (fd *Field) IsExtension() bool { return false } func (fd *Field) IsWeak() bool { return fd.L1.IsWeak } -func (fd *Field) IsList() bool { return fd.Cardinality() == pref.Repeated && !fd.IsMap() } +func (fd *Field) IsList() bool { return fd.Cardinality() == protoreflect.Repeated && !fd.IsMap() } func (fd *Field) IsMap() bool { return fd.Message() != nil && fd.Message().IsMapEntry() } -func (fd *Field) MapKey() pref.FieldDescriptor { +func (fd *Field) MapKey() protoreflect.FieldDescriptor { if !fd.IsMap() { return nil } return fd.Message().Fields().ByNumber(genid.MapEntry_Key_field_number) } -func (fd *Field) MapValue() pref.FieldDescriptor { +func (fd *Field) MapValue() protoreflect.FieldDescriptor { if !fd.IsMap() { return nil } return fd.Message().Fields().ByNumber(genid.MapEntry_Value_field_number) } -func (fd *Field) HasDefault() bool { return fd.L1.Default.has } -func (fd *Field) Default() pref.Value { return fd.L1.Default.get(fd) } -func (fd *Field) DefaultEnumValue() pref.EnumValueDescriptor { return fd.L1.Default.enum } -func (fd *Field) ContainingOneof() pref.OneofDescriptor { return fd.L1.ContainingOneof } -func (fd *Field) ContainingMessage() pref.MessageDescriptor { - return fd.L0.Parent.(pref.MessageDescriptor) +func (fd *Field) HasDefault() bool { return fd.L1.Default.has } +func (fd *Field) Default() protoreflect.Value { return fd.L1.Default.get(fd) } +func (fd *Field) DefaultEnumValue() protoreflect.EnumValueDescriptor { return fd.L1.Default.enum } +func (fd *Field) ContainingOneof() protoreflect.OneofDescriptor { return fd.L1.ContainingOneof } +func (fd *Field) ContainingMessage() protoreflect.MessageDescriptor { + return fd.L0.Parent.(protoreflect.MessageDescriptor) } -func (fd *Field) Enum() pref.EnumDescriptor { +func (fd *Field) Enum() protoreflect.EnumDescriptor { return fd.L1.Enum } -func (fd *Field) Message() pref.MessageDescriptor { +func (fd *Field) Message() protoreflect.MessageDescriptor { if fd.L1.IsWeak { if d, _ := protoregistry.GlobalFiles.FindDescriptorByName(fd.L1.Message.FullName()); d != nil { - return d.(pref.MessageDescriptor) + return d.(protoreflect.MessageDescriptor) } } return fd.L1.Message } -func (fd *Field) Format(s fmt.State, r rune) { descfmt.FormatDesc(s, r, fd) } -func (fd *Field) ProtoType(pref.FieldDescriptor) {} +func (fd *Field) Format(s fmt.State, r rune) { descfmt.FormatDesc(s, r, fd) } +func (fd *Field) ProtoType(protoreflect.FieldDescriptor) {} // EnforceUTF8 is a pseudo-internal API to determine whether to enforce UTF-8 // validation for the string field. This exists for Google-internal use only @@ -336,21 +336,21 @@ func (fd *Field) EnforceUTF8() bool { if fd.L1.HasEnforceUTF8 { return fd.L1.EnforceUTF8 } - return fd.L0.ParentFile.L1.Syntax == pref.Proto3 + return fd.L0.ParentFile.L1.Syntax == protoreflect.Proto3 } func (od *Oneof) IsSynthetic() bool { - return od.L0.ParentFile.L1.Syntax == pref.Proto3 && len(od.L1.Fields.List) == 1 && od.L1.Fields.List[0].HasOptionalKeyword() + return od.L0.ParentFile.L1.Syntax == protoreflect.Proto3 && len(od.L1.Fields.List) == 1 && od.L1.Fields.List[0].HasOptionalKeyword() } -func (od *Oneof) Options() pref.ProtoMessage { +func (od *Oneof) Options() protoreflect.ProtoMessage { if f := od.L1.Options; f != nil { return f() } return descopts.Oneof } -func (od *Oneof) Fields() pref.FieldDescriptors { return &od.L1.Fields } -func (od *Oneof) Format(s fmt.State, r rune) { descfmt.FormatDesc(s, r, od) } -func (od *Oneof) ProtoType(pref.OneofDescriptor) {} +func (od *Oneof) Fields() protoreflect.FieldDescriptors { return &od.L1.Fields } +func (od *Oneof) Format(s fmt.State, r rune) { descfmt.FormatDesc(s, r, od) } +func (od *Oneof) ProtoType(protoreflect.OneofDescriptor) {} type ( Extension struct { @@ -359,55 +359,57 @@ type ( L2 *ExtensionL2 // protected by fileDesc.once } ExtensionL1 struct { - Number pref.FieldNumber - Extendee pref.MessageDescriptor - Cardinality pref.Cardinality - Kind pref.Kind + Number protoreflect.FieldNumber + Extendee protoreflect.MessageDescriptor + Cardinality protoreflect.Cardinality + Kind protoreflect.Kind } ExtensionL2 struct { - Options func() pref.ProtoMessage + Options func() protoreflect.ProtoMessage StringName stringName IsProto3Optional bool // promoted from google.protobuf.FieldDescriptorProto IsPacked bool // promoted from google.protobuf.FieldOptions Default defaultValue - Enum pref.EnumDescriptor - Message pref.MessageDescriptor + Enum protoreflect.EnumDescriptor + Message protoreflect.MessageDescriptor } ) -func (xd *Extension) Options() pref.ProtoMessage { +func (xd *Extension) Options() protoreflect.ProtoMessage { if f := xd.lazyInit().Options; f != nil { return f() } return descopts.Field } -func (xd *Extension) Number() pref.FieldNumber { return xd.L1.Number } -func (xd *Extension) Cardinality() pref.Cardinality { return xd.L1.Cardinality } -func (xd *Extension) Kind() pref.Kind { return xd.L1.Kind } -func (xd *Extension) HasJSONName() bool { return xd.lazyInit().StringName.hasJSON } -func (xd *Extension) JSONName() string { return xd.lazyInit().StringName.getJSON(xd) } -func (xd *Extension) TextName() string { return xd.lazyInit().StringName.getText(xd) } -func (xd *Extension) HasPresence() bool { return xd.L1.Cardinality != pref.Repeated } +func (xd *Extension) Number() protoreflect.FieldNumber { return xd.L1.Number } +func (xd *Extension) Cardinality() protoreflect.Cardinality { return xd.L1.Cardinality } +func (xd *Extension) Kind() protoreflect.Kind { return xd.L1.Kind } +func (xd *Extension) HasJSONName() bool { return xd.lazyInit().StringName.hasJSON } +func (xd *Extension) JSONName() string { return xd.lazyInit().StringName.getJSON(xd) } +func (xd *Extension) TextName() string { return xd.lazyInit().StringName.getText(xd) } +func (xd *Extension) HasPresence() bool { return xd.L1.Cardinality != protoreflect.Repeated } func (xd *Extension) HasOptionalKeyword() bool { - return (xd.L0.ParentFile.L1.Syntax == pref.Proto2 && xd.L1.Cardinality == pref.Optional) || xd.lazyInit().IsProto3Optional + return (xd.L0.ParentFile.L1.Syntax == protoreflect.Proto2 && xd.L1.Cardinality == protoreflect.Optional) || xd.lazyInit().IsProto3Optional } -func (xd *Extension) IsPacked() bool { return xd.lazyInit().IsPacked } -func (xd *Extension) IsExtension() bool { return true } -func (xd *Extension) IsWeak() bool { return false } -func (xd *Extension) IsList() bool { return xd.Cardinality() == pref.Repeated } -func (xd *Extension) IsMap() bool { return false } -func (xd *Extension) MapKey() pref.FieldDescriptor { return nil } -func (xd *Extension) MapValue() pref.FieldDescriptor { return nil } -func (xd *Extension) HasDefault() bool { return xd.lazyInit().Default.has } -func (xd *Extension) Default() pref.Value { return xd.lazyInit().Default.get(xd) } -func (xd *Extension) DefaultEnumValue() pref.EnumValueDescriptor { return xd.lazyInit().Default.enum } -func (xd *Extension) ContainingOneof() pref.OneofDescriptor { return nil } -func (xd *Extension) ContainingMessage() pref.MessageDescriptor { return xd.L1.Extendee } -func (xd *Extension) Enum() pref.EnumDescriptor { return xd.lazyInit().Enum } -func (xd *Extension) Message() pref.MessageDescriptor { return xd.lazyInit().Message } -func (xd *Extension) Format(s fmt.State, r rune) { descfmt.FormatDesc(s, r, xd) } -func (xd *Extension) ProtoType(pref.FieldDescriptor) {} -func (xd *Extension) ProtoInternal(pragma.DoNotImplement) {} +func (xd *Extension) IsPacked() bool { return xd.lazyInit().IsPacked } +func (xd *Extension) IsExtension() bool { return true } +func (xd *Extension) IsWeak() bool { return false } +func (xd *Extension) IsList() bool { return xd.Cardinality() == protoreflect.Repeated } +func (xd *Extension) IsMap() bool { return false } +func (xd *Extension) MapKey() protoreflect.FieldDescriptor { return nil } +func (xd *Extension) MapValue() protoreflect.FieldDescriptor { return nil } +func (xd *Extension) HasDefault() bool { return xd.lazyInit().Default.has } +func (xd *Extension) Default() protoreflect.Value { return xd.lazyInit().Default.get(xd) } +func (xd *Extension) DefaultEnumValue() protoreflect.EnumValueDescriptor { + return xd.lazyInit().Default.enum +} +func (xd *Extension) ContainingOneof() protoreflect.OneofDescriptor { return nil } +func (xd *Extension) ContainingMessage() protoreflect.MessageDescriptor { return xd.L1.Extendee } +func (xd *Extension) Enum() protoreflect.EnumDescriptor { return xd.lazyInit().Enum } +func (xd *Extension) Message() protoreflect.MessageDescriptor { return xd.lazyInit().Message } +func (xd *Extension) Format(s fmt.State, r rune) { descfmt.FormatDesc(s, r, xd) } +func (xd *Extension) ProtoType(protoreflect.FieldDescriptor) {} +func (xd *Extension) ProtoInternal(pragma.DoNotImplement) {} func (xd *Extension) lazyInit() *ExtensionL2 { xd.L0.ParentFile.lazyInit() // implicitly initializes L2 return xd.L2 @@ -421,7 +423,7 @@ type ( } ServiceL1 struct{} ServiceL2 struct { - Options func() pref.ProtoMessage + Options func() protoreflect.ProtoMessage Methods Methods } @@ -430,48 +432,48 @@ type ( L1 MethodL1 } MethodL1 struct { - Options func() pref.ProtoMessage - Input pref.MessageDescriptor - Output pref.MessageDescriptor + Options func() protoreflect.ProtoMessage + Input protoreflect.MessageDescriptor + Output protoreflect.MessageDescriptor IsStreamingClient bool IsStreamingServer bool } ) -func (sd *Service) Options() pref.ProtoMessage { +func (sd *Service) Options() protoreflect.ProtoMessage { if f := sd.lazyInit().Options; f != nil { return f() } return descopts.Service } -func (sd *Service) Methods() pref.MethodDescriptors { return &sd.lazyInit().Methods } -func (sd *Service) Format(s fmt.State, r rune) { descfmt.FormatDesc(s, r, sd) } -func (sd *Service) ProtoType(pref.ServiceDescriptor) {} -func (sd *Service) ProtoInternal(pragma.DoNotImplement) {} +func (sd *Service) Methods() protoreflect.MethodDescriptors { return &sd.lazyInit().Methods } +func (sd *Service) Format(s fmt.State, r rune) { descfmt.FormatDesc(s, r, sd) } +func (sd *Service) ProtoType(protoreflect.ServiceDescriptor) {} +func (sd *Service) ProtoInternal(pragma.DoNotImplement) {} func (sd *Service) lazyInit() *ServiceL2 { sd.L0.ParentFile.lazyInit() // implicitly initializes L2 return sd.L2 } -func (md *Method) Options() pref.ProtoMessage { +func (md *Method) Options() protoreflect.ProtoMessage { if f := md.L1.Options; f != nil { return f() } return descopts.Method } -func (md *Method) Input() pref.MessageDescriptor { return md.L1.Input } -func (md *Method) Output() pref.MessageDescriptor { return md.L1.Output } -func (md *Method) IsStreamingClient() bool { return md.L1.IsStreamingClient } -func (md *Method) IsStreamingServer() bool { return md.L1.IsStreamingServer } -func (md *Method) Format(s fmt.State, r rune) { descfmt.FormatDesc(s, r, md) } -func (md *Method) ProtoType(pref.MethodDescriptor) {} -func (md *Method) ProtoInternal(pragma.DoNotImplement) {} +func (md *Method) Input() protoreflect.MessageDescriptor { return md.L1.Input } +func (md *Method) Output() protoreflect.MessageDescriptor { return md.L1.Output } +func (md *Method) IsStreamingClient() bool { return md.L1.IsStreamingClient } +func (md *Method) IsStreamingServer() bool { return md.L1.IsStreamingServer } +func (md *Method) Format(s fmt.State, r rune) { descfmt.FormatDesc(s, r, md) } +func (md *Method) ProtoType(protoreflect.MethodDescriptor) {} +func (md *Method) ProtoInternal(pragma.DoNotImplement) {} // Surrogate files are can be used to create standalone descriptors // where the syntax is only information derived from the parent file. var ( - SurrogateProto2 = &File{L1: FileL1{Syntax: pref.Proto2}, L2: &FileL2{}} - SurrogateProto3 = &File{L1: FileL1{Syntax: pref.Proto3}, L2: &FileL2{}} + SurrogateProto2 = &File{L1: FileL1{Syntax: protoreflect.Proto2}, L2: &FileL2{}} + SurrogateProto3 = &File{L1: FileL1{Syntax: protoreflect.Proto3}, L2: &FileL2{}} ) type ( @@ -479,24 +481,24 @@ type ( L0 BaseL0 } BaseL0 struct { - FullName pref.FullName // must be populated - ParentFile *File // must be populated - Parent pref.Descriptor + FullName protoreflect.FullName // must be populated + ParentFile *File // must be populated + Parent protoreflect.Descriptor Index int } ) -func (d *Base) Name() pref.Name { return d.L0.FullName.Name() } -func (d *Base) FullName() pref.FullName { return d.L0.FullName } -func (d *Base) ParentFile() pref.FileDescriptor { +func (d *Base) Name() protoreflect.Name { return d.L0.FullName.Name() } +func (d *Base) FullName() protoreflect.FullName { return d.L0.FullName } +func (d *Base) ParentFile() protoreflect.FileDescriptor { if d.L0.ParentFile == SurrogateProto2 || d.L0.ParentFile == SurrogateProto3 { return nil // surrogate files are not real parents } return d.L0.ParentFile } -func (d *Base) Parent() pref.Descriptor { return d.L0.Parent } +func (d *Base) Parent() protoreflect.Descriptor { return d.L0.Parent } func (d *Base) Index() int { return d.L0.Index } -func (d *Base) Syntax() pref.Syntax { return d.L0.ParentFile.Syntax() } +func (d *Base) Syntax() protoreflect.Syntax { return d.L0.ParentFile.Syntax() } func (d *Base) IsPlaceholder() bool { return false } func (d *Base) ProtoInternal(pragma.DoNotImplement) {} @@ -513,7 +515,7 @@ func (s *stringName) InitJSON(name string) { s.nameJSON = name } -func (s *stringName) lazyInit(fd pref.FieldDescriptor) *stringName { +func (s *stringName) lazyInit(fd protoreflect.FieldDescriptor) *stringName { s.once.Do(func() { if fd.IsExtension() { // For extensions, JSON and text are formatted the same way. @@ -533,7 +535,7 @@ func (s *stringName) lazyInit(fd pref.FieldDescriptor) *stringName { // Format the text name. s.nameText = string(fd.Name()) - if fd.Kind() == pref.GroupKind { + if fd.Kind() == protoreflect.GroupKind { s.nameText = string(fd.Message().Name()) } } @@ -541,10 +543,10 @@ func (s *stringName) lazyInit(fd pref.FieldDescriptor) *stringName { return s } -func (s *stringName) getJSON(fd pref.FieldDescriptor) string { return s.lazyInit(fd).nameJSON } -func (s *stringName) getText(fd pref.FieldDescriptor) string { return s.lazyInit(fd).nameText } +func (s *stringName) getJSON(fd protoreflect.FieldDescriptor) string { return s.lazyInit(fd).nameJSON } +func (s *stringName) getText(fd protoreflect.FieldDescriptor) string { return s.lazyInit(fd).nameText } -func DefaultValue(v pref.Value, ev pref.EnumValueDescriptor) defaultValue { +func DefaultValue(v protoreflect.Value, ev protoreflect.EnumValueDescriptor) defaultValue { dv := defaultValue{has: v.IsValid(), val: v, enum: ev} if b, ok := v.Interface().([]byte); ok { // Store a copy of the default bytes, so that we can detect @@ -554,9 +556,9 @@ func DefaultValue(v pref.Value, ev pref.EnumValueDescriptor) defaultValue { return dv } -func unmarshalDefault(b []byte, k pref.Kind, pf *File, ed pref.EnumDescriptor) defaultValue { - var evs pref.EnumValueDescriptors - if k == pref.EnumKind { +func unmarshalDefault(b []byte, k protoreflect.Kind, pf *File, ed protoreflect.EnumDescriptor) defaultValue { + var evs protoreflect.EnumValueDescriptors + if k == protoreflect.EnumKind { // If the enum is declared within the same file, be careful not to // blindly call the Values method, lest we bind ourselves in a deadlock. if e, ok := ed.(*Enum); ok && e.L0.ParentFile == pf { @@ -567,9 +569,9 @@ func unmarshalDefault(b []byte, k pref.Kind, pf *File, ed pref.EnumDescriptor) d // If we are unable to resolve the enum dependency, use a placeholder // enum value since we will not be able to parse the default value. - if ed.IsPlaceholder() && pref.Name(b).IsValid() { - v := pref.ValueOfEnum(0) - ev := PlaceholderEnumValue(ed.FullName().Parent().Append(pref.Name(b))) + if ed.IsPlaceholder() && protoreflect.Name(b).IsValid() { + v := protoreflect.ValueOfEnum(0) + ev := PlaceholderEnumValue(ed.FullName().Parent().Append(protoreflect.Name(b))) return DefaultValue(v, ev) } } @@ -583,41 +585,41 @@ func unmarshalDefault(b []byte, k pref.Kind, pf *File, ed pref.EnumDescriptor) d type defaultValue struct { has bool - val pref.Value - enum pref.EnumValueDescriptor + val protoreflect.Value + enum protoreflect.EnumValueDescriptor bytes []byte } -func (dv *defaultValue) get(fd pref.FieldDescriptor) pref.Value { +func (dv *defaultValue) get(fd protoreflect.FieldDescriptor) protoreflect.Value { // Return the zero value as the default if unpopulated. if !dv.has { - if fd.Cardinality() == pref.Repeated { - return pref.Value{} + if fd.Cardinality() == protoreflect.Repeated { + return protoreflect.Value{} } switch fd.Kind() { - case pref.BoolKind: - return pref.ValueOfBool(false) - case pref.Int32Kind, pref.Sint32Kind, pref.Sfixed32Kind: - return pref.ValueOfInt32(0) - case pref.Int64Kind, pref.Sint64Kind, pref.Sfixed64Kind: - return pref.ValueOfInt64(0) - case pref.Uint32Kind, pref.Fixed32Kind: - return pref.ValueOfUint32(0) - case pref.Uint64Kind, pref.Fixed64Kind: - return pref.ValueOfUint64(0) - case pref.FloatKind: - return pref.ValueOfFloat32(0) - case pref.DoubleKind: - return pref.ValueOfFloat64(0) - case pref.StringKind: - return pref.ValueOfString("") - case pref.BytesKind: - return pref.ValueOfBytes(nil) - case pref.EnumKind: + case protoreflect.BoolKind: + return protoreflect.ValueOfBool(false) + case protoreflect.Int32Kind, protoreflect.Sint32Kind, protoreflect.Sfixed32Kind: + return protoreflect.ValueOfInt32(0) + case protoreflect.Int64Kind, protoreflect.Sint64Kind, protoreflect.Sfixed64Kind: + return protoreflect.ValueOfInt64(0) + case protoreflect.Uint32Kind, protoreflect.Fixed32Kind: + return protoreflect.ValueOfUint32(0) + case protoreflect.Uint64Kind, protoreflect.Fixed64Kind: + return protoreflect.ValueOfUint64(0) + case protoreflect.FloatKind: + return protoreflect.ValueOfFloat32(0) + case protoreflect.DoubleKind: + return protoreflect.ValueOfFloat64(0) + case protoreflect.StringKind: + return protoreflect.ValueOfString("") + case protoreflect.BytesKind: + return protoreflect.ValueOfBytes(nil) + case protoreflect.EnumKind: if evs := fd.Enum().Values(); evs.Len() > 0 { - return pref.ValueOfEnum(evs.Get(0).Number()) + return protoreflect.ValueOfEnum(evs.Get(0).Number()) } - return pref.ValueOfEnum(0) + return protoreflect.ValueOfEnum(0) } } diff --git a/vendor/google.golang.org/protobuf/internal/filedesc/desc_init.go b/vendor/google.golang.org/protobuf/internal/filedesc/desc_init.go index 66e1fee5..4a1584c9 100644 --- a/vendor/google.golang.org/protobuf/internal/filedesc/desc_init.go +++ b/vendor/google.golang.org/protobuf/internal/filedesc/desc_init.go @@ -10,7 +10,7 @@ import ( "google.golang.org/protobuf/encoding/protowire" "google.golang.org/protobuf/internal/genid" "google.golang.org/protobuf/internal/strs" - pref "google.golang.org/protobuf/reflect/protoreflect" + "google.golang.org/protobuf/reflect/protoreflect" ) // fileRaw is a data struct used when initializing a file descriptor from @@ -95,7 +95,7 @@ func (fd *File) unmarshalSeed(b []byte) { sb := getBuilder() defer putBuilder(sb) - var prevField pref.FieldNumber + var prevField protoreflect.FieldNumber var numEnums, numMessages, numExtensions, numServices int var posEnums, posMessages, posExtensions, posServices int b0 := b @@ -110,16 +110,16 @@ func (fd *File) unmarshalSeed(b []byte) { case genid.FileDescriptorProto_Syntax_field_number: switch string(v) { case "proto2": - fd.L1.Syntax = pref.Proto2 + fd.L1.Syntax = protoreflect.Proto2 case "proto3": - fd.L1.Syntax = pref.Proto3 + fd.L1.Syntax = protoreflect.Proto3 default: panic("invalid syntax") } case genid.FileDescriptorProto_Name_field_number: fd.L1.Path = sb.MakeString(v) case genid.FileDescriptorProto_Package_field_number: - fd.L1.Package = pref.FullName(sb.MakeString(v)) + fd.L1.Package = protoreflect.FullName(sb.MakeString(v)) case genid.FileDescriptorProto_EnumType_field_number: if prevField != genid.FileDescriptorProto_EnumType_field_number { if numEnums > 0 { @@ -163,7 +163,7 @@ func (fd *File) unmarshalSeed(b []byte) { // If syntax is missing, it is assumed to be proto2. if fd.L1.Syntax == 0 { - fd.L1.Syntax = pref.Proto2 + fd.L1.Syntax = protoreflect.Proto2 } // Must allocate all declarations before parsing each descriptor type @@ -219,7 +219,7 @@ func (fd *File) unmarshalSeed(b []byte) { } } -func (ed *Enum) unmarshalSeed(b []byte, sb *strs.Builder, pf *File, pd pref.Descriptor, i int) { +func (ed *Enum) unmarshalSeed(b []byte, sb *strs.Builder, pf *File, pd protoreflect.Descriptor, i int) { ed.L0.ParentFile = pf ed.L0.Parent = pd ed.L0.Index = i @@ -271,12 +271,12 @@ func (ed *Enum) unmarshalSeed(b []byte, sb *strs.Builder, pf *File, pd pref.Desc } } -func (md *Message) unmarshalSeed(b []byte, sb *strs.Builder, pf *File, pd pref.Descriptor, i int) { +func (md *Message) unmarshalSeed(b []byte, sb *strs.Builder, pf *File, pd protoreflect.Descriptor, i int) { md.L0.ParentFile = pf md.L0.Parent = pd md.L0.Index = i - var prevField pref.FieldNumber + var prevField protoreflect.FieldNumber var numEnums, numMessages, numExtensions int var posEnums, posMessages, posExtensions int b0 := b @@ -387,7 +387,7 @@ func (md *Message) unmarshalSeedOptions(b []byte) { } } -func (xd *Extension) unmarshalSeed(b []byte, sb *strs.Builder, pf *File, pd pref.Descriptor, i int) { +func (xd *Extension) unmarshalSeed(b []byte, sb *strs.Builder, pf *File, pd protoreflect.Descriptor, i int) { xd.L0.ParentFile = pf xd.L0.Parent = pd xd.L0.Index = i @@ -401,11 +401,11 @@ func (xd *Extension) unmarshalSeed(b []byte, sb *strs.Builder, pf *File, pd pref b = b[m:] switch num { case genid.FieldDescriptorProto_Number_field_number: - xd.L1.Number = pref.FieldNumber(v) + xd.L1.Number = protoreflect.FieldNumber(v) case genid.FieldDescriptorProto_Label_field_number: - xd.L1.Cardinality = pref.Cardinality(v) + xd.L1.Cardinality = protoreflect.Cardinality(v) case genid.FieldDescriptorProto_Type_field_number: - xd.L1.Kind = pref.Kind(v) + xd.L1.Kind = protoreflect.Kind(v) } case protowire.BytesType: v, m := protowire.ConsumeBytes(b) @@ -423,7 +423,7 @@ func (xd *Extension) unmarshalSeed(b []byte, sb *strs.Builder, pf *File, pd pref } } -func (sd *Service) unmarshalSeed(b []byte, sb *strs.Builder, pf *File, pd pref.Descriptor, i int) { +func (sd *Service) unmarshalSeed(b []byte, sb *strs.Builder, pf *File, pd protoreflect.Descriptor, i int) { sd.L0.ParentFile = pf sd.L0.Parent = pd sd.L0.Index = i @@ -459,13 +459,13 @@ func putBuilder(b *strs.Builder) { // makeFullName converts b to a protoreflect.FullName, // where b must start with a leading dot. -func makeFullName(sb *strs.Builder, b []byte) pref.FullName { +func makeFullName(sb *strs.Builder, b []byte) protoreflect.FullName { if len(b) == 0 || b[0] != '.' { panic("name reference must be fully qualified") } - return pref.FullName(sb.MakeString(b[1:])) + return protoreflect.FullName(sb.MakeString(b[1:])) } -func appendFullName(sb *strs.Builder, prefix pref.FullName, suffix []byte) pref.FullName { - return sb.AppendFullName(prefix, pref.Name(strs.UnsafeString(suffix))) +func appendFullName(sb *strs.Builder, prefix protoreflect.FullName, suffix []byte) protoreflect.FullName { + return sb.AppendFullName(prefix, protoreflect.Name(strs.UnsafeString(suffix))) } diff --git a/vendor/google.golang.org/protobuf/internal/filedesc/desc_lazy.go b/vendor/google.golang.org/protobuf/internal/filedesc/desc_lazy.go index 198451e3..736a19a7 100644 --- a/vendor/google.golang.org/protobuf/internal/filedesc/desc_lazy.go +++ b/vendor/google.golang.org/protobuf/internal/filedesc/desc_lazy.go @@ -13,7 +13,7 @@ import ( "google.golang.org/protobuf/internal/genid" "google.golang.org/protobuf/internal/strs" "google.golang.org/protobuf/proto" - pref "google.golang.org/protobuf/reflect/protoreflect" + "google.golang.org/protobuf/reflect/protoreflect" ) func (fd *File) lazyRawInit() { @@ -39,10 +39,10 @@ func (file *File) resolveMessages() { // Resolve message field dependency. switch fd.L1.Kind { - case pref.EnumKind: + case protoreflect.EnumKind: fd.L1.Enum = file.resolveEnumDependency(fd.L1.Enum, listFieldDeps, depIdx) depIdx++ - case pref.MessageKind, pref.GroupKind: + case protoreflect.MessageKind, protoreflect.GroupKind: fd.L1.Message = file.resolveMessageDependency(fd.L1.Message, listFieldDeps, depIdx) depIdx++ } @@ -62,10 +62,10 @@ func (file *File) resolveExtensions() { // Resolve extension field dependency. switch xd.L1.Kind { - case pref.EnumKind: + case protoreflect.EnumKind: xd.L2.Enum = file.resolveEnumDependency(xd.L2.Enum, listExtDeps, depIdx) depIdx++ - case pref.MessageKind, pref.GroupKind: + case protoreflect.MessageKind, protoreflect.GroupKind: xd.L2.Message = file.resolveMessageDependency(xd.L2.Message, listExtDeps, depIdx) depIdx++ } @@ -92,7 +92,7 @@ func (file *File) resolveServices() { } } -func (file *File) resolveEnumDependency(ed pref.EnumDescriptor, i, j int32) pref.EnumDescriptor { +func (file *File) resolveEnumDependency(ed protoreflect.EnumDescriptor, i, j int32) protoreflect.EnumDescriptor { r := file.builder.FileRegistry if r, ok := r.(resolverByIndex); ok { if ed2 := r.FindEnumByIndex(i, j, file.allEnums, file.allMessages); ed2 != nil { @@ -105,12 +105,12 @@ func (file *File) resolveEnumDependency(ed pref.EnumDescriptor, i, j int32) pref } } if d, _ := r.FindDescriptorByName(ed.FullName()); d != nil { - return d.(pref.EnumDescriptor) + return d.(protoreflect.EnumDescriptor) } return ed } -func (file *File) resolveMessageDependency(md pref.MessageDescriptor, i, j int32) pref.MessageDescriptor { +func (file *File) resolveMessageDependency(md protoreflect.MessageDescriptor, i, j int32) protoreflect.MessageDescriptor { r := file.builder.FileRegistry if r, ok := r.(resolverByIndex); ok { if md2 := r.FindMessageByIndex(i, j, file.allEnums, file.allMessages); md2 != nil { @@ -123,7 +123,7 @@ func (file *File) resolveMessageDependency(md pref.MessageDescriptor, i, j int32 } } if d, _ := r.FindDescriptorByName(md.FullName()); d != nil { - return d.(pref.MessageDescriptor) + return d.(protoreflect.MessageDescriptor) } return md } @@ -158,7 +158,7 @@ func (fd *File) unmarshalFull(b []byte) { if imp == nil { imp = PlaceholderFile(path) } - fd.L2.Imports = append(fd.L2.Imports, pref.FileImport{FileDescriptor: imp}) + fd.L2.Imports = append(fd.L2.Imports, protoreflect.FileImport{FileDescriptor: imp}) case genid.FileDescriptorProto_EnumType_field_number: fd.L1.Enums.List[enumIdx].unmarshalFull(v, sb) enumIdx++ @@ -199,7 +199,7 @@ func (ed *Enum) unmarshalFull(b []byte, sb *strs.Builder) { case genid.EnumDescriptorProto_Value_field_number: rawValues = append(rawValues, v) case genid.EnumDescriptorProto_ReservedName_field_number: - ed.L2.ReservedNames.List = append(ed.L2.ReservedNames.List, pref.Name(sb.MakeString(v))) + ed.L2.ReservedNames.List = append(ed.L2.ReservedNames.List, protoreflect.Name(sb.MakeString(v))) case genid.EnumDescriptorProto_ReservedRange_field_number: ed.L2.ReservedRanges.List = append(ed.L2.ReservedRanges.List, unmarshalEnumReservedRange(v)) case genid.EnumDescriptorProto_Options_field_number: @@ -219,7 +219,7 @@ func (ed *Enum) unmarshalFull(b []byte, sb *strs.Builder) { ed.L2.Options = ed.L0.ParentFile.builder.optionsUnmarshaler(&descopts.Enum, rawOptions) } -func unmarshalEnumReservedRange(b []byte) (r [2]pref.EnumNumber) { +func unmarshalEnumReservedRange(b []byte) (r [2]protoreflect.EnumNumber) { for len(b) > 0 { num, typ, n := protowire.ConsumeTag(b) b = b[n:] @@ -229,9 +229,9 @@ func unmarshalEnumReservedRange(b []byte) (r [2]pref.EnumNumber) { b = b[m:] switch num { case genid.EnumDescriptorProto_EnumReservedRange_Start_field_number: - r[0] = pref.EnumNumber(v) + r[0] = protoreflect.EnumNumber(v) case genid.EnumDescriptorProto_EnumReservedRange_End_field_number: - r[1] = pref.EnumNumber(v) + r[1] = protoreflect.EnumNumber(v) } default: m := protowire.ConsumeFieldValue(num, typ, b) @@ -241,7 +241,7 @@ func unmarshalEnumReservedRange(b []byte) (r [2]pref.EnumNumber) { return r } -func (vd *EnumValue) unmarshalFull(b []byte, sb *strs.Builder, pf *File, pd pref.Descriptor, i int) { +func (vd *EnumValue) unmarshalFull(b []byte, sb *strs.Builder, pf *File, pd protoreflect.Descriptor, i int) { vd.L0.ParentFile = pf vd.L0.Parent = pd vd.L0.Index = i @@ -256,7 +256,7 @@ func (vd *EnumValue) unmarshalFull(b []byte, sb *strs.Builder, pf *File, pd pref b = b[m:] switch num { case genid.EnumValueDescriptorProto_Number_field_number: - vd.L1.Number = pref.EnumNumber(v) + vd.L1.Number = protoreflect.EnumNumber(v) } case protowire.BytesType: v, m := protowire.ConsumeBytes(b) @@ -294,7 +294,7 @@ func (md *Message) unmarshalFull(b []byte, sb *strs.Builder) { case genid.DescriptorProto_OneofDecl_field_number: rawOneofs = append(rawOneofs, v) case genid.DescriptorProto_ReservedName_field_number: - md.L2.ReservedNames.List = append(md.L2.ReservedNames.List, pref.Name(sb.MakeString(v))) + md.L2.ReservedNames.List = append(md.L2.ReservedNames.List, protoreflect.Name(sb.MakeString(v))) case genid.DescriptorProto_ReservedRange_field_number: md.L2.ReservedRanges.List = append(md.L2.ReservedRanges.List, unmarshalMessageReservedRange(v)) case genid.DescriptorProto_ExtensionRange_field_number: @@ -326,7 +326,7 @@ func (md *Message) unmarshalFull(b []byte, sb *strs.Builder) { for i, b := range rawFields { fd := &md.L2.Fields.List[i] fd.unmarshalFull(b, sb, md.L0.ParentFile, md, i) - if fd.L1.Cardinality == pref.Required { + if fd.L1.Cardinality == protoreflect.Required { md.L2.RequiredNumbers.List = append(md.L2.RequiredNumbers.List, fd.L1.Number) } } @@ -359,7 +359,7 @@ func (md *Message) unmarshalOptions(b []byte) { } } -func unmarshalMessageReservedRange(b []byte) (r [2]pref.FieldNumber) { +func unmarshalMessageReservedRange(b []byte) (r [2]protoreflect.FieldNumber) { for len(b) > 0 { num, typ, n := protowire.ConsumeTag(b) b = b[n:] @@ -369,9 +369,9 @@ func unmarshalMessageReservedRange(b []byte) (r [2]pref.FieldNumber) { b = b[m:] switch num { case genid.DescriptorProto_ReservedRange_Start_field_number: - r[0] = pref.FieldNumber(v) + r[0] = protoreflect.FieldNumber(v) case genid.DescriptorProto_ReservedRange_End_field_number: - r[1] = pref.FieldNumber(v) + r[1] = protoreflect.FieldNumber(v) } default: m := protowire.ConsumeFieldValue(num, typ, b) @@ -381,7 +381,7 @@ func unmarshalMessageReservedRange(b []byte) (r [2]pref.FieldNumber) { return r } -func unmarshalMessageExtensionRange(b []byte) (r [2]pref.FieldNumber, rawOptions []byte) { +func unmarshalMessageExtensionRange(b []byte) (r [2]protoreflect.FieldNumber, rawOptions []byte) { for len(b) > 0 { num, typ, n := protowire.ConsumeTag(b) b = b[n:] @@ -391,9 +391,9 @@ func unmarshalMessageExtensionRange(b []byte) (r [2]pref.FieldNumber, rawOptions b = b[m:] switch num { case genid.DescriptorProto_ExtensionRange_Start_field_number: - r[0] = pref.FieldNumber(v) + r[0] = protoreflect.FieldNumber(v) case genid.DescriptorProto_ExtensionRange_End_field_number: - r[1] = pref.FieldNumber(v) + r[1] = protoreflect.FieldNumber(v) } case protowire.BytesType: v, m := protowire.ConsumeBytes(b) @@ -410,7 +410,7 @@ func unmarshalMessageExtensionRange(b []byte) (r [2]pref.FieldNumber, rawOptions return r, rawOptions } -func (fd *Field) unmarshalFull(b []byte, sb *strs.Builder, pf *File, pd pref.Descriptor, i int) { +func (fd *Field) unmarshalFull(b []byte, sb *strs.Builder, pf *File, pd protoreflect.Descriptor, i int) { fd.L0.ParentFile = pf fd.L0.Parent = pd fd.L0.Index = i @@ -426,11 +426,11 @@ func (fd *Field) unmarshalFull(b []byte, sb *strs.Builder, pf *File, pd pref.Des b = b[m:] switch num { case genid.FieldDescriptorProto_Number_field_number: - fd.L1.Number = pref.FieldNumber(v) + fd.L1.Number = protoreflect.FieldNumber(v) case genid.FieldDescriptorProto_Label_field_number: - fd.L1.Cardinality = pref.Cardinality(v) + fd.L1.Cardinality = protoreflect.Cardinality(v) case genid.FieldDescriptorProto_Type_field_number: - fd.L1.Kind = pref.Kind(v) + fd.L1.Kind = protoreflect.Kind(v) case genid.FieldDescriptorProto_OneofIndex_field_number: // In Message.unmarshalFull, we allocate slices for both // the field and oneof descriptors before unmarshaling either @@ -453,7 +453,7 @@ func (fd *Field) unmarshalFull(b []byte, sb *strs.Builder, pf *File, pd pref.Des case genid.FieldDescriptorProto_JsonName_field_number: fd.L1.StringName.InitJSON(sb.MakeString(v)) case genid.FieldDescriptorProto_DefaultValue_field_number: - fd.L1.Default.val = pref.ValueOfBytes(v) // temporarily store as bytes; later resolved in resolveMessages + fd.L1.Default.val = protoreflect.ValueOfBytes(v) // temporarily store as bytes; later resolved in resolveMessages case genid.FieldDescriptorProto_TypeName_field_number: rawTypeName = v case genid.FieldDescriptorProto_Options_field_number: @@ -468,9 +468,9 @@ func (fd *Field) unmarshalFull(b []byte, sb *strs.Builder, pf *File, pd pref.Des if rawTypeName != nil { name := makeFullName(sb, rawTypeName) switch fd.L1.Kind { - case pref.EnumKind: + case protoreflect.EnumKind: fd.L1.Enum = PlaceholderEnum(name) - case pref.MessageKind, pref.GroupKind: + case protoreflect.MessageKind, protoreflect.GroupKind: fd.L1.Message = PlaceholderMessage(name) } } @@ -504,7 +504,7 @@ func (fd *Field) unmarshalOptions(b []byte) { } } -func (od *Oneof) unmarshalFull(b []byte, sb *strs.Builder, pf *File, pd pref.Descriptor, i int) { +func (od *Oneof) unmarshalFull(b []byte, sb *strs.Builder, pf *File, pd protoreflect.Descriptor, i int) { od.L0.ParentFile = pf od.L0.Parent = pd od.L0.Index = i @@ -553,7 +553,7 @@ func (xd *Extension) unmarshalFull(b []byte, sb *strs.Builder) { case genid.FieldDescriptorProto_JsonName_field_number: xd.L2.StringName.InitJSON(sb.MakeString(v)) case genid.FieldDescriptorProto_DefaultValue_field_number: - xd.L2.Default.val = pref.ValueOfBytes(v) // temporarily store as bytes; later resolved in resolveExtensions + xd.L2.Default.val = protoreflect.ValueOfBytes(v) // temporarily store as bytes; later resolved in resolveExtensions case genid.FieldDescriptorProto_TypeName_field_number: rawTypeName = v case genid.FieldDescriptorProto_Options_field_number: @@ -568,9 +568,9 @@ func (xd *Extension) unmarshalFull(b []byte, sb *strs.Builder) { if rawTypeName != nil { name := makeFullName(sb, rawTypeName) switch xd.L1.Kind { - case pref.EnumKind: + case protoreflect.EnumKind: xd.L2.Enum = PlaceholderEnum(name) - case pref.MessageKind, pref.GroupKind: + case protoreflect.MessageKind, protoreflect.GroupKind: xd.L2.Message = PlaceholderMessage(name) } } @@ -627,7 +627,7 @@ func (sd *Service) unmarshalFull(b []byte, sb *strs.Builder) { sd.L2.Options = sd.L0.ParentFile.builder.optionsUnmarshaler(&descopts.Service, rawOptions) } -func (md *Method) unmarshalFull(b []byte, sb *strs.Builder, pf *File, pd pref.Descriptor, i int) { +func (md *Method) unmarshalFull(b []byte, sb *strs.Builder, pf *File, pd protoreflect.Descriptor, i int) { md.L0.ParentFile = pf md.L0.Parent = pd md.L0.Index = i @@ -680,18 +680,18 @@ func appendOptions(dst, src []byte) []byte { // // The type of message to unmarshal to is passed as a pointer since the // vars in descopts may not yet be populated at the time this function is called. -func (db *Builder) optionsUnmarshaler(p *pref.ProtoMessage, b []byte) func() pref.ProtoMessage { +func (db *Builder) optionsUnmarshaler(p *protoreflect.ProtoMessage, b []byte) func() protoreflect.ProtoMessage { if b == nil { return nil } - var opts pref.ProtoMessage + var opts protoreflect.ProtoMessage var once sync.Once - return func() pref.ProtoMessage { + return func() protoreflect.ProtoMessage { once.Do(func() { if *p == nil { panic("Descriptor.Options called without importing the descriptor package") } - opts = reflect.New(reflect.TypeOf(*p).Elem()).Interface().(pref.ProtoMessage) + opts = reflect.New(reflect.TypeOf(*p).Elem()).Interface().(protoreflect.ProtoMessage) if err := (proto.UnmarshalOptions{ AllowPartial: true, Resolver: db.TypeResolver, diff --git a/vendor/google.golang.org/protobuf/internal/filedesc/desc_list.go b/vendor/google.golang.org/protobuf/internal/filedesc/desc_list.go index aa294fff..e3b6587d 100644 --- a/vendor/google.golang.org/protobuf/internal/filedesc/desc_list.go +++ b/vendor/google.golang.org/protobuf/internal/filedesc/desc_list.go @@ -17,31 +17,30 @@ import ( "google.golang.org/protobuf/internal/errors" "google.golang.org/protobuf/internal/pragma" "google.golang.org/protobuf/reflect/protoreflect" - pref "google.golang.org/protobuf/reflect/protoreflect" ) -type FileImports []pref.FileImport +type FileImports []protoreflect.FileImport func (p *FileImports) Len() int { return len(*p) } -func (p *FileImports) Get(i int) pref.FileImport { return (*p)[i] } +func (p *FileImports) Get(i int) protoreflect.FileImport { return (*p)[i] } func (p *FileImports) Format(s fmt.State, r rune) { descfmt.FormatList(s, r, p) } func (p *FileImports) ProtoInternal(pragma.DoNotImplement) {} type Names struct { - List []pref.Name + List []protoreflect.Name once sync.Once - has map[pref.Name]int // protected by once + has map[protoreflect.Name]int // protected by once } func (p *Names) Len() int { return len(p.List) } -func (p *Names) Get(i int) pref.Name { return p.List[i] } -func (p *Names) Has(s pref.Name) bool { return p.lazyInit().has[s] > 0 } +func (p *Names) Get(i int) protoreflect.Name { return p.List[i] } +func (p *Names) Has(s protoreflect.Name) bool { return p.lazyInit().has[s] > 0 } func (p *Names) Format(s fmt.State, r rune) { descfmt.FormatList(s, r, p) } func (p *Names) ProtoInternal(pragma.DoNotImplement) {} func (p *Names) lazyInit() *Names { p.once.Do(func() { if len(p.List) > 0 { - p.has = make(map[pref.Name]int, len(p.List)) + p.has = make(map[protoreflect.Name]int, len(p.List)) for _, s := range p.List { p.has[s] = p.has[s] + 1 } @@ -67,14 +66,14 @@ func (p *Names) CheckValid() error { } type EnumRanges struct { - List [][2]pref.EnumNumber // start inclusive; end inclusive + List [][2]protoreflect.EnumNumber // start inclusive; end inclusive once sync.Once - sorted [][2]pref.EnumNumber // protected by once + sorted [][2]protoreflect.EnumNumber // protected by once } -func (p *EnumRanges) Len() int { return len(p.List) } -func (p *EnumRanges) Get(i int) [2]pref.EnumNumber { return p.List[i] } -func (p *EnumRanges) Has(n pref.EnumNumber) bool { +func (p *EnumRanges) Len() int { return len(p.List) } +func (p *EnumRanges) Get(i int) [2]protoreflect.EnumNumber { return p.List[i] } +func (p *EnumRanges) Has(n protoreflect.EnumNumber) bool { for ls := p.lazyInit().sorted; len(ls) > 0; { i := len(ls) / 2 switch r := enumRange(ls[i]); { @@ -129,14 +128,14 @@ func (r enumRange) String() string { } type FieldRanges struct { - List [][2]pref.FieldNumber // start inclusive; end exclusive + List [][2]protoreflect.FieldNumber // start inclusive; end exclusive once sync.Once - sorted [][2]pref.FieldNumber // protected by once + sorted [][2]protoreflect.FieldNumber // protected by once } -func (p *FieldRanges) Len() int { return len(p.List) } -func (p *FieldRanges) Get(i int) [2]pref.FieldNumber { return p.List[i] } -func (p *FieldRanges) Has(n pref.FieldNumber) bool { +func (p *FieldRanges) Len() int { return len(p.List) } +func (p *FieldRanges) Get(i int) [2]protoreflect.FieldNumber { return p.List[i] } +func (p *FieldRanges) Has(n protoreflect.FieldNumber) bool { for ls := p.lazyInit().sorted; len(ls) > 0; { i := len(ls) / 2 switch r := fieldRange(ls[i]); { @@ -221,17 +220,17 @@ func (r fieldRange) String() string { } type FieldNumbers struct { - List []pref.FieldNumber + List []protoreflect.FieldNumber once sync.Once - has map[pref.FieldNumber]struct{} // protected by once + has map[protoreflect.FieldNumber]struct{} // protected by once } -func (p *FieldNumbers) Len() int { return len(p.List) } -func (p *FieldNumbers) Get(i int) pref.FieldNumber { return p.List[i] } -func (p *FieldNumbers) Has(n pref.FieldNumber) bool { +func (p *FieldNumbers) Len() int { return len(p.List) } +func (p *FieldNumbers) Get(i int) protoreflect.FieldNumber { return p.List[i] } +func (p *FieldNumbers) Has(n protoreflect.FieldNumber) bool { p.once.Do(func() { if len(p.List) > 0 { - p.has = make(map[pref.FieldNumber]struct{}, len(p.List)) + p.has = make(map[protoreflect.FieldNumber]struct{}, len(p.List)) for _, n := range p.List { p.has[n] = struct{}{} } @@ -244,30 +243,38 @@ func (p *FieldNumbers) Format(s fmt.State, r rune) { descfmt.FormatList func (p *FieldNumbers) ProtoInternal(pragma.DoNotImplement) {} type OneofFields struct { - List []pref.FieldDescriptor + List []protoreflect.FieldDescriptor once sync.Once - byName map[pref.Name]pref.FieldDescriptor // protected by once - byJSON map[string]pref.FieldDescriptor // protected by once - byText map[string]pref.FieldDescriptor // protected by once - byNum map[pref.FieldNumber]pref.FieldDescriptor // protected by once + byName map[protoreflect.Name]protoreflect.FieldDescriptor // protected by once + byJSON map[string]protoreflect.FieldDescriptor // protected by once + byText map[string]protoreflect.FieldDescriptor // protected by once + byNum map[protoreflect.FieldNumber]protoreflect.FieldDescriptor // protected by once } -func (p *OneofFields) Len() int { return len(p.List) } -func (p *OneofFields) Get(i int) pref.FieldDescriptor { return p.List[i] } -func (p *OneofFields) ByName(s pref.Name) pref.FieldDescriptor { return p.lazyInit().byName[s] } -func (p *OneofFields) ByJSONName(s string) pref.FieldDescriptor { return p.lazyInit().byJSON[s] } -func (p *OneofFields) ByTextName(s string) pref.FieldDescriptor { return p.lazyInit().byText[s] } -func (p *OneofFields) ByNumber(n pref.FieldNumber) pref.FieldDescriptor { return p.lazyInit().byNum[n] } -func (p *OneofFields) Format(s fmt.State, r rune) { descfmt.FormatList(s, r, p) } -func (p *OneofFields) ProtoInternal(pragma.DoNotImplement) {} +func (p *OneofFields) Len() int { return len(p.List) } +func (p *OneofFields) Get(i int) protoreflect.FieldDescriptor { return p.List[i] } +func (p *OneofFields) ByName(s protoreflect.Name) protoreflect.FieldDescriptor { + return p.lazyInit().byName[s] +} +func (p *OneofFields) ByJSONName(s string) protoreflect.FieldDescriptor { + return p.lazyInit().byJSON[s] +} +func (p *OneofFields) ByTextName(s string) protoreflect.FieldDescriptor { + return p.lazyInit().byText[s] +} +func (p *OneofFields) ByNumber(n protoreflect.FieldNumber) protoreflect.FieldDescriptor { + return p.lazyInit().byNum[n] +} +func (p *OneofFields) Format(s fmt.State, r rune) { descfmt.FormatList(s, r, p) } +func (p *OneofFields) ProtoInternal(pragma.DoNotImplement) {} func (p *OneofFields) lazyInit() *OneofFields { p.once.Do(func() { if len(p.List) > 0 { - p.byName = make(map[pref.Name]pref.FieldDescriptor, len(p.List)) - p.byJSON = make(map[string]pref.FieldDescriptor, len(p.List)) - p.byText = make(map[string]pref.FieldDescriptor, len(p.List)) - p.byNum = make(map[pref.FieldNumber]pref.FieldDescriptor, len(p.List)) + p.byName = make(map[protoreflect.Name]protoreflect.FieldDescriptor, len(p.List)) + p.byJSON = make(map[string]protoreflect.FieldDescriptor, len(p.List)) + p.byText = make(map[string]protoreflect.FieldDescriptor, len(p.List)) + p.byNum = make(map[protoreflect.FieldNumber]protoreflect.FieldDescriptor, len(p.List)) for _, f := range p.List { // Field names and numbers are guaranteed to be unique. p.byName[f.Name()] = f @@ -284,123 +291,123 @@ type SourceLocations struct { // List is a list of SourceLocations. // The SourceLocation.Next field does not need to be populated // as it will be lazily populated upon first need. - List []pref.SourceLocation + List []protoreflect.SourceLocation // File is the parent file descriptor that these locations are relative to. // If non-nil, ByDescriptor verifies that the provided descriptor // is a child of this file descriptor. - File pref.FileDescriptor + File protoreflect.FileDescriptor once sync.Once byPath map[pathKey]int } -func (p *SourceLocations) Len() int { return len(p.List) } -func (p *SourceLocations) Get(i int) pref.SourceLocation { return p.lazyInit().List[i] } -func (p *SourceLocations) byKey(k pathKey) pref.SourceLocation { +func (p *SourceLocations) Len() int { return len(p.List) } +func (p *SourceLocations) Get(i int) protoreflect.SourceLocation { return p.lazyInit().List[i] } +func (p *SourceLocations) byKey(k pathKey) protoreflect.SourceLocation { if i, ok := p.lazyInit().byPath[k]; ok { return p.List[i] } - return pref.SourceLocation{} + return protoreflect.SourceLocation{} } -func (p *SourceLocations) ByPath(path pref.SourcePath) pref.SourceLocation { +func (p *SourceLocations) ByPath(path protoreflect.SourcePath) protoreflect.SourceLocation { return p.byKey(newPathKey(path)) } -func (p *SourceLocations) ByDescriptor(desc pref.Descriptor) pref.SourceLocation { +func (p *SourceLocations) ByDescriptor(desc protoreflect.Descriptor) protoreflect.SourceLocation { if p.File != nil && desc != nil && p.File != desc.ParentFile() { - return pref.SourceLocation{} // mismatching parent files + return protoreflect.SourceLocation{} // mismatching parent files } var pathArr [16]int32 path := pathArr[:0] for { switch desc.(type) { - case pref.FileDescriptor: + case protoreflect.FileDescriptor: // Reverse the path since it was constructed in reverse. for i, j := 0, len(path)-1; i < j; i, j = i+1, j-1 { path[i], path[j] = path[j], path[i] } return p.byKey(newPathKey(path)) - case pref.MessageDescriptor: + case protoreflect.MessageDescriptor: path = append(path, int32(desc.Index())) desc = desc.Parent() switch desc.(type) { - case pref.FileDescriptor: + case protoreflect.FileDescriptor: path = append(path, int32(genid.FileDescriptorProto_MessageType_field_number)) - case pref.MessageDescriptor: + case protoreflect.MessageDescriptor: path = append(path, int32(genid.DescriptorProto_NestedType_field_number)) default: - return pref.SourceLocation{} + return protoreflect.SourceLocation{} } - case pref.FieldDescriptor: - isExtension := desc.(pref.FieldDescriptor).IsExtension() + case protoreflect.FieldDescriptor: + isExtension := desc.(protoreflect.FieldDescriptor).IsExtension() path = append(path, int32(desc.Index())) desc = desc.Parent() if isExtension { switch desc.(type) { - case pref.FileDescriptor: + case protoreflect.FileDescriptor: path = append(path, int32(genid.FileDescriptorProto_Extension_field_number)) - case pref.MessageDescriptor: + case protoreflect.MessageDescriptor: path = append(path, int32(genid.DescriptorProto_Extension_field_number)) default: - return pref.SourceLocation{} + return protoreflect.SourceLocation{} } } else { switch desc.(type) { - case pref.MessageDescriptor: + case protoreflect.MessageDescriptor: path = append(path, int32(genid.DescriptorProto_Field_field_number)) default: - return pref.SourceLocation{} + return protoreflect.SourceLocation{} } } - case pref.OneofDescriptor: + case protoreflect.OneofDescriptor: path = append(path, int32(desc.Index())) desc = desc.Parent() switch desc.(type) { - case pref.MessageDescriptor: + case protoreflect.MessageDescriptor: path = append(path, int32(genid.DescriptorProto_OneofDecl_field_number)) default: - return pref.SourceLocation{} + return protoreflect.SourceLocation{} } - case pref.EnumDescriptor: + case protoreflect.EnumDescriptor: path = append(path, int32(desc.Index())) desc = desc.Parent() switch desc.(type) { - case pref.FileDescriptor: + case protoreflect.FileDescriptor: path = append(path, int32(genid.FileDescriptorProto_EnumType_field_number)) - case pref.MessageDescriptor: + case protoreflect.MessageDescriptor: path = append(path, int32(genid.DescriptorProto_EnumType_field_number)) default: - return pref.SourceLocation{} + return protoreflect.SourceLocation{} } - case pref.EnumValueDescriptor: + case protoreflect.EnumValueDescriptor: path = append(path, int32(desc.Index())) desc = desc.Parent() switch desc.(type) { - case pref.EnumDescriptor: + case protoreflect.EnumDescriptor: path = append(path, int32(genid.EnumDescriptorProto_Value_field_number)) default: - return pref.SourceLocation{} + return protoreflect.SourceLocation{} } - case pref.ServiceDescriptor: + case protoreflect.ServiceDescriptor: path = append(path, int32(desc.Index())) desc = desc.Parent() switch desc.(type) { - case pref.FileDescriptor: + case protoreflect.FileDescriptor: path = append(path, int32(genid.FileDescriptorProto_Service_field_number)) default: - return pref.SourceLocation{} + return protoreflect.SourceLocation{} } - case pref.MethodDescriptor: + case protoreflect.MethodDescriptor: path = append(path, int32(desc.Index())) desc = desc.Parent() switch desc.(type) { - case pref.ServiceDescriptor: + case protoreflect.ServiceDescriptor: path = append(path, int32(genid.ServiceDescriptorProto_Method_field_number)) default: - return pref.SourceLocation{} + return protoreflect.SourceLocation{} } default: - return pref.SourceLocation{} + return protoreflect.SourceLocation{} } } } @@ -435,7 +442,7 @@ type pathKey struct { str string // used if the path does not fit in arr } -func newPathKey(p pref.SourcePath) (k pathKey) { +func newPathKey(p protoreflect.SourcePath) (k pathKey) { if len(p) < len(k.arr) { for i, ps := range p { if ps < 0 || math.MaxUint8 <= ps { diff --git a/vendor/google.golang.org/protobuf/internal/filedesc/placeholder.go b/vendor/google.golang.org/protobuf/internal/filedesc/placeholder.go index dbf2c605..28240ebc 100644 --- a/vendor/google.golang.org/protobuf/internal/filedesc/placeholder.go +++ b/vendor/google.golang.org/protobuf/internal/filedesc/placeholder.go @@ -7,7 +7,7 @@ package filedesc import ( "google.golang.org/protobuf/internal/descopts" "google.golang.org/protobuf/internal/pragma" - pref "google.golang.org/protobuf/reflect/protoreflect" + "google.golang.org/protobuf/reflect/protoreflect" ) var ( @@ -30,78 +30,80 @@ var ( // PlaceholderFile is a placeholder, representing only the file path. type PlaceholderFile string -func (f PlaceholderFile) ParentFile() pref.FileDescriptor { return f } -func (f PlaceholderFile) Parent() pref.Descriptor { return nil } -func (f PlaceholderFile) Index() int { return 0 } -func (f PlaceholderFile) Syntax() pref.Syntax { return 0 } -func (f PlaceholderFile) Name() pref.Name { return "" } -func (f PlaceholderFile) FullName() pref.FullName { return "" } -func (f PlaceholderFile) IsPlaceholder() bool { return true } -func (f PlaceholderFile) Options() pref.ProtoMessage { return descopts.File } -func (f PlaceholderFile) Path() string { return string(f) } -func (f PlaceholderFile) Package() pref.FullName { return "" } -func (f PlaceholderFile) Imports() pref.FileImports { return emptyFiles } -func (f PlaceholderFile) Messages() pref.MessageDescriptors { return emptyMessages } -func (f PlaceholderFile) Enums() pref.EnumDescriptors { return emptyEnums } -func (f PlaceholderFile) Extensions() pref.ExtensionDescriptors { return emptyExtensions } -func (f PlaceholderFile) Services() pref.ServiceDescriptors { return emptyServices } -func (f PlaceholderFile) SourceLocations() pref.SourceLocations { return emptySourceLocations } -func (f PlaceholderFile) ProtoType(pref.FileDescriptor) { return } -func (f PlaceholderFile) ProtoInternal(pragma.DoNotImplement) { return } +func (f PlaceholderFile) ParentFile() protoreflect.FileDescriptor { return f } +func (f PlaceholderFile) Parent() protoreflect.Descriptor { return nil } +func (f PlaceholderFile) Index() int { return 0 } +func (f PlaceholderFile) Syntax() protoreflect.Syntax { return 0 } +func (f PlaceholderFile) Name() protoreflect.Name { return "" } +func (f PlaceholderFile) FullName() protoreflect.FullName { return "" } +func (f PlaceholderFile) IsPlaceholder() bool { return true } +func (f PlaceholderFile) Options() protoreflect.ProtoMessage { return descopts.File } +func (f PlaceholderFile) Path() string { return string(f) } +func (f PlaceholderFile) Package() protoreflect.FullName { return "" } +func (f PlaceholderFile) Imports() protoreflect.FileImports { return emptyFiles } +func (f PlaceholderFile) Messages() protoreflect.MessageDescriptors { return emptyMessages } +func (f PlaceholderFile) Enums() protoreflect.EnumDescriptors { return emptyEnums } +func (f PlaceholderFile) Extensions() protoreflect.ExtensionDescriptors { return emptyExtensions } +func (f PlaceholderFile) Services() protoreflect.ServiceDescriptors { return emptyServices } +func (f PlaceholderFile) SourceLocations() protoreflect.SourceLocations { return emptySourceLocations } +func (f PlaceholderFile) ProtoType(protoreflect.FileDescriptor) { return } +func (f PlaceholderFile) ProtoInternal(pragma.DoNotImplement) { return } // PlaceholderEnum is a placeholder, representing only the full name. -type PlaceholderEnum pref.FullName +type PlaceholderEnum protoreflect.FullName -func (e PlaceholderEnum) ParentFile() pref.FileDescriptor { return nil } -func (e PlaceholderEnum) Parent() pref.Descriptor { return nil } -func (e PlaceholderEnum) Index() int { return 0 } -func (e PlaceholderEnum) Syntax() pref.Syntax { return 0 } -func (e PlaceholderEnum) Name() pref.Name { return pref.FullName(e).Name() } -func (e PlaceholderEnum) FullName() pref.FullName { return pref.FullName(e) } -func (e PlaceholderEnum) IsPlaceholder() bool { return true } -func (e PlaceholderEnum) Options() pref.ProtoMessage { return descopts.Enum } -func (e PlaceholderEnum) Values() pref.EnumValueDescriptors { return emptyEnumValues } -func (e PlaceholderEnum) ReservedNames() pref.Names { return emptyNames } -func (e PlaceholderEnum) ReservedRanges() pref.EnumRanges { return emptyEnumRanges } -func (e PlaceholderEnum) ProtoType(pref.EnumDescriptor) { return } -func (e PlaceholderEnum) ProtoInternal(pragma.DoNotImplement) { return } +func (e PlaceholderEnum) ParentFile() protoreflect.FileDescriptor { return nil } +func (e PlaceholderEnum) Parent() protoreflect.Descriptor { return nil } +func (e PlaceholderEnum) Index() int { return 0 } +func (e PlaceholderEnum) Syntax() protoreflect.Syntax { return 0 } +func (e PlaceholderEnum) Name() protoreflect.Name { return protoreflect.FullName(e).Name() } +func (e PlaceholderEnum) FullName() protoreflect.FullName { return protoreflect.FullName(e) } +func (e PlaceholderEnum) IsPlaceholder() bool { return true } +func (e PlaceholderEnum) Options() protoreflect.ProtoMessage { return descopts.Enum } +func (e PlaceholderEnum) Values() protoreflect.EnumValueDescriptors { return emptyEnumValues } +func (e PlaceholderEnum) ReservedNames() protoreflect.Names { return emptyNames } +func (e PlaceholderEnum) ReservedRanges() protoreflect.EnumRanges { return emptyEnumRanges } +func (e PlaceholderEnum) ProtoType(protoreflect.EnumDescriptor) { return } +func (e PlaceholderEnum) ProtoInternal(pragma.DoNotImplement) { return } // PlaceholderEnumValue is a placeholder, representing only the full name. -type PlaceholderEnumValue pref.FullName +type PlaceholderEnumValue protoreflect.FullName -func (e PlaceholderEnumValue) ParentFile() pref.FileDescriptor { return nil } -func (e PlaceholderEnumValue) Parent() pref.Descriptor { return nil } -func (e PlaceholderEnumValue) Index() int { return 0 } -func (e PlaceholderEnumValue) Syntax() pref.Syntax { return 0 } -func (e PlaceholderEnumValue) Name() pref.Name { return pref.FullName(e).Name() } -func (e PlaceholderEnumValue) FullName() pref.FullName { return pref.FullName(e) } -func (e PlaceholderEnumValue) IsPlaceholder() bool { return true } -func (e PlaceholderEnumValue) Options() pref.ProtoMessage { return descopts.EnumValue } -func (e PlaceholderEnumValue) Number() pref.EnumNumber { return 0 } -func (e PlaceholderEnumValue) ProtoType(pref.EnumValueDescriptor) { return } -func (e PlaceholderEnumValue) ProtoInternal(pragma.DoNotImplement) { return } +func (e PlaceholderEnumValue) ParentFile() protoreflect.FileDescriptor { return nil } +func (e PlaceholderEnumValue) Parent() protoreflect.Descriptor { return nil } +func (e PlaceholderEnumValue) Index() int { return 0 } +func (e PlaceholderEnumValue) Syntax() protoreflect.Syntax { return 0 } +func (e PlaceholderEnumValue) Name() protoreflect.Name { return protoreflect.FullName(e).Name() } +func (e PlaceholderEnumValue) FullName() protoreflect.FullName { return protoreflect.FullName(e) } +func (e PlaceholderEnumValue) IsPlaceholder() bool { return true } +func (e PlaceholderEnumValue) Options() protoreflect.ProtoMessage { return descopts.EnumValue } +func (e PlaceholderEnumValue) Number() protoreflect.EnumNumber { return 0 } +func (e PlaceholderEnumValue) ProtoType(protoreflect.EnumValueDescriptor) { return } +func (e PlaceholderEnumValue) ProtoInternal(pragma.DoNotImplement) { return } // PlaceholderMessage is a placeholder, representing only the full name. -type PlaceholderMessage pref.FullName +type PlaceholderMessage protoreflect.FullName -func (m PlaceholderMessage) ParentFile() pref.FileDescriptor { return nil } -func (m PlaceholderMessage) Parent() pref.Descriptor { return nil } -func (m PlaceholderMessage) Index() int { return 0 } -func (m PlaceholderMessage) Syntax() pref.Syntax { return 0 } -func (m PlaceholderMessage) Name() pref.Name { return pref.FullName(m).Name() } -func (m PlaceholderMessage) FullName() pref.FullName { return pref.FullName(m) } -func (m PlaceholderMessage) IsPlaceholder() bool { return true } -func (m PlaceholderMessage) Options() pref.ProtoMessage { return descopts.Message } -func (m PlaceholderMessage) IsMapEntry() bool { return false } -func (m PlaceholderMessage) Fields() pref.FieldDescriptors { return emptyFields } -func (m PlaceholderMessage) Oneofs() pref.OneofDescriptors { return emptyOneofs } -func (m PlaceholderMessage) ReservedNames() pref.Names { return emptyNames } -func (m PlaceholderMessage) ReservedRanges() pref.FieldRanges { return emptyFieldRanges } -func (m PlaceholderMessage) RequiredNumbers() pref.FieldNumbers { return emptyFieldNumbers } -func (m PlaceholderMessage) ExtensionRanges() pref.FieldRanges { return emptyFieldRanges } -func (m PlaceholderMessage) ExtensionRangeOptions(int) pref.ProtoMessage { panic("index out of range") } -func (m PlaceholderMessage) Messages() pref.MessageDescriptors { return emptyMessages } -func (m PlaceholderMessage) Enums() pref.EnumDescriptors { return emptyEnums } -func (m PlaceholderMessage) Extensions() pref.ExtensionDescriptors { return emptyExtensions } -func (m PlaceholderMessage) ProtoType(pref.MessageDescriptor) { return } -func (m PlaceholderMessage) ProtoInternal(pragma.DoNotImplement) { return } +func (m PlaceholderMessage) ParentFile() protoreflect.FileDescriptor { return nil } +func (m PlaceholderMessage) Parent() protoreflect.Descriptor { return nil } +func (m PlaceholderMessage) Index() int { return 0 } +func (m PlaceholderMessage) Syntax() protoreflect.Syntax { return 0 } +func (m PlaceholderMessage) Name() protoreflect.Name { return protoreflect.FullName(m).Name() } +func (m PlaceholderMessage) FullName() protoreflect.FullName { return protoreflect.FullName(m) } +func (m PlaceholderMessage) IsPlaceholder() bool { return true } +func (m PlaceholderMessage) Options() protoreflect.ProtoMessage { return descopts.Message } +func (m PlaceholderMessage) IsMapEntry() bool { return false } +func (m PlaceholderMessage) Fields() protoreflect.FieldDescriptors { return emptyFields } +func (m PlaceholderMessage) Oneofs() protoreflect.OneofDescriptors { return emptyOneofs } +func (m PlaceholderMessage) ReservedNames() protoreflect.Names { return emptyNames } +func (m PlaceholderMessage) ReservedRanges() protoreflect.FieldRanges { return emptyFieldRanges } +func (m PlaceholderMessage) RequiredNumbers() protoreflect.FieldNumbers { return emptyFieldNumbers } +func (m PlaceholderMessage) ExtensionRanges() protoreflect.FieldRanges { return emptyFieldRanges } +func (m PlaceholderMessage) ExtensionRangeOptions(int) protoreflect.ProtoMessage { + panic("index out of range") +} +func (m PlaceholderMessage) Messages() protoreflect.MessageDescriptors { return emptyMessages } +func (m PlaceholderMessage) Enums() protoreflect.EnumDescriptors { return emptyEnums } +func (m PlaceholderMessage) Extensions() protoreflect.ExtensionDescriptors { return emptyExtensions } +func (m PlaceholderMessage) ProtoType(protoreflect.MessageDescriptor) { return } +func (m PlaceholderMessage) ProtoInternal(pragma.DoNotImplement) { return } diff --git a/vendor/google.golang.org/protobuf/internal/filetype/build.go b/vendor/google.golang.org/protobuf/internal/filetype/build.go index 0a0dd35d..f0e38c4e 100644 --- a/vendor/google.golang.org/protobuf/internal/filetype/build.go +++ b/vendor/google.golang.org/protobuf/internal/filetype/build.go @@ -10,17 +10,16 @@ import ( "reflect" "google.golang.org/protobuf/internal/descopts" - fdesc "google.golang.org/protobuf/internal/filedesc" + "google.golang.org/protobuf/internal/filedesc" pimpl "google.golang.org/protobuf/internal/impl" - pref "google.golang.org/protobuf/reflect/protoreflect" - preg "google.golang.org/protobuf/reflect/protoregistry" + "google.golang.org/protobuf/reflect/protoreflect" + "google.golang.org/protobuf/reflect/protoregistry" ) // Builder constructs type descriptors from a raw file descriptor // and associated Go types for each enum and message declaration. // -// -// Flattened Ordering +// # Flattened Ordering // // The protobuf type system represents declarations as a tree. Certain nodes in // the tree require us to either associate it with a concrete Go type or to @@ -52,7 +51,7 @@ import ( // that children themselves may have. type Builder struct { // File is the underlying file descriptor builder. - File fdesc.Builder + File filedesc.Builder // GoTypes is a unique set of the Go types for all declarations and // dependencies. Each type is represented as a zero value of the Go type. @@ -108,22 +107,22 @@ type Builder struct { // TypeRegistry is the registry to register each type descriptor. // If nil, it uses protoregistry.GlobalTypes. TypeRegistry interface { - RegisterMessage(pref.MessageType) error - RegisterEnum(pref.EnumType) error - RegisterExtension(pref.ExtensionType) error + RegisterMessage(protoreflect.MessageType) error + RegisterEnum(protoreflect.EnumType) error + RegisterExtension(protoreflect.ExtensionType) error } } // Out is the output of the builder. type Out struct { - File pref.FileDescriptor + File protoreflect.FileDescriptor } func (tb Builder) Build() (out Out) { // Replace the resolver with one that resolves dependencies by index, // which is faster and more reliable than relying on the global registry. if tb.File.FileRegistry == nil { - tb.File.FileRegistry = preg.GlobalFiles + tb.File.FileRegistry = protoregistry.GlobalFiles } tb.File.FileRegistry = &resolverByIndex{ goTypes: tb.GoTypes, @@ -133,7 +132,7 @@ func (tb Builder) Build() (out Out) { // Initialize registry if unpopulated. if tb.TypeRegistry == nil { - tb.TypeRegistry = preg.GlobalTypes + tb.TypeRegistry = protoregistry.GlobalTypes } fbOut := tb.File.Build() @@ -183,23 +182,23 @@ func (tb Builder) Build() (out Out) { for i := range fbOut.Messages { switch fbOut.Messages[i].Name() { case "FileOptions": - descopts.File = messageGoTypes[i].(pref.ProtoMessage) + descopts.File = messageGoTypes[i].(protoreflect.ProtoMessage) case "EnumOptions": - descopts.Enum = messageGoTypes[i].(pref.ProtoMessage) + descopts.Enum = messageGoTypes[i].(protoreflect.ProtoMessage) case "EnumValueOptions": - descopts.EnumValue = messageGoTypes[i].(pref.ProtoMessage) + descopts.EnumValue = messageGoTypes[i].(protoreflect.ProtoMessage) case "MessageOptions": - descopts.Message = messageGoTypes[i].(pref.ProtoMessage) + descopts.Message = messageGoTypes[i].(protoreflect.ProtoMessage) case "FieldOptions": - descopts.Field = messageGoTypes[i].(pref.ProtoMessage) + descopts.Field = messageGoTypes[i].(protoreflect.ProtoMessage) case "OneofOptions": - descopts.Oneof = messageGoTypes[i].(pref.ProtoMessage) + descopts.Oneof = messageGoTypes[i].(protoreflect.ProtoMessage) case "ExtensionRangeOptions": - descopts.ExtensionRange = messageGoTypes[i].(pref.ProtoMessage) + descopts.ExtensionRange = messageGoTypes[i].(protoreflect.ProtoMessage) case "ServiceOptions": - descopts.Service = messageGoTypes[i].(pref.ProtoMessage) + descopts.Service = messageGoTypes[i].(protoreflect.ProtoMessage) case "MethodOptions": - descopts.Method = messageGoTypes[i].(pref.ProtoMessage) + descopts.Method = messageGoTypes[i].(protoreflect.ProtoMessage) } } } @@ -216,11 +215,11 @@ func (tb Builder) Build() (out Out) { const listExtDeps = 2 var goType reflect.Type switch fbOut.Extensions[i].L1.Kind { - case pref.EnumKind: + case protoreflect.EnumKind: j := depIdxs.Get(tb.DependencyIndexes, listExtDeps, depIdx) goType = reflect.TypeOf(tb.GoTypes[j]) depIdx++ - case pref.MessageKind, pref.GroupKind: + case protoreflect.MessageKind, protoreflect.GroupKind: j := depIdxs.Get(tb.DependencyIndexes, listExtDeps, depIdx) goType = reflect.TypeOf(tb.GoTypes[j]) depIdx++ @@ -242,22 +241,22 @@ func (tb Builder) Build() (out Out) { return out } -var goTypeForPBKind = map[pref.Kind]reflect.Type{ - pref.BoolKind: reflect.TypeOf(bool(false)), - pref.Int32Kind: reflect.TypeOf(int32(0)), - pref.Sint32Kind: reflect.TypeOf(int32(0)), - pref.Sfixed32Kind: reflect.TypeOf(int32(0)), - pref.Int64Kind: reflect.TypeOf(int64(0)), - pref.Sint64Kind: reflect.TypeOf(int64(0)), - pref.Sfixed64Kind: reflect.TypeOf(int64(0)), - pref.Uint32Kind: reflect.TypeOf(uint32(0)), - pref.Fixed32Kind: reflect.TypeOf(uint32(0)), - pref.Uint64Kind: reflect.TypeOf(uint64(0)), - pref.Fixed64Kind: reflect.TypeOf(uint64(0)), - pref.FloatKind: reflect.TypeOf(float32(0)), - pref.DoubleKind: reflect.TypeOf(float64(0)), - pref.StringKind: reflect.TypeOf(string("")), - pref.BytesKind: reflect.TypeOf([]byte(nil)), +var goTypeForPBKind = map[protoreflect.Kind]reflect.Type{ + protoreflect.BoolKind: reflect.TypeOf(bool(false)), + protoreflect.Int32Kind: reflect.TypeOf(int32(0)), + protoreflect.Sint32Kind: reflect.TypeOf(int32(0)), + protoreflect.Sfixed32Kind: reflect.TypeOf(int32(0)), + protoreflect.Int64Kind: reflect.TypeOf(int64(0)), + protoreflect.Sint64Kind: reflect.TypeOf(int64(0)), + protoreflect.Sfixed64Kind: reflect.TypeOf(int64(0)), + protoreflect.Uint32Kind: reflect.TypeOf(uint32(0)), + protoreflect.Fixed32Kind: reflect.TypeOf(uint32(0)), + protoreflect.Uint64Kind: reflect.TypeOf(uint64(0)), + protoreflect.Fixed64Kind: reflect.TypeOf(uint64(0)), + protoreflect.FloatKind: reflect.TypeOf(float32(0)), + protoreflect.DoubleKind: reflect.TypeOf(float64(0)), + protoreflect.StringKind: reflect.TypeOf(string("")), + protoreflect.BytesKind: reflect.TypeOf([]byte(nil)), } type depIdxs []int32 @@ -274,13 +273,13 @@ type ( fileRegistry } fileRegistry interface { - FindFileByPath(string) (pref.FileDescriptor, error) - FindDescriptorByName(pref.FullName) (pref.Descriptor, error) - RegisterFile(pref.FileDescriptor) error + FindFileByPath(string) (protoreflect.FileDescriptor, error) + FindDescriptorByName(protoreflect.FullName) (protoreflect.Descriptor, error) + RegisterFile(protoreflect.FileDescriptor) error } ) -func (r *resolverByIndex) FindEnumByIndex(i, j int32, es []fdesc.Enum, ms []fdesc.Message) pref.EnumDescriptor { +func (r *resolverByIndex) FindEnumByIndex(i, j int32, es []filedesc.Enum, ms []filedesc.Message) protoreflect.EnumDescriptor { if depIdx := int(r.depIdxs.Get(i, j)); int(depIdx) < len(es)+len(ms) { return &es[depIdx] } else { @@ -288,7 +287,7 @@ func (r *resolverByIndex) FindEnumByIndex(i, j int32, es []fdesc.Enum, ms []fdes } } -func (r *resolverByIndex) FindMessageByIndex(i, j int32, es []fdesc.Enum, ms []fdesc.Message) pref.MessageDescriptor { +func (r *resolverByIndex) FindMessageByIndex(i, j int32, es []filedesc.Enum, ms []filedesc.Message) protoreflect.MessageDescriptor { if depIdx := int(r.depIdxs.Get(i, j)); depIdx < len(es)+len(ms) { return &ms[depIdx-len(es)] } else { diff --git a/vendor/google.golang.org/protobuf/internal/impl/api_export.go b/vendor/google.golang.org/protobuf/internal/impl/api_export.go index abee5f30..a371f98d 100644 --- a/vendor/google.golang.org/protobuf/internal/impl/api_export.go +++ b/vendor/google.golang.org/protobuf/internal/impl/api_export.go @@ -12,8 +12,8 @@ import ( "google.golang.org/protobuf/encoding/prototext" "google.golang.org/protobuf/internal/errors" "google.golang.org/protobuf/proto" - pref "google.golang.org/protobuf/reflect/protoreflect" - piface "google.golang.org/protobuf/runtime/protoiface" + "google.golang.org/protobuf/reflect/protoreflect" + "google.golang.org/protobuf/runtime/protoiface" ) // Export is a zero-length named type that exists only to export a set of @@ -32,11 +32,11 @@ type enum = interface{} // EnumOf returns the protoreflect.Enum interface over e. // It returns nil if e is nil. -func (Export) EnumOf(e enum) pref.Enum { +func (Export) EnumOf(e enum) protoreflect.Enum { switch e := e.(type) { case nil: return nil - case pref.Enum: + case protoreflect.Enum: return e default: return legacyWrapEnum(reflect.ValueOf(e)) @@ -45,11 +45,11 @@ func (Export) EnumOf(e enum) pref.Enum { // EnumDescriptorOf returns the protoreflect.EnumDescriptor for e. // It returns nil if e is nil. -func (Export) EnumDescriptorOf(e enum) pref.EnumDescriptor { +func (Export) EnumDescriptorOf(e enum) protoreflect.EnumDescriptor { switch e := e.(type) { case nil: return nil - case pref.Enum: + case protoreflect.Enum: return e.Descriptor() default: return LegacyLoadEnumDesc(reflect.TypeOf(e)) @@ -58,11 +58,11 @@ func (Export) EnumDescriptorOf(e enum) pref.EnumDescriptor { // EnumTypeOf returns the protoreflect.EnumType for e. // It returns nil if e is nil. -func (Export) EnumTypeOf(e enum) pref.EnumType { +func (Export) EnumTypeOf(e enum) protoreflect.EnumType { switch e := e.(type) { case nil: return nil - case pref.Enum: + case protoreflect.Enum: return e.Type() default: return legacyLoadEnumType(reflect.TypeOf(e)) @@ -71,7 +71,7 @@ func (Export) EnumTypeOf(e enum) pref.EnumType { // EnumStringOf returns the enum value as a string, either as the name if // the number is resolvable, or the number formatted as a string. -func (Export) EnumStringOf(ed pref.EnumDescriptor, n pref.EnumNumber) string { +func (Export) EnumStringOf(ed protoreflect.EnumDescriptor, n protoreflect.EnumNumber) string { ev := ed.Values().ByNumber(n) if ev != nil { return string(ev.Name()) @@ -84,7 +84,7 @@ func (Export) EnumStringOf(ed pref.EnumDescriptor, n pref.EnumNumber) string { type message = interface{} // legacyMessageWrapper wraps a v2 message as a v1 message. -type legacyMessageWrapper struct{ m pref.ProtoMessage } +type legacyMessageWrapper struct{ m protoreflect.ProtoMessage } func (m legacyMessageWrapper) Reset() { proto.Reset(m.m) } func (m legacyMessageWrapper) String() string { return Export{}.MessageStringOf(m.m) } @@ -92,30 +92,30 @@ func (m legacyMessageWrapper) ProtoMessage() {} // ProtoMessageV1Of converts either a v1 or v2 message to a v1 message. // It returns nil if m is nil. -func (Export) ProtoMessageV1Of(m message) piface.MessageV1 { +func (Export) ProtoMessageV1Of(m message) protoiface.MessageV1 { switch mv := m.(type) { case nil: return nil - case piface.MessageV1: + case protoiface.MessageV1: return mv case unwrapper: return Export{}.ProtoMessageV1Of(mv.protoUnwrap()) - case pref.ProtoMessage: + case protoreflect.ProtoMessage: return legacyMessageWrapper{mv} default: panic(fmt.Sprintf("message %T is neither a v1 or v2 Message", m)) } } -func (Export) protoMessageV2Of(m message) pref.ProtoMessage { +func (Export) protoMessageV2Of(m message) protoreflect.ProtoMessage { switch mv := m.(type) { case nil: return nil - case pref.ProtoMessage: + case protoreflect.ProtoMessage: return mv case legacyMessageWrapper: return mv.m - case piface.MessageV1: + case protoiface.MessageV1: return nil default: panic(fmt.Sprintf("message %T is neither a v1 or v2 Message", m)) @@ -124,7 +124,7 @@ func (Export) protoMessageV2Of(m message) pref.ProtoMessage { // ProtoMessageV2Of converts either a v1 or v2 message to a v2 message. // It returns nil if m is nil. -func (Export) ProtoMessageV2Of(m message) pref.ProtoMessage { +func (Export) ProtoMessageV2Of(m message) protoreflect.ProtoMessage { if m == nil { return nil } @@ -136,7 +136,7 @@ func (Export) ProtoMessageV2Of(m message) pref.ProtoMessage { // MessageOf returns the protoreflect.Message interface over m. // It returns nil if m is nil. -func (Export) MessageOf(m message) pref.Message { +func (Export) MessageOf(m message) protoreflect.Message { if m == nil { return nil } @@ -148,7 +148,7 @@ func (Export) MessageOf(m message) pref.Message { // MessageDescriptorOf returns the protoreflect.MessageDescriptor for m. // It returns nil if m is nil. -func (Export) MessageDescriptorOf(m message) pref.MessageDescriptor { +func (Export) MessageDescriptorOf(m message) protoreflect.MessageDescriptor { if m == nil { return nil } @@ -160,7 +160,7 @@ func (Export) MessageDescriptorOf(m message) pref.MessageDescriptor { // MessageTypeOf returns the protoreflect.MessageType for m. // It returns nil if m is nil. -func (Export) MessageTypeOf(m message) pref.MessageType { +func (Export) MessageTypeOf(m message) protoreflect.MessageType { if m == nil { return nil } @@ -172,6 +172,6 @@ func (Export) MessageTypeOf(m message) pref.MessageType { // MessageStringOf returns the message value as a string, // which is the message serialized in the protobuf text format. -func (Export) MessageStringOf(m pref.ProtoMessage) string { +func (Export) MessageStringOf(m protoreflect.ProtoMessage) string { return prototext.MarshalOptions{Multiline: false}.Format(m) } diff --git a/vendor/google.golang.org/protobuf/internal/impl/checkinit.go b/vendor/google.golang.org/protobuf/internal/impl/checkinit.go index b82341e5..bff041ed 100644 --- a/vendor/google.golang.org/protobuf/internal/impl/checkinit.go +++ b/vendor/google.golang.org/protobuf/internal/impl/checkinit.go @@ -8,18 +8,18 @@ import ( "sync" "google.golang.org/protobuf/internal/errors" - pref "google.golang.org/protobuf/reflect/protoreflect" - piface "google.golang.org/protobuf/runtime/protoiface" + "google.golang.org/protobuf/reflect/protoreflect" + "google.golang.org/protobuf/runtime/protoiface" ) -func (mi *MessageInfo) checkInitialized(in piface.CheckInitializedInput) (piface.CheckInitializedOutput, error) { +func (mi *MessageInfo) checkInitialized(in protoiface.CheckInitializedInput) (protoiface.CheckInitializedOutput, error) { var p pointer if ms, ok := in.Message.(*messageState); ok { p = ms.pointer() } else { p = in.Message.(*messageReflectWrapper).pointer() } - return piface.CheckInitializedOutput{}, mi.checkInitializedPointer(p) + return protoiface.CheckInitializedOutput{}, mi.checkInitializedPointer(p) } func (mi *MessageInfo) checkInitializedPointer(p pointer) error { @@ -90,7 +90,7 @@ var ( // needsInitCheck reports whether a message needs to be checked for partial initialization. // // It returns true if the message transitively includes any required or extension fields. -func needsInitCheck(md pref.MessageDescriptor) bool { +func needsInitCheck(md protoreflect.MessageDescriptor) bool { if v, ok := needsInitCheckMap.Load(md); ok { if has, ok := v.(bool); ok { return has @@ -101,7 +101,7 @@ func needsInitCheck(md pref.MessageDescriptor) bool { return needsInitCheckLocked(md) } -func needsInitCheckLocked(md pref.MessageDescriptor) (has bool) { +func needsInitCheckLocked(md protoreflect.MessageDescriptor) (has bool) { if v, ok := needsInitCheckMap.Load(md); ok { // If has is true, we've previously determined that this message // needs init checks. diff --git a/vendor/google.golang.org/protobuf/internal/impl/codec_extension.go b/vendor/google.golang.org/protobuf/internal/impl/codec_extension.go index 08d35170..e74cefdc 100644 --- a/vendor/google.golang.org/protobuf/internal/impl/codec_extension.go +++ b/vendor/google.golang.org/protobuf/internal/impl/codec_extension.go @@ -10,7 +10,7 @@ import ( "google.golang.org/protobuf/encoding/protowire" "google.golang.org/protobuf/internal/errors" - pref "google.golang.org/protobuf/reflect/protoreflect" + "google.golang.org/protobuf/reflect/protoreflect" ) type extensionFieldInfo struct { @@ -23,7 +23,7 @@ type extensionFieldInfo struct { var legacyExtensionFieldInfoCache sync.Map // map[protoreflect.ExtensionType]*extensionFieldInfo -func getExtensionFieldInfo(xt pref.ExtensionType) *extensionFieldInfo { +func getExtensionFieldInfo(xt protoreflect.ExtensionType) *extensionFieldInfo { if xi, ok := xt.(*ExtensionInfo); ok { xi.lazyInit() return xi.info @@ -32,7 +32,7 @@ func getExtensionFieldInfo(xt pref.ExtensionType) *extensionFieldInfo { } // legacyLoadExtensionFieldInfo dynamically loads a *ExtensionInfo for xt. -func legacyLoadExtensionFieldInfo(xt pref.ExtensionType) *extensionFieldInfo { +func legacyLoadExtensionFieldInfo(xt protoreflect.ExtensionType) *extensionFieldInfo { if xi, ok := legacyExtensionFieldInfoCache.Load(xt); ok { return xi.(*extensionFieldInfo) } @@ -43,7 +43,7 @@ func legacyLoadExtensionFieldInfo(xt pref.ExtensionType) *extensionFieldInfo { return e } -func makeExtensionFieldInfo(xd pref.ExtensionDescriptor) *extensionFieldInfo { +func makeExtensionFieldInfo(xd protoreflect.ExtensionDescriptor) *extensionFieldInfo { var wiretag uint64 if !xd.IsPacked() { wiretag = protowire.EncodeTag(xd.Number(), wireTypes[xd.Kind()]) @@ -59,10 +59,10 @@ func makeExtensionFieldInfo(xd pref.ExtensionDescriptor) *extensionFieldInfo { // This is true for composite types, where we pass in a message, list, or map to fill in, // and for enums, where we pass in a prototype value to specify the concrete enum type. switch xd.Kind() { - case pref.MessageKind, pref.GroupKind, pref.EnumKind: + case protoreflect.MessageKind, protoreflect.GroupKind, protoreflect.EnumKind: e.unmarshalNeedsValue = true default: - if xd.Cardinality() == pref.Repeated { + if xd.Cardinality() == protoreflect.Repeated { e.unmarshalNeedsValue = true } } @@ -73,21 +73,21 @@ type lazyExtensionValue struct { atomicOnce uint32 // atomically set if value is valid mu sync.Mutex xi *extensionFieldInfo - value pref.Value + value protoreflect.Value b []byte - fn func() pref.Value + fn func() protoreflect.Value } type ExtensionField struct { - typ pref.ExtensionType + typ protoreflect.ExtensionType // value is either the value of GetValue, // or a *lazyExtensionValue that then returns the value of GetValue. - value pref.Value + value protoreflect.Value lazy *lazyExtensionValue } -func (f *ExtensionField) appendLazyBytes(xt pref.ExtensionType, xi *extensionFieldInfo, num protowire.Number, wtyp protowire.Type, b []byte) { +func (f *ExtensionField) appendLazyBytes(xt protoreflect.ExtensionType, xi *extensionFieldInfo, num protowire.Number, wtyp protowire.Type, b []byte) { if f.lazy == nil { f.lazy = &lazyExtensionValue{xi: xi} } @@ -97,7 +97,7 @@ func (f *ExtensionField) appendLazyBytes(xt pref.ExtensionType, xi *extensionFie f.lazy.b = append(f.lazy.b, b...) } -func (f *ExtensionField) canLazy(xt pref.ExtensionType) bool { +func (f *ExtensionField) canLazy(xt protoreflect.ExtensionType) bool { if f.typ == nil { return true } @@ -154,7 +154,7 @@ func (f *ExtensionField) lazyInit() { // Set sets the type and value of the extension field. // This must not be called concurrently. -func (f *ExtensionField) Set(t pref.ExtensionType, v pref.Value) { +func (f *ExtensionField) Set(t protoreflect.ExtensionType, v protoreflect.Value) { f.typ = t f.value = v f.lazy = nil @@ -162,14 +162,14 @@ func (f *ExtensionField) Set(t pref.ExtensionType, v pref.Value) { // SetLazy sets the type and a value that is to be lazily evaluated upon first use. // This must not be called concurrently. -func (f *ExtensionField) SetLazy(t pref.ExtensionType, fn func() pref.Value) { +func (f *ExtensionField) SetLazy(t protoreflect.ExtensionType, fn func() protoreflect.Value) { f.typ = t f.lazy = &lazyExtensionValue{fn: fn} } // Value returns the value of the extension field. // This may be called concurrently. -func (f *ExtensionField) Value() pref.Value { +func (f *ExtensionField) Value() protoreflect.Value { if f.lazy != nil { if atomic.LoadUint32(&f.lazy.atomicOnce) == 0 { f.lazyInit() @@ -181,7 +181,7 @@ func (f *ExtensionField) Value() pref.Value { // Type returns the type of the extension field. // This may be called concurrently. -func (f ExtensionField) Type() pref.ExtensionType { +func (f ExtensionField) Type() protoreflect.ExtensionType { return f.typ } @@ -193,7 +193,7 @@ func (f ExtensionField) IsSet() bool { // IsLazy reports whether a field is lazily encoded. // It is exported for testing. -func IsLazy(m pref.Message, fd pref.FieldDescriptor) bool { +func IsLazy(m protoreflect.Message, fd protoreflect.FieldDescriptor) bool { var mi *MessageInfo var p pointer switch m := m.(type) { @@ -206,7 +206,7 @@ func IsLazy(m pref.Message, fd pref.FieldDescriptor) bool { default: return false } - xd, ok := fd.(pref.ExtensionTypeDescriptor) + xd, ok := fd.(protoreflect.ExtensionTypeDescriptor) if !ok { return false } diff --git a/vendor/google.golang.org/protobuf/internal/impl/codec_field.go b/vendor/google.golang.org/protobuf/internal/impl/codec_field.go index cb4b482d..3fadd241 100644 --- a/vendor/google.golang.org/protobuf/internal/impl/codec_field.go +++ b/vendor/google.golang.org/protobuf/internal/impl/codec_field.go @@ -12,9 +12,9 @@ import ( "google.golang.org/protobuf/encoding/protowire" "google.golang.org/protobuf/internal/errors" "google.golang.org/protobuf/proto" - pref "google.golang.org/protobuf/reflect/protoreflect" - preg "google.golang.org/protobuf/reflect/protoregistry" - piface "google.golang.org/protobuf/runtime/protoiface" + "google.golang.org/protobuf/reflect/protoreflect" + "google.golang.org/protobuf/reflect/protoregistry" + "google.golang.org/protobuf/runtime/protoiface" ) type errInvalidUTF8 struct{} @@ -30,7 +30,7 @@ func (errInvalidUTF8) Unwrap() error { return errors.Error } // to the appropriate field-specific function as necessary. // // The unmarshal function is set on each field individually as usual. -func (mi *MessageInfo) initOneofFieldCoders(od pref.OneofDescriptor, si structInfo) { +func (mi *MessageInfo) initOneofFieldCoders(od protoreflect.OneofDescriptor, si structInfo) { fs := si.oneofsByName[od.Name()] ft := fs.Type oneofFields := make(map[reflect.Type]*coderFieldInfo) @@ -118,13 +118,13 @@ func (mi *MessageInfo) initOneofFieldCoders(od pref.OneofDescriptor, si structIn } } -func makeWeakMessageFieldCoder(fd pref.FieldDescriptor) pointerCoderFuncs { +func makeWeakMessageFieldCoder(fd protoreflect.FieldDescriptor) pointerCoderFuncs { var once sync.Once - var messageType pref.MessageType + var messageType protoreflect.MessageType lazyInit := func() { once.Do(func() { messageName := fd.Message().FullName() - messageType, _ = preg.GlobalTypes.FindMessageByName(messageName) + messageType, _ = protoregistry.GlobalTypes.FindMessageByName(messageName) }) } @@ -190,7 +190,7 @@ func makeWeakMessageFieldCoder(fd pref.FieldDescriptor) pointerCoderFuncs { } } -func makeMessageFieldCoder(fd pref.FieldDescriptor, ft reflect.Type) pointerCoderFuncs { +func makeMessageFieldCoder(fd protoreflect.FieldDescriptor, ft reflect.Type) pointerCoderFuncs { if mi := getMessageInfo(ft); mi != nil { funcs := pointerCoderFuncs{ size: sizeMessageInfo, @@ -280,7 +280,7 @@ func consumeMessage(b []byte, m proto.Message, wtyp protowire.Type, opts unmarsh if n < 0 { return out, errDecode } - o, err := opts.Options().UnmarshalState(piface.UnmarshalInput{ + o, err := opts.Options().UnmarshalState(protoiface.UnmarshalInput{ Buf: v, Message: m.ProtoReflect(), }) @@ -288,27 +288,27 @@ func consumeMessage(b []byte, m proto.Message, wtyp protowire.Type, opts unmarsh return out, err } out.n = n - out.initialized = o.Flags&piface.UnmarshalInitialized != 0 + out.initialized = o.Flags&protoiface.UnmarshalInitialized != 0 return out, nil } -func sizeMessageValue(v pref.Value, tagsize int, opts marshalOptions) int { +func sizeMessageValue(v protoreflect.Value, tagsize int, opts marshalOptions) int { m := v.Message().Interface() return sizeMessage(m, tagsize, opts) } -func appendMessageValue(b []byte, v pref.Value, wiretag uint64, opts marshalOptions) ([]byte, error) { +func appendMessageValue(b []byte, v protoreflect.Value, wiretag uint64, opts marshalOptions) ([]byte, error) { m := v.Message().Interface() return appendMessage(b, m, wiretag, opts) } -func consumeMessageValue(b []byte, v pref.Value, _ protowire.Number, wtyp protowire.Type, opts unmarshalOptions) (pref.Value, unmarshalOutput, error) { +func consumeMessageValue(b []byte, v protoreflect.Value, _ protowire.Number, wtyp protowire.Type, opts unmarshalOptions) (protoreflect.Value, unmarshalOutput, error) { m := v.Message().Interface() out, err := consumeMessage(b, m, wtyp, opts) return v, out, err } -func isInitMessageValue(v pref.Value) error { +func isInitMessageValue(v protoreflect.Value) error { m := v.Message().Interface() return proto.CheckInitialized(m) } @@ -321,17 +321,17 @@ var coderMessageValue = valueCoderFuncs{ merge: mergeMessageValue, } -func sizeGroupValue(v pref.Value, tagsize int, opts marshalOptions) int { +func sizeGroupValue(v protoreflect.Value, tagsize int, opts marshalOptions) int { m := v.Message().Interface() return sizeGroup(m, tagsize, opts) } -func appendGroupValue(b []byte, v pref.Value, wiretag uint64, opts marshalOptions) ([]byte, error) { +func appendGroupValue(b []byte, v protoreflect.Value, wiretag uint64, opts marshalOptions) ([]byte, error) { m := v.Message().Interface() return appendGroup(b, m, wiretag, opts) } -func consumeGroupValue(b []byte, v pref.Value, num protowire.Number, wtyp protowire.Type, opts unmarshalOptions) (pref.Value, unmarshalOutput, error) { +func consumeGroupValue(b []byte, v protoreflect.Value, num protowire.Number, wtyp protowire.Type, opts unmarshalOptions) (protoreflect.Value, unmarshalOutput, error) { m := v.Message().Interface() out, err := consumeGroup(b, m, num, wtyp, opts) return v, out, err @@ -345,7 +345,7 @@ var coderGroupValue = valueCoderFuncs{ merge: mergeMessageValue, } -func makeGroupFieldCoder(fd pref.FieldDescriptor, ft reflect.Type) pointerCoderFuncs { +func makeGroupFieldCoder(fd protoreflect.FieldDescriptor, ft reflect.Type) pointerCoderFuncs { num := fd.Number() if mi := getMessageInfo(ft); mi != nil { funcs := pointerCoderFuncs{ @@ -424,7 +424,7 @@ func consumeGroup(b []byte, m proto.Message, num protowire.Number, wtyp protowir if n < 0 { return out, errDecode } - o, err := opts.Options().UnmarshalState(piface.UnmarshalInput{ + o, err := opts.Options().UnmarshalState(protoiface.UnmarshalInput{ Buf: b, Message: m.ProtoReflect(), }) @@ -432,11 +432,11 @@ func consumeGroup(b []byte, m proto.Message, num protowire.Number, wtyp protowir return out, err } out.n = n - out.initialized = o.Flags&piface.UnmarshalInitialized != 0 + out.initialized = o.Flags&protoiface.UnmarshalInitialized != 0 return out, nil } -func makeMessageSliceFieldCoder(fd pref.FieldDescriptor, ft reflect.Type) pointerCoderFuncs { +func makeMessageSliceFieldCoder(fd protoreflect.FieldDescriptor, ft reflect.Type) pointerCoderFuncs { if mi := getMessageInfo(ft); mi != nil { funcs := pointerCoderFuncs{ size: sizeMessageSliceInfo, @@ -555,7 +555,7 @@ func consumeMessageSlice(b []byte, p pointer, goType reflect.Type, wtyp protowir return out, errDecode } mp := reflect.New(goType.Elem()) - o, err := opts.Options().UnmarshalState(piface.UnmarshalInput{ + o, err := opts.Options().UnmarshalState(protoiface.UnmarshalInput{ Buf: v, Message: asMessage(mp).ProtoReflect(), }) @@ -564,7 +564,7 @@ func consumeMessageSlice(b []byte, p pointer, goType reflect.Type, wtyp protowir } p.AppendPointerSlice(pointerOfValue(mp)) out.n = n - out.initialized = o.Flags&piface.UnmarshalInitialized != 0 + out.initialized = o.Flags&protoiface.UnmarshalInitialized != 0 return out, nil } @@ -581,7 +581,7 @@ func isInitMessageSlice(p pointer, goType reflect.Type) error { // Slices of messages -func sizeMessageSliceValue(listv pref.Value, tagsize int, opts marshalOptions) int { +func sizeMessageSliceValue(listv protoreflect.Value, tagsize int, opts marshalOptions) int { list := listv.List() n := 0 for i, llen := 0, list.Len(); i < llen; i++ { @@ -591,7 +591,7 @@ func sizeMessageSliceValue(listv pref.Value, tagsize int, opts marshalOptions) i return n } -func appendMessageSliceValue(b []byte, listv pref.Value, wiretag uint64, opts marshalOptions) ([]byte, error) { +func appendMessageSliceValue(b []byte, listv protoreflect.Value, wiretag uint64, opts marshalOptions) ([]byte, error) { list := listv.List() mopts := opts.Options() for i, llen := 0, list.Len(); i < llen; i++ { @@ -608,30 +608,30 @@ func appendMessageSliceValue(b []byte, listv pref.Value, wiretag uint64, opts ma return b, nil } -func consumeMessageSliceValue(b []byte, listv pref.Value, _ protowire.Number, wtyp protowire.Type, opts unmarshalOptions) (_ pref.Value, out unmarshalOutput, err error) { +func consumeMessageSliceValue(b []byte, listv protoreflect.Value, _ protowire.Number, wtyp protowire.Type, opts unmarshalOptions) (_ protoreflect.Value, out unmarshalOutput, err error) { list := listv.List() if wtyp != protowire.BytesType { - return pref.Value{}, out, errUnknown + return protoreflect.Value{}, out, errUnknown } v, n := protowire.ConsumeBytes(b) if n < 0 { - return pref.Value{}, out, errDecode + return protoreflect.Value{}, out, errDecode } m := list.NewElement() - o, err := opts.Options().UnmarshalState(piface.UnmarshalInput{ + o, err := opts.Options().UnmarshalState(protoiface.UnmarshalInput{ Buf: v, Message: m.Message(), }) if err != nil { - return pref.Value{}, out, err + return protoreflect.Value{}, out, err } list.Append(m) out.n = n - out.initialized = o.Flags&piface.UnmarshalInitialized != 0 + out.initialized = o.Flags&protoiface.UnmarshalInitialized != 0 return listv, out, nil } -func isInitMessageSliceValue(listv pref.Value) error { +func isInitMessageSliceValue(listv protoreflect.Value) error { list := listv.List() for i, llen := 0, list.Len(); i < llen; i++ { m := list.Get(i).Message().Interface() @@ -650,7 +650,7 @@ var coderMessageSliceValue = valueCoderFuncs{ merge: mergeMessageListValue, } -func sizeGroupSliceValue(listv pref.Value, tagsize int, opts marshalOptions) int { +func sizeGroupSliceValue(listv protoreflect.Value, tagsize int, opts marshalOptions) int { list := listv.List() n := 0 for i, llen := 0, list.Len(); i < llen; i++ { @@ -660,7 +660,7 @@ func sizeGroupSliceValue(listv pref.Value, tagsize int, opts marshalOptions) int return n } -func appendGroupSliceValue(b []byte, listv pref.Value, wiretag uint64, opts marshalOptions) ([]byte, error) { +func appendGroupSliceValue(b []byte, listv protoreflect.Value, wiretag uint64, opts marshalOptions) ([]byte, error) { list := listv.List() mopts := opts.Options() for i, llen := 0, list.Len(); i < llen; i++ { @@ -676,26 +676,26 @@ func appendGroupSliceValue(b []byte, listv pref.Value, wiretag uint64, opts mars return b, nil } -func consumeGroupSliceValue(b []byte, listv pref.Value, num protowire.Number, wtyp protowire.Type, opts unmarshalOptions) (_ pref.Value, out unmarshalOutput, err error) { +func consumeGroupSliceValue(b []byte, listv protoreflect.Value, num protowire.Number, wtyp protowire.Type, opts unmarshalOptions) (_ protoreflect.Value, out unmarshalOutput, err error) { list := listv.List() if wtyp != protowire.StartGroupType { - return pref.Value{}, out, errUnknown + return protoreflect.Value{}, out, errUnknown } b, n := protowire.ConsumeGroup(num, b) if n < 0 { - return pref.Value{}, out, errDecode + return protoreflect.Value{}, out, errDecode } m := list.NewElement() - o, err := opts.Options().UnmarshalState(piface.UnmarshalInput{ + o, err := opts.Options().UnmarshalState(protoiface.UnmarshalInput{ Buf: b, Message: m.Message(), }) if err != nil { - return pref.Value{}, out, err + return protoreflect.Value{}, out, err } list.Append(m) out.n = n - out.initialized = o.Flags&piface.UnmarshalInitialized != 0 + out.initialized = o.Flags&protoiface.UnmarshalInitialized != 0 return listv, out, nil } @@ -707,7 +707,7 @@ var coderGroupSliceValue = valueCoderFuncs{ merge: mergeMessageListValue, } -func makeGroupSliceFieldCoder(fd pref.FieldDescriptor, ft reflect.Type) pointerCoderFuncs { +func makeGroupSliceFieldCoder(fd protoreflect.FieldDescriptor, ft reflect.Type) pointerCoderFuncs { num := fd.Number() if mi := getMessageInfo(ft); mi != nil { funcs := pointerCoderFuncs{ @@ -772,7 +772,7 @@ func consumeGroupSlice(b []byte, p pointer, num protowire.Number, wtyp protowire return out, errDecode } mp := reflect.New(goType.Elem()) - o, err := opts.Options().UnmarshalState(piface.UnmarshalInput{ + o, err := opts.Options().UnmarshalState(protoiface.UnmarshalInput{ Buf: b, Message: asMessage(mp).ProtoReflect(), }) @@ -781,7 +781,7 @@ func consumeGroupSlice(b []byte, p pointer, num protowire.Number, wtyp protowire } p.AppendPointerSlice(pointerOfValue(mp)) out.n = n - out.initialized = o.Flags&piface.UnmarshalInitialized != 0 + out.initialized = o.Flags&protoiface.UnmarshalInitialized != 0 return out, nil } @@ -822,8 +822,8 @@ func consumeGroupSliceInfo(b []byte, p pointer, wtyp protowire.Type, f *coderFie return out, nil } -func asMessage(v reflect.Value) pref.ProtoMessage { - if m, ok := v.Interface().(pref.ProtoMessage); ok { +func asMessage(v reflect.Value) protoreflect.ProtoMessage { + if m, ok := v.Interface().(protoreflect.ProtoMessage); ok { return m } return legacyWrapMessage(v).Interface() diff --git a/vendor/google.golang.org/protobuf/internal/impl/codec_map.go b/vendor/google.golang.org/protobuf/internal/impl/codec_map.go index c1245fef..111b9d16 100644 --- a/vendor/google.golang.org/protobuf/internal/impl/codec_map.go +++ b/vendor/google.golang.org/protobuf/internal/impl/codec_map.go @@ -10,7 +10,7 @@ import ( "google.golang.org/protobuf/encoding/protowire" "google.golang.org/protobuf/internal/genid" - pref "google.golang.org/protobuf/reflect/protoreflect" + "google.golang.org/protobuf/reflect/protoreflect" ) type mapInfo struct { @@ -19,12 +19,12 @@ type mapInfo struct { valWiretag uint64 keyFuncs valueCoderFuncs valFuncs valueCoderFuncs - keyZero pref.Value - keyKind pref.Kind + keyZero protoreflect.Value + keyKind protoreflect.Kind conv *mapConverter } -func encoderFuncsForMap(fd pref.FieldDescriptor, ft reflect.Type) (valueMessage *MessageInfo, funcs pointerCoderFuncs) { +func encoderFuncsForMap(fd protoreflect.FieldDescriptor, ft reflect.Type) (valueMessage *MessageInfo, funcs pointerCoderFuncs) { // TODO: Consider generating specialized map coders. keyField := fd.MapKey() valField := fd.MapValue() @@ -44,7 +44,7 @@ func encoderFuncsForMap(fd pref.FieldDescriptor, ft reflect.Type) (valueMessage keyKind: keyField.Kind(), conv: conv, } - if valField.Kind() == pref.MessageKind { + if valField.Kind() == protoreflect.MessageKind { valueMessage = getMessageInfo(ft.Elem()) } @@ -68,9 +68,9 @@ func encoderFuncsForMap(fd pref.FieldDescriptor, ft reflect.Type) (valueMessage }, } switch valField.Kind() { - case pref.MessageKind: + case protoreflect.MessageKind: funcs.merge = mergeMapOfMessage - case pref.BytesKind: + case protoreflect.BytesKind: funcs.merge = mergeMapOfBytes default: funcs.merge = mergeMap @@ -135,7 +135,7 @@ func consumeMap(b []byte, mapv reflect.Value, wtyp protowire.Type, mapi *mapInfo err := errUnknown switch num { case genid.MapEntry_Key_field_number: - var v pref.Value + var v protoreflect.Value var o unmarshalOutput v, o, err = mapi.keyFuncs.unmarshal(b, key, num, wtyp, opts) if err != nil { @@ -144,7 +144,7 @@ func consumeMap(b []byte, mapv reflect.Value, wtyp protowire.Type, mapi *mapInfo key = v n = o.n case genid.MapEntry_Value_field_number: - var v pref.Value + var v protoreflect.Value var o unmarshalOutput v, o, err = mapi.valFuncs.unmarshal(b, val, num, wtyp, opts) if err != nil { @@ -192,7 +192,7 @@ func consumeMapOfMessage(b []byte, mapv reflect.Value, wtyp protowire.Type, mapi err := errUnknown switch num { case 1: - var v pref.Value + var v protoreflect.Value var o unmarshalOutput v, o, err = mapi.keyFuncs.unmarshal(b, key, num, wtyp, opts) if err != nil { diff --git a/vendor/google.golang.org/protobuf/internal/impl/codec_message.go b/vendor/google.golang.org/protobuf/internal/impl/codec_message.go index cd40527f..6b2fdbb7 100644 --- a/vendor/google.golang.org/protobuf/internal/impl/codec_message.go +++ b/vendor/google.golang.org/protobuf/internal/impl/codec_message.go @@ -12,15 +12,15 @@ import ( "google.golang.org/protobuf/encoding/protowire" "google.golang.org/protobuf/internal/encoding/messageset" "google.golang.org/protobuf/internal/order" - pref "google.golang.org/protobuf/reflect/protoreflect" - piface "google.golang.org/protobuf/runtime/protoiface" + "google.golang.org/protobuf/reflect/protoreflect" + "google.golang.org/protobuf/runtime/protoiface" ) // coderMessageInfo contains per-message information used by the fast-path functions. // This is a different type from MessageInfo to keep MessageInfo as general-purpose as // possible. type coderMessageInfo struct { - methods piface.Methods + methods protoiface.Methods orderedCoderFields []*coderFieldInfo denseCoderFields []*coderFieldInfo @@ -38,13 +38,13 @@ type coderFieldInfo struct { funcs pointerCoderFuncs // fast-path per-field functions mi *MessageInfo // field's message ft reflect.Type - validation validationInfo // information used by message validation - num pref.FieldNumber // field number - offset offset // struct field offset - wiretag uint64 // field tag (number + wire type) - tagsize int // size of the varint-encoded tag - isPointer bool // true if IsNil may be called on the struct field - isRequired bool // true if field is required + validation validationInfo // information used by message validation + num protoreflect.FieldNumber // field number + offset offset // struct field offset + wiretag uint64 // field tag (number + wire type) + tagsize int // size of the varint-encoded tag + isPointer bool // true if IsNil may be called on the struct field + isRequired bool // true if field is required } func (mi *MessageInfo) makeCoderMethods(t reflect.Type, si structInfo) { @@ -125,8 +125,8 @@ func (mi *MessageInfo) makeCoderMethods(t reflect.Type, si structInfo) { funcs: funcs, mi: childMessage, validation: newFieldValidationInfo(mi, si, fd, ft), - isPointer: fd.Cardinality() == pref.Repeated || fd.HasPresence(), - isRequired: fd.Cardinality() == pref.Required, + isPointer: fd.Cardinality() == protoreflect.Repeated || fd.HasPresence(), + isRequired: fd.Cardinality() == protoreflect.Required, } mi.orderedCoderFields = append(mi.orderedCoderFields, cf) mi.coderFields[cf.num] = cf @@ -149,7 +149,7 @@ func (mi *MessageInfo) makeCoderMethods(t reflect.Type, si structInfo) { return mi.orderedCoderFields[i].num < mi.orderedCoderFields[j].num }) - var maxDense pref.FieldNumber + var maxDense protoreflect.FieldNumber for _, cf := range mi.orderedCoderFields { if cf.num >= 16 && cf.num >= 2*maxDense { break @@ -175,12 +175,12 @@ func (mi *MessageInfo) makeCoderMethods(t reflect.Type, si structInfo) { mi.needsInitCheck = needsInitCheck(mi.Desc) if mi.methods.Marshal == nil && mi.methods.Size == nil { - mi.methods.Flags |= piface.SupportMarshalDeterministic + mi.methods.Flags |= protoiface.SupportMarshalDeterministic mi.methods.Marshal = mi.marshal mi.methods.Size = mi.size } if mi.methods.Unmarshal == nil { - mi.methods.Flags |= piface.SupportUnmarshalDiscardUnknown + mi.methods.Flags |= protoiface.SupportUnmarshalDiscardUnknown mi.methods.Unmarshal = mi.unmarshal } if mi.methods.CheckInitialized == nil { diff --git a/vendor/google.golang.org/protobuf/internal/impl/codec_tables.go b/vendor/google.golang.org/protobuf/internal/impl/codec_tables.go index e8997123..576dcf3a 100644 --- a/vendor/google.golang.org/protobuf/internal/impl/codec_tables.go +++ b/vendor/google.golang.org/protobuf/internal/impl/codec_tables.go @@ -10,7 +10,7 @@ import ( "google.golang.org/protobuf/encoding/protowire" "google.golang.org/protobuf/internal/strs" - pref "google.golang.org/protobuf/reflect/protoreflect" + "google.golang.org/protobuf/reflect/protoreflect" ) // pointerCoderFuncs is a set of pointer encoding functions. @@ -25,83 +25,83 @@ type pointerCoderFuncs struct { // valueCoderFuncs is a set of protoreflect.Value encoding functions. type valueCoderFuncs struct { - size func(v pref.Value, tagsize int, opts marshalOptions) int - marshal func(b []byte, v pref.Value, wiretag uint64, opts marshalOptions) ([]byte, error) - unmarshal func(b []byte, v pref.Value, num protowire.Number, wtyp protowire.Type, opts unmarshalOptions) (pref.Value, unmarshalOutput, error) - isInit func(v pref.Value) error - merge func(dst, src pref.Value, opts mergeOptions) pref.Value + size func(v protoreflect.Value, tagsize int, opts marshalOptions) int + marshal func(b []byte, v protoreflect.Value, wiretag uint64, opts marshalOptions) ([]byte, error) + unmarshal func(b []byte, v protoreflect.Value, num protowire.Number, wtyp protowire.Type, opts unmarshalOptions) (protoreflect.Value, unmarshalOutput, error) + isInit func(v protoreflect.Value) error + merge func(dst, src protoreflect.Value, opts mergeOptions) protoreflect.Value } // fieldCoder returns pointer functions for a field, used for operating on // struct fields. -func fieldCoder(fd pref.FieldDescriptor, ft reflect.Type) (*MessageInfo, pointerCoderFuncs) { +func fieldCoder(fd protoreflect.FieldDescriptor, ft reflect.Type) (*MessageInfo, pointerCoderFuncs) { switch { case fd.IsMap(): return encoderFuncsForMap(fd, ft) - case fd.Cardinality() == pref.Repeated && !fd.IsPacked(): + case fd.Cardinality() == protoreflect.Repeated && !fd.IsPacked(): // Repeated fields (not packed). if ft.Kind() != reflect.Slice { break } ft := ft.Elem() switch fd.Kind() { - case pref.BoolKind: + case protoreflect.BoolKind: if ft.Kind() == reflect.Bool { return nil, coderBoolSlice } - case pref.EnumKind: + case protoreflect.EnumKind: if ft.Kind() == reflect.Int32 { return nil, coderEnumSlice } - case pref.Int32Kind: + case protoreflect.Int32Kind: if ft.Kind() == reflect.Int32 { return nil, coderInt32Slice } - case pref.Sint32Kind: + case protoreflect.Sint32Kind: if ft.Kind() == reflect.Int32 { return nil, coderSint32Slice } - case pref.Uint32Kind: + case protoreflect.Uint32Kind: if ft.Kind() == reflect.Uint32 { return nil, coderUint32Slice } - case pref.Int64Kind: + case protoreflect.Int64Kind: if ft.Kind() == reflect.Int64 { return nil, coderInt64Slice } - case pref.Sint64Kind: + case protoreflect.Sint64Kind: if ft.Kind() == reflect.Int64 { return nil, coderSint64Slice } - case pref.Uint64Kind: + case protoreflect.Uint64Kind: if ft.Kind() == reflect.Uint64 { return nil, coderUint64Slice } - case pref.Sfixed32Kind: + case protoreflect.Sfixed32Kind: if ft.Kind() == reflect.Int32 { return nil, coderSfixed32Slice } - case pref.Fixed32Kind: + case protoreflect.Fixed32Kind: if ft.Kind() == reflect.Uint32 { return nil, coderFixed32Slice } - case pref.FloatKind: + case protoreflect.FloatKind: if ft.Kind() == reflect.Float32 { return nil, coderFloatSlice } - case pref.Sfixed64Kind: + case protoreflect.Sfixed64Kind: if ft.Kind() == reflect.Int64 { return nil, coderSfixed64Slice } - case pref.Fixed64Kind: + case protoreflect.Fixed64Kind: if ft.Kind() == reflect.Uint64 { return nil, coderFixed64Slice } - case pref.DoubleKind: + case protoreflect.DoubleKind: if ft.Kind() == reflect.Float64 { return nil, coderDoubleSlice } - case pref.StringKind: + case protoreflect.StringKind: if ft.Kind() == reflect.String && strs.EnforceUTF8(fd) { return nil, coderStringSliceValidateUTF8 } @@ -114,19 +114,19 @@ func fieldCoder(fd pref.FieldDescriptor, ft reflect.Type) (*MessageInfo, pointer if ft.Kind() == reflect.Slice && ft.Elem().Kind() == reflect.Uint8 { return nil, coderBytesSlice } - case pref.BytesKind: + case protoreflect.BytesKind: if ft.Kind() == reflect.String { return nil, coderStringSlice } if ft.Kind() == reflect.Slice && ft.Elem().Kind() == reflect.Uint8 { return nil, coderBytesSlice } - case pref.MessageKind: + case protoreflect.MessageKind: return getMessageInfo(ft), makeMessageSliceFieldCoder(fd, ft) - case pref.GroupKind: + case protoreflect.GroupKind: return getMessageInfo(ft), makeGroupSliceFieldCoder(fd, ft) } - case fd.Cardinality() == pref.Repeated && fd.IsPacked(): + case fd.Cardinality() == protoreflect.Repeated && fd.IsPacked(): // Packed repeated fields. // // Only repeated fields of primitive numeric types @@ -136,128 +136,128 @@ func fieldCoder(fd pref.FieldDescriptor, ft reflect.Type) (*MessageInfo, pointer } ft := ft.Elem() switch fd.Kind() { - case pref.BoolKind: + case protoreflect.BoolKind: if ft.Kind() == reflect.Bool { return nil, coderBoolPackedSlice } - case pref.EnumKind: + case protoreflect.EnumKind: if ft.Kind() == reflect.Int32 { return nil, coderEnumPackedSlice } - case pref.Int32Kind: + case protoreflect.Int32Kind: if ft.Kind() == reflect.Int32 { return nil, coderInt32PackedSlice } - case pref.Sint32Kind: + case protoreflect.Sint32Kind: if ft.Kind() == reflect.Int32 { return nil, coderSint32PackedSlice } - case pref.Uint32Kind: + case protoreflect.Uint32Kind: if ft.Kind() == reflect.Uint32 { return nil, coderUint32PackedSlice } - case pref.Int64Kind: + case protoreflect.Int64Kind: if ft.Kind() == reflect.Int64 { return nil, coderInt64PackedSlice } - case pref.Sint64Kind: + case protoreflect.Sint64Kind: if ft.Kind() == reflect.Int64 { return nil, coderSint64PackedSlice } - case pref.Uint64Kind: + case protoreflect.Uint64Kind: if ft.Kind() == reflect.Uint64 { return nil, coderUint64PackedSlice } - case pref.Sfixed32Kind: + case protoreflect.Sfixed32Kind: if ft.Kind() == reflect.Int32 { return nil, coderSfixed32PackedSlice } - case pref.Fixed32Kind: + case protoreflect.Fixed32Kind: if ft.Kind() == reflect.Uint32 { return nil, coderFixed32PackedSlice } - case pref.FloatKind: + case protoreflect.FloatKind: if ft.Kind() == reflect.Float32 { return nil, coderFloatPackedSlice } - case pref.Sfixed64Kind: + case protoreflect.Sfixed64Kind: if ft.Kind() == reflect.Int64 { return nil, coderSfixed64PackedSlice } - case pref.Fixed64Kind: + case protoreflect.Fixed64Kind: if ft.Kind() == reflect.Uint64 { return nil, coderFixed64PackedSlice } - case pref.DoubleKind: + case protoreflect.DoubleKind: if ft.Kind() == reflect.Float64 { return nil, coderDoublePackedSlice } } - case fd.Kind() == pref.MessageKind: + case fd.Kind() == protoreflect.MessageKind: return getMessageInfo(ft), makeMessageFieldCoder(fd, ft) - case fd.Kind() == pref.GroupKind: + case fd.Kind() == protoreflect.GroupKind: return getMessageInfo(ft), makeGroupFieldCoder(fd, ft) - case fd.Syntax() == pref.Proto3 && fd.ContainingOneof() == nil: + case fd.Syntax() == protoreflect.Proto3 && fd.ContainingOneof() == nil: // Populated oneof fields always encode even if set to the zero value, // which normally are not encoded in proto3. switch fd.Kind() { - case pref.BoolKind: + case protoreflect.BoolKind: if ft.Kind() == reflect.Bool { return nil, coderBoolNoZero } - case pref.EnumKind: + case protoreflect.EnumKind: if ft.Kind() == reflect.Int32 { return nil, coderEnumNoZero } - case pref.Int32Kind: + case protoreflect.Int32Kind: if ft.Kind() == reflect.Int32 { return nil, coderInt32NoZero } - case pref.Sint32Kind: + case protoreflect.Sint32Kind: if ft.Kind() == reflect.Int32 { return nil, coderSint32NoZero } - case pref.Uint32Kind: + case protoreflect.Uint32Kind: if ft.Kind() == reflect.Uint32 { return nil, coderUint32NoZero } - case pref.Int64Kind: + case protoreflect.Int64Kind: if ft.Kind() == reflect.Int64 { return nil, coderInt64NoZero } - case pref.Sint64Kind: + case protoreflect.Sint64Kind: if ft.Kind() == reflect.Int64 { return nil, coderSint64NoZero } - case pref.Uint64Kind: + case protoreflect.Uint64Kind: if ft.Kind() == reflect.Uint64 { return nil, coderUint64NoZero } - case pref.Sfixed32Kind: + case protoreflect.Sfixed32Kind: if ft.Kind() == reflect.Int32 { return nil, coderSfixed32NoZero } - case pref.Fixed32Kind: + case protoreflect.Fixed32Kind: if ft.Kind() == reflect.Uint32 { return nil, coderFixed32NoZero } - case pref.FloatKind: + case protoreflect.FloatKind: if ft.Kind() == reflect.Float32 { return nil, coderFloatNoZero } - case pref.Sfixed64Kind: + case protoreflect.Sfixed64Kind: if ft.Kind() == reflect.Int64 { return nil, coderSfixed64NoZero } - case pref.Fixed64Kind: + case protoreflect.Fixed64Kind: if ft.Kind() == reflect.Uint64 { return nil, coderFixed64NoZero } - case pref.DoubleKind: + case protoreflect.DoubleKind: if ft.Kind() == reflect.Float64 { return nil, coderDoubleNoZero } - case pref.StringKind: + case protoreflect.StringKind: if ft.Kind() == reflect.String && strs.EnforceUTF8(fd) { return nil, coderStringNoZeroValidateUTF8 } @@ -270,7 +270,7 @@ func fieldCoder(fd pref.FieldDescriptor, ft reflect.Type) (*MessageInfo, pointer if ft.Kind() == reflect.Slice && ft.Elem().Kind() == reflect.Uint8 { return nil, coderBytesNoZero } - case pref.BytesKind: + case protoreflect.BytesKind: if ft.Kind() == reflect.String { return nil, coderStringNoZero } @@ -281,133 +281,133 @@ func fieldCoder(fd pref.FieldDescriptor, ft reflect.Type) (*MessageInfo, pointer case ft.Kind() == reflect.Ptr: ft := ft.Elem() switch fd.Kind() { - case pref.BoolKind: + case protoreflect.BoolKind: if ft.Kind() == reflect.Bool { return nil, coderBoolPtr } - case pref.EnumKind: + case protoreflect.EnumKind: if ft.Kind() == reflect.Int32 { return nil, coderEnumPtr } - case pref.Int32Kind: + case protoreflect.Int32Kind: if ft.Kind() == reflect.Int32 { return nil, coderInt32Ptr } - case pref.Sint32Kind: + case protoreflect.Sint32Kind: if ft.Kind() == reflect.Int32 { return nil, coderSint32Ptr } - case pref.Uint32Kind: + case protoreflect.Uint32Kind: if ft.Kind() == reflect.Uint32 { return nil, coderUint32Ptr } - case pref.Int64Kind: + case protoreflect.Int64Kind: if ft.Kind() == reflect.Int64 { return nil, coderInt64Ptr } - case pref.Sint64Kind: + case protoreflect.Sint64Kind: if ft.Kind() == reflect.Int64 { return nil, coderSint64Ptr } - case pref.Uint64Kind: + case protoreflect.Uint64Kind: if ft.Kind() == reflect.Uint64 { return nil, coderUint64Ptr } - case pref.Sfixed32Kind: + case protoreflect.Sfixed32Kind: if ft.Kind() == reflect.Int32 { return nil, coderSfixed32Ptr } - case pref.Fixed32Kind: + case protoreflect.Fixed32Kind: if ft.Kind() == reflect.Uint32 { return nil, coderFixed32Ptr } - case pref.FloatKind: + case protoreflect.FloatKind: if ft.Kind() == reflect.Float32 { return nil, coderFloatPtr } - case pref.Sfixed64Kind: + case protoreflect.Sfixed64Kind: if ft.Kind() == reflect.Int64 { return nil, coderSfixed64Ptr } - case pref.Fixed64Kind: + case protoreflect.Fixed64Kind: if ft.Kind() == reflect.Uint64 { return nil, coderFixed64Ptr } - case pref.DoubleKind: + case protoreflect.DoubleKind: if ft.Kind() == reflect.Float64 { return nil, coderDoublePtr } - case pref.StringKind: + case protoreflect.StringKind: if ft.Kind() == reflect.String && strs.EnforceUTF8(fd) { return nil, coderStringPtrValidateUTF8 } if ft.Kind() == reflect.String { return nil, coderStringPtr } - case pref.BytesKind: + case protoreflect.BytesKind: if ft.Kind() == reflect.String { return nil, coderStringPtr } } default: switch fd.Kind() { - case pref.BoolKind: + case protoreflect.BoolKind: if ft.Kind() == reflect.Bool { return nil, coderBool } - case pref.EnumKind: + case protoreflect.EnumKind: if ft.Kind() == reflect.Int32 { return nil, coderEnum } - case pref.Int32Kind: + case protoreflect.Int32Kind: if ft.Kind() == reflect.Int32 { return nil, coderInt32 } - case pref.Sint32Kind: + case protoreflect.Sint32Kind: if ft.Kind() == reflect.Int32 { return nil, coderSint32 } - case pref.Uint32Kind: + case protoreflect.Uint32Kind: if ft.Kind() == reflect.Uint32 { return nil, coderUint32 } - case pref.Int64Kind: + case protoreflect.Int64Kind: if ft.Kind() == reflect.Int64 { return nil, coderInt64 } - case pref.Sint64Kind: + case protoreflect.Sint64Kind: if ft.Kind() == reflect.Int64 { return nil, coderSint64 } - case pref.Uint64Kind: + case protoreflect.Uint64Kind: if ft.Kind() == reflect.Uint64 { return nil, coderUint64 } - case pref.Sfixed32Kind: + case protoreflect.Sfixed32Kind: if ft.Kind() == reflect.Int32 { return nil, coderSfixed32 } - case pref.Fixed32Kind: + case protoreflect.Fixed32Kind: if ft.Kind() == reflect.Uint32 { return nil, coderFixed32 } - case pref.FloatKind: + case protoreflect.FloatKind: if ft.Kind() == reflect.Float32 { return nil, coderFloat } - case pref.Sfixed64Kind: + case protoreflect.Sfixed64Kind: if ft.Kind() == reflect.Int64 { return nil, coderSfixed64 } - case pref.Fixed64Kind: + case protoreflect.Fixed64Kind: if ft.Kind() == reflect.Uint64 { return nil, coderFixed64 } - case pref.DoubleKind: + case protoreflect.DoubleKind: if ft.Kind() == reflect.Float64 { return nil, coderDouble } - case pref.StringKind: + case protoreflect.StringKind: if ft.Kind() == reflect.String && strs.EnforceUTF8(fd) { return nil, coderStringValidateUTF8 } @@ -420,7 +420,7 @@ func fieldCoder(fd pref.FieldDescriptor, ft reflect.Type) (*MessageInfo, pointer if ft.Kind() == reflect.Slice && ft.Elem().Kind() == reflect.Uint8 { return nil, coderBytes } - case pref.BytesKind: + case protoreflect.BytesKind: if ft.Kind() == reflect.String { return nil, coderString } @@ -434,122 +434,122 @@ func fieldCoder(fd pref.FieldDescriptor, ft reflect.Type) (*MessageInfo, pointer // encoderFuncsForValue returns value functions for a field, used for // extension values and map encoding. -func encoderFuncsForValue(fd pref.FieldDescriptor) valueCoderFuncs { +func encoderFuncsForValue(fd protoreflect.FieldDescriptor) valueCoderFuncs { switch { - case fd.Cardinality() == pref.Repeated && !fd.IsPacked(): + case fd.Cardinality() == protoreflect.Repeated && !fd.IsPacked(): switch fd.Kind() { - case pref.BoolKind: + case protoreflect.BoolKind: return coderBoolSliceValue - case pref.EnumKind: + case protoreflect.EnumKind: return coderEnumSliceValue - case pref.Int32Kind: + case protoreflect.Int32Kind: return coderInt32SliceValue - case pref.Sint32Kind: + case protoreflect.Sint32Kind: return coderSint32SliceValue - case pref.Uint32Kind: + case protoreflect.Uint32Kind: return coderUint32SliceValue - case pref.Int64Kind: + case protoreflect.Int64Kind: return coderInt64SliceValue - case pref.Sint64Kind: + case protoreflect.Sint64Kind: return coderSint64SliceValue - case pref.Uint64Kind: + case protoreflect.Uint64Kind: return coderUint64SliceValue - case pref.Sfixed32Kind: + case protoreflect.Sfixed32Kind: return coderSfixed32SliceValue - case pref.Fixed32Kind: + case protoreflect.Fixed32Kind: return coderFixed32SliceValue - case pref.FloatKind: + case protoreflect.FloatKind: return coderFloatSliceValue - case pref.Sfixed64Kind: + case protoreflect.Sfixed64Kind: return coderSfixed64SliceValue - case pref.Fixed64Kind: + case protoreflect.Fixed64Kind: return coderFixed64SliceValue - case pref.DoubleKind: + case protoreflect.DoubleKind: return coderDoubleSliceValue - case pref.StringKind: + case protoreflect.StringKind: // We don't have a UTF-8 validating coder for repeated string fields. // Value coders are used for extensions and maps. // Extensions are never proto3, and maps never contain lists. return coderStringSliceValue - case pref.BytesKind: + case protoreflect.BytesKind: return coderBytesSliceValue - case pref.MessageKind: + case protoreflect.MessageKind: return coderMessageSliceValue - case pref.GroupKind: + case protoreflect.GroupKind: return coderGroupSliceValue } - case fd.Cardinality() == pref.Repeated && fd.IsPacked(): + case fd.Cardinality() == protoreflect.Repeated && fd.IsPacked(): switch fd.Kind() { - case pref.BoolKind: + case protoreflect.BoolKind: return coderBoolPackedSliceValue - case pref.EnumKind: + case protoreflect.EnumKind: return coderEnumPackedSliceValue - case pref.Int32Kind: + case protoreflect.Int32Kind: return coderInt32PackedSliceValue - case pref.Sint32Kind: + case protoreflect.Sint32Kind: return coderSint32PackedSliceValue - case pref.Uint32Kind: + case protoreflect.Uint32Kind: return coderUint32PackedSliceValue - case pref.Int64Kind: + case protoreflect.Int64Kind: return coderInt64PackedSliceValue - case pref.Sint64Kind: + case protoreflect.Sint64Kind: return coderSint64PackedSliceValue - case pref.Uint64Kind: + case protoreflect.Uint64Kind: return coderUint64PackedSliceValue - case pref.Sfixed32Kind: + case protoreflect.Sfixed32Kind: return coderSfixed32PackedSliceValue - case pref.Fixed32Kind: + case protoreflect.Fixed32Kind: return coderFixed32PackedSliceValue - case pref.FloatKind: + case protoreflect.FloatKind: return coderFloatPackedSliceValue - case pref.Sfixed64Kind: + case protoreflect.Sfixed64Kind: return coderSfixed64PackedSliceValue - case pref.Fixed64Kind: + case protoreflect.Fixed64Kind: return coderFixed64PackedSliceValue - case pref.DoubleKind: + case protoreflect.DoubleKind: return coderDoublePackedSliceValue } default: switch fd.Kind() { default: - case pref.BoolKind: + case protoreflect.BoolKind: return coderBoolValue - case pref.EnumKind: + case protoreflect.EnumKind: return coderEnumValue - case pref.Int32Kind: + case protoreflect.Int32Kind: return coderInt32Value - case pref.Sint32Kind: + case protoreflect.Sint32Kind: return coderSint32Value - case pref.Uint32Kind: + case protoreflect.Uint32Kind: return coderUint32Value - case pref.Int64Kind: + case protoreflect.Int64Kind: return coderInt64Value - case pref.Sint64Kind: + case protoreflect.Sint64Kind: return coderSint64Value - case pref.Uint64Kind: + case protoreflect.Uint64Kind: return coderUint64Value - case pref.Sfixed32Kind: + case protoreflect.Sfixed32Kind: return coderSfixed32Value - case pref.Fixed32Kind: + case protoreflect.Fixed32Kind: return coderFixed32Value - case pref.FloatKind: + case protoreflect.FloatKind: return coderFloatValue - case pref.Sfixed64Kind: + case protoreflect.Sfixed64Kind: return coderSfixed64Value - case pref.Fixed64Kind: + case protoreflect.Fixed64Kind: return coderFixed64Value - case pref.DoubleKind: + case protoreflect.DoubleKind: return coderDoubleValue - case pref.StringKind: + case protoreflect.StringKind: if strs.EnforceUTF8(fd) { return coderStringValueValidateUTF8 } return coderStringValue - case pref.BytesKind: + case protoreflect.BytesKind: return coderBytesValue - case pref.MessageKind: + case protoreflect.MessageKind: return coderMessageValue - case pref.GroupKind: + case protoreflect.GroupKind: return coderGroupValue } } diff --git a/vendor/google.golang.org/protobuf/internal/impl/convert.go b/vendor/google.golang.org/protobuf/internal/impl/convert.go index acd61bb5..11a6128b 100644 --- a/vendor/google.golang.org/protobuf/internal/impl/convert.go +++ b/vendor/google.golang.org/protobuf/internal/impl/convert.go @@ -8,7 +8,7 @@ import ( "fmt" "reflect" - pref "google.golang.org/protobuf/reflect/protoreflect" + "google.golang.org/protobuf/reflect/protoreflect" ) // unwrapper unwraps the value to the underlying value. @@ -20,13 +20,13 @@ type unwrapper interface { // A Converter coverts to/from Go reflect.Value types and protobuf protoreflect.Value types. type Converter interface { // PBValueOf converts a reflect.Value to a protoreflect.Value. - PBValueOf(reflect.Value) pref.Value + PBValueOf(reflect.Value) protoreflect.Value // GoValueOf converts a protoreflect.Value to a reflect.Value. - GoValueOf(pref.Value) reflect.Value + GoValueOf(protoreflect.Value) reflect.Value // IsValidPB returns whether a protoreflect.Value is compatible with this type. - IsValidPB(pref.Value) bool + IsValidPB(protoreflect.Value) bool // IsValidGo returns whether a reflect.Value is compatible with this type. IsValidGo(reflect.Value) bool @@ -34,12 +34,12 @@ type Converter interface { // New returns a new field value. // For scalars, it returns the default value of the field. // For composite types, it returns a new mutable value. - New() pref.Value + New() protoreflect.Value // Zero returns a new field value. // For scalars, it returns the default value of the field. // For composite types, it returns an immutable, empty value. - Zero() pref.Value + Zero() protoreflect.Value } // NewConverter matches a Go type with a protobuf field and returns a Converter @@ -50,7 +50,7 @@ type Converter interface { // This matcher deliberately supports a wider range of Go types than what // protoc-gen-go historically generated to be able to automatically wrap some // v1 messages generated by other forks of protoc-gen-go. -func NewConverter(t reflect.Type, fd pref.FieldDescriptor) Converter { +func NewConverter(t reflect.Type, fd protoreflect.FieldDescriptor) Converter { switch { case fd.IsList(): return newListConverter(t, fd) @@ -76,68 +76,68 @@ var ( ) var ( - boolZero = pref.ValueOfBool(false) - int32Zero = pref.ValueOfInt32(0) - int64Zero = pref.ValueOfInt64(0) - uint32Zero = pref.ValueOfUint32(0) - uint64Zero = pref.ValueOfUint64(0) - float32Zero = pref.ValueOfFloat32(0) - float64Zero = pref.ValueOfFloat64(0) - stringZero = pref.ValueOfString("") - bytesZero = pref.ValueOfBytes(nil) + boolZero = protoreflect.ValueOfBool(false) + int32Zero = protoreflect.ValueOfInt32(0) + int64Zero = protoreflect.ValueOfInt64(0) + uint32Zero = protoreflect.ValueOfUint32(0) + uint64Zero = protoreflect.ValueOfUint64(0) + float32Zero = protoreflect.ValueOfFloat32(0) + float64Zero = protoreflect.ValueOfFloat64(0) + stringZero = protoreflect.ValueOfString("") + bytesZero = protoreflect.ValueOfBytes(nil) ) -func newSingularConverter(t reflect.Type, fd pref.FieldDescriptor) Converter { - defVal := func(fd pref.FieldDescriptor, zero pref.Value) pref.Value { - if fd.Cardinality() == pref.Repeated { +func newSingularConverter(t reflect.Type, fd protoreflect.FieldDescriptor) Converter { + defVal := func(fd protoreflect.FieldDescriptor, zero protoreflect.Value) protoreflect.Value { + if fd.Cardinality() == protoreflect.Repeated { // Default isn't defined for repeated fields. return zero } return fd.Default() } switch fd.Kind() { - case pref.BoolKind: + case protoreflect.BoolKind: if t.Kind() == reflect.Bool { return &boolConverter{t, defVal(fd, boolZero)} } - case pref.Int32Kind, pref.Sint32Kind, pref.Sfixed32Kind: + case protoreflect.Int32Kind, protoreflect.Sint32Kind, protoreflect.Sfixed32Kind: if t.Kind() == reflect.Int32 { return &int32Converter{t, defVal(fd, int32Zero)} } - case pref.Int64Kind, pref.Sint64Kind, pref.Sfixed64Kind: + case protoreflect.Int64Kind, protoreflect.Sint64Kind, protoreflect.Sfixed64Kind: if t.Kind() == reflect.Int64 { return &int64Converter{t, defVal(fd, int64Zero)} } - case pref.Uint32Kind, pref.Fixed32Kind: + case protoreflect.Uint32Kind, protoreflect.Fixed32Kind: if t.Kind() == reflect.Uint32 { return &uint32Converter{t, defVal(fd, uint32Zero)} } - case pref.Uint64Kind, pref.Fixed64Kind: + case protoreflect.Uint64Kind, protoreflect.Fixed64Kind: if t.Kind() == reflect.Uint64 { return &uint64Converter{t, defVal(fd, uint64Zero)} } - case pref.FloatKind: + case protoreflect.FloatKind: if t.Kind() == reflect.Float32 { return &float32Converter{t, defVal(fd, float32Zero)} } - case pref.DoubleKind: + case protoreflect.DoubleKind: if t.Kind() == reflect.Float64 { return &float64Converter{t, defVal(fd, float64Zero)} } - case pref.StringKind: + case protoreflect.StringKind: if t.Kind() == reflect.String || (t.Kind() == reflect.Slice && t.Elem() == byteType) { return &stringConverter{t, defVal(fd, stringZero)} } - case pref.BytesKind: + case protoreflect.BytesKind: if t.Kind() == reflect.String || (t.Kind() == reflect.Slice && t.Elem() == byteType) { return &bytesConverter{t, defVal(fd, bytesZero)} } - case pref.EnumKind: + case protoreflect.EnumKind: // Handle enums, which must be a named int32 type. if t.Kind() == reflect.Int32 { return newEnumConverter(t, fd) } - case pref.MessageKind, pref.GroupKind: + case protoreflect.MessageKind, protoreflect.GroupKind: return newMessageConverter(t) } panic(fmt.Sprintf("invalid Go type %v for field %v", t, fd.FullName())) @@ -145,184 +145,184 @@ func newSingularConverter(t reflect.Type, fd pref.FieldDescriptor) Converter { type boolConverter struct { goType reflect.Type - def pref.Value + def protoreflect.Value } -func (c *boolConverter) PBValueOf(v reflect.Value) pref.Value { +func (c *boolConverter) PBValueOf(v reflect.Value) protoreflect.Value { if v.Type() != c.goType { panic(fmt.Sprintf("invalid type: got %v, want %v", v.Type(), c.goType)) } - return pref.ValueOfBool(v.Bool()) + return protoreflect.ValueOfBool(v.Bool()) } -func (c *boolConverter) GoValueOf(v pref.Value) reflect.Value { +func (c *boolConverter) GoValueOf(v protoreflect.Value) reflect.Value { return reflect.ValueOf(v.Bool()).Convert(c.goType) } -func (c *boolConverter) IsValidPB(v pref.Value) bool { +func (c *boolConverter) IsValidPB(v protoreflect.Value) bool { _, ok := v.Interface().(bool) return ok } func (c *boolConverter) IsValidGo(v reflect.Value) bool { return v.IsValid() && v.Type() == c.goType } -func (c *boolConverter) New() pref.Value { return c.def } -func (c *boolConverter) Zero() pref.Value { return c.def } +func (c *boolConverter) New() protoreflect.Value { return c.def } +func (c *boolConverter) Zero() protoreflect.Value { return c.def } type int32Converter struct { goType reflect.Type - def pref.Value + def protoreflect.Value } -func (c *int32Converter) PBValueOf(v reflect.Value) pref.Value { +func (c *int32Converter) PBValueOf(v reflect.Value) protoreflect.Value { if v.Type() != c.goType { panic(fmt.Sprintf("invalid type: got %v, want %v", v.Type(), c.goType)) } - return pref.ValueOfInt32(int32(v.Int())) + return protoreflect.ValueOfInt32(int32(v.Int())) } -func (c *int32Converter) GoValueOf(v pref.Value) reflect.Value { +func (c *int32Converter) GoValueOf(v protoreflect.Value) reflect.Value { return reflect.ValueOf(int32(v.Int())).Convert(c.goType) } -func (c *int32Converter) IsValidPB(v pref.Value) bool { +func (c *int32Converter) IsValidPB(v protoreflect.Value) bool { _, ok := v.Interface().(int32) return ok } func (c *int32Converter) IsValidGo(v reflect.Value) bool { return v.IsValid() && v.Type() == c.goType } -func (c *int32Converter) New() pref.Value { return c.def } -func (c *int32Converter) Zero() pref.Value { return c.def } +func (c *int32Converter) New() protoreflect.Value { return c.def } +func (c *int32Converter) Zero() protoreflect.Value { return c.def } type int64Converter struct { goType reflect.Type - def pref.Value + def protoreflect.Value } -func (c *int64Converter) PBValueOf(v reflect.Value) pref.Value { +func (c *int64Converter) PBValueOf(v reflect.Value) protoreflect.Value { if v.Type() != c.goType { panic(fmt.Sprintf("invalid type: got %v, want %v", v.Type(), c.goType)) } - return pref.ValueOfInt64(int64(v.Int())) + return protoreflect.ValueOfInt64(int64(v.Int())) } -func (c *int64Converter) GoValueOf(v pref.Value) reflect.Value { +func (c *int64Converter) GoValueOf(v protoreflect.Value) reflect.Value { return reflect.ValueOf(int64(v.Int())).Convert(c.goType) } -func (c *int64Converter) IsValidPB(v pref.Value) bool { +func (c *int64Converter) IsValidPB(v protoreflect.Value) bool { _, ok := v.Interface().(int64) return ok } func (c *int64Converter) IsValidGo(v reflect.Value) bool { return v.IsValid() && v.Type() == c.goType } -func (c *int64Converter) New() pref.Value { return c.def } -func (c *int64Converter) Zero() pref.Value { return c.def } +func (c *int64Converter) New() protoreflect.Value { return c.def } +func (c *int64Converter) Zero() protoreflect.Value { return c.def } type uint32Converter struct { goType reflect.Type - def pref.Value + def protoreflect.Value } -func (c *uint32Converter) PBValueOf(v reflect.Value) pref.Value { +func (c *uint32Converter) PBValueOf(v reflect.Value) protoreflect.Value { if v.Type() != c.goType { panic(fmt.Sprintf("invalid type: got %v, want %v", v.Type(), c.goType)) } - return pref.ValueOfUint32(uint32(v.Uint())) + return protoreflect.ValueOfUint32(uint32(v.Uint())) } -func (c *uint32Converter) GoValueOf(v pref.Value) reflect.Value { +func (c *uint32Converter) GoValueOf(v protoreflect.Value) reflect.Value { return reflect.ValueOf(uint32(v.Uint())).Convert(c.goType) } -func (c *uint32Converter) IsValidPB(v pref.Value) bool { +func (c *uint32Converter) IsValidPB(v protoreflect.Value) bool { _, ok := v.Interface().(uint32) return ok } func (c *uint32Converter) IsValidGo(v reflect.Value) bool { return v.IsValid() && v.Type() == c.goType } -func (c *uint32Converter) New() pref.Value { return c.def } -func (c *uint32Converter) Zero() pref.Value { return c.def } +func (c *uint32Converter) New() protoreflect.Value { return c.def } +func (c *uint32Converter) Zero() protoreflect.Value { return c.def } type uint64Converter struct { goType reflect.Type - def pref.Value + def protoreflect.Value } -func (c *uint64Converter) PBValueOf(v reflect.Value) pref.Value { +func (c *uint64Converter) PBValueOf(v reflect.Value) protoreflect.Value { if v.Type() != c.goType { panic(fmt.Sprintf("invalid type: got %v, want %v", v.Type(), c.goType)) } - return pref.ValueOfUint64(uint64(v.Uint())) + return protoreflect.ValueOfUint64(uint64(v.Uint())) } -func (c *uint64Converter) GoValueOf(v pref.Value) reflect.Value { +func (c *uint64Converter) GoValueOf(v protoreflect.Value) reflect.Value { return reflect.ValueOf(uint64(v.Uint())).Convert(c.goType) } -func (c *uint64Converter) IsValidPB(v pref.Value) bool { +func (c *uint64Converter) IsValidPB(v protoreflect.Value) bool { _, ok := v.Interface().(uint64) return ok } func (c *uint64Converter) IsValidGo(v reflect.Value) bool { return v.IsValid() && v.Type() == c.goType } -func (c *uint64Converter) New() pref.Value { return c.def } -func (c *uint64Converter) Zero() pref.Value { return c.def } +func (c *uint64Converter) New() protoreflect.Value { return c.def } +func (c *uint64Converter) Zero() protoreflect.Value { return c.def } type float32Converter struct { goType reflect.Type - def pref.Value + def protoreflect.Value } -func (c *float32Converter) PBValueOf(v reflect.Value) pref.Value { +func (c *float32Converter) PBValueOf(v reflect.Value) protoreflect.Value { if v.Type() != c.goType { panic(fmt.Sprintf("invalid type: got %v, want %v", v.Type(), c.goType)) } - return pref.ValueOfFloat32(float32(v.Float())) + return protoreflect.ValueOfFloat32(float32(v.Float())) } -func (c *float32Converter) GoValueOf(v pref.Value) reflect.Value { +func (c *float32Converter) GoValueOf(v protoreflect.Value) reflect.Value { return reflect.ValueOf(float32(v.Float())).Convert(c.goType) } -func (c *float32Converter) IsValidPB(v pref.Value) bool { +func (c *float32Converter) IsValidPB(v protoreflect.Value) bool { _, ok := v.Interface().(float32) return ok } func (c *float32Converter) IsValidGo(v reflect.Value) bool { return v.IsValid() && v.Type() == c.goType } -func (c *float32Converter) New() pref.Value { return c.def } -func (c *float32Converter) Zero() pref.Value { return c.def } +func (c *float32Converter) New() protoreflect.Value { return c.def } +func (c *float32Converter) Zero() protoreflect.Value { return c.def } type float64Converter struct { goType reflect.Type - def pref.Value + def protoreflect.Value } -func (c *float64Converter) PBValueOf(v reflect.Value) pref.Value { +func (c *float64Converter) PBValueOf(v reflect.Value) protoreflect.Value { if v.Type() != c.goType { panic(fmt.Sprintf("invalid type: got %v, want %v", v.Type(), c.goType)) } - return pref.ValueOfFloat64(float64(v.Float())) + return protoreflect.ValueOfFloat64(float64(v.Float())) } -func (c *float64Converter) GoValueOf(v pref.Value) reflect.Value { +func (c *float64Converter) GoValueOf(v protoreflect.Value) reflect.Value { return reflect.ValueOf(float64(v.Float())).Convert(c.goType) } -func (c *float64Converter) IsValidPB(v pref.Value) bool { +func (c *float64Converter) IsValidPB(v protoreflect.Value) bool { _, ok := v.Interface().(float64) return ok } func (c *float64Converter) IsValidGo(v reflect.Value) bool { return v.IsValid() && v.Type() == c.goType } -func (c *float64Converter) New() pref.Value { return c.def } -func (c *float64Converter) Zero() pref.Value { return c.def } +func (c *float64Converter) New() protoreflect.Value { return c.def } +func (c *float64Converter) Zero() protoreflect.Value { return c.def } type stringConverter struct { goType reflect.Type - def pref.Value + def protoreflect.Value } -func (c *stringConverter) PBValueOf(v reflect.Value) pref.Value { +func (c *stringConverter) PBValueOf(v reflect.Value) protoreflect.Value { if v.Type() != c.goType { panic(fmt.Sprintf("invalid type: got %v, want %v", v.Type(), c.goType)) } - return pref.ValueOfString(v.Convert(stringType).String()) + return protoreflect.ValueOfString(v.Convert(stringType).String()) } -func (c *stringConverter) GoValueOf(v pref.Value) reflect.Value { +func (c *stringConverter) GoValueOf(v protoreflect.Value) reflect.Value { // pref.Value.String never panics, so we go through an interface // conversion here to check the type. s := v.Interface().(string) @@ -331,71 +331,71 @@ func (c *stringConverter) GoValueOf(v pref.Value) reflect.Value { } return reflect.ValueOf(s).Convert(c.goType) } -func (c *stringConverter) IsValidPB(v pref.Value) bool { +func (c *stringConverter) IsValidPB(v protoreflect.Value) bool { _, ok := v.Interface().(string) return ok } func (c *stringConverter) IsValidGo(v reflect.Value) bool { return v.IsValid() && v.Type() == c.goType } -func (c *stringConverter) New() pref.Value { return c.def } -func (c *stringConverter) Zero() pref.Value { return c.def } +func (c *stringConverter) New() protoreflect.Value { return c.def } +func (c *stringConverter) Zero() protoreflect.Value { return c.def } type bytesConverter struct { goType reflect.Type - def pref.Value + def protoreflect.Value } -func (c *bytesConverter) PBValueOf(v reflect.Value) pref.Value { +func (c *bytesConverter) PBValueOf(v reflect.Value) protoreflect.Value { if v.Type() != c.goType { panic(fmt.Sprintf("invalid type: got %v, want %v", v.Type(), c.goType)) } if c.goType.Kind() == reflect.String && v.Len() == 0 { - return pref.ValueOfBytes(nil) // ensure empty string is []byte(nil) + return protoreflect.ValueOfBytes(nil) // ensure empty string is []byte(nil) } - return pref.ValueOfBytes(v.Convert(bytesType).Bytes()) + return protoreflect.ValueOfBytes(v.Convert(bytesType).Bytes()) } -func (c *bytesConverter) GoValueOf(v pref.Value) reflect.Value { +func (c *bytesConverter) GoValueOf(v protoreflect.Value) reflect.Value { return reflect.ValueOf(v.Bytes()).Convert(c.goType) } -func (c *bytesConverter) IsValidPB(v pref.Value) bool { +func (c *bytesConverter) IsValidPB(v protoreflect.Value) bool { _, ok := v.Interface().([]byte) return ok } func (c *bytesConverter) IsValidGo(v reflect.Value) bool { return v.IsValid() && v.Type() == c.goType } -func (c *bytesConverter) New() pref.Value { return c.def } -func (c *bytesConverter) Zero() pref.Value { return c.def } +func (c *bytesConverter) New() protoreflect.Value { return c.def } +func (c *bytesConverter) Zero() protoreflect.Value { return c.def } type enumConverter struct { goType reflect.Type - def pref.Value + def protoreflect.Value } -func newEnumConverter(goType reflect.Type, fd pref.FieldDescriptor) Converter { - var def pref.Value - if fd.Cardinality() == pref.Repeated { - def = pref.ValueOfEnum(fd.Enum().Values().Get(0).Number()) +func newEnumConverter(goType reflect.Type, fd protoreflect.FieldDescriptor) Converter { + var def protoreflect.Value + if fd.Cardinality() == protoreflect.Repeated { + def = protoreflect.ValueOfEnum(fd.Enum().Values().Get(0).Number()) } else { def = fd.Default() } return &enumConverter{goType, def} } -func (c *enumConverter) PBValueOf(v reflect.Value) pref.Value { +func (c *enumConverter) PBValueOf(v reflect.Value) protoreflect.Value { if v.Type() != c.goType { panic(fmt.Sprintf("invalid type: got %v, want %v", v.Type(), c.goType)) } - return pref.ValueOfEnum(pref.EnumNumber(v.Int())) + return protoreflect.ValueOfEnum(protoreflect.EnumNumber(v.Int())) } -func (c *enumConverter) GoValueOf(v pref.Value) reflect.Value { +func (c *enumConverter) GoValueOf(v protoreflect.Value) reflect.Value { return reflect.ValueOf(v.Enum()).Convert(c.goType) } -func (c *enumConverter) IsValidPB(v pref.Value) bool { - _, ok := v.Interface().(pref.EnumNumber) +func (c *enumConverter) IsValidPB(v protoreflect.Value) bool { + _, ok := v.Interface().(protoreflect.EnumNumber) return ok } @@ -403,11 +403,11 @@ func (c *enumConverter) IsValidGo(v reflect.Value) bool { return v.IsValid() && v.Type() == c.goType } -func (c *enumConverter) New() pref.Value { +func (c *enumConverter) New() protoreflect.Value { return c.def } -func (c *enumConverter) Zero() pref.Value { +func (c *enumConverter) Zero() protoreflect.Value { return c.def } @@ -419,7 +419,7 @@ func newMessageConverter(goType reflect.Type) Converter { return &messageConverter{goType} } -func (c *messageConverter) PBValueOf(v reflect.Value) pref.Value { +func (c *messageConverter) PBValueOf(v reflect.Value) protoreflect.Value { if v.Type() != c.goType { panic(fmt.Sprintf("invalid type: got %v, want %v", v.Type(), c.goType)) } @@ -430,13 +430,13 @@ func (c *messageConverter) PBValueOf(v reflect.Value) pref.Value { v = reflect.Zero(reflect.PtrTo(v.Type())) } } - if m, ok := v.Interface().(pref.ProtoMessage); ok { - return pref.ValueOfMessage(m.ProtoReflect()) + if m, ok := v.Interface().(protoreflect.ProtoMessage); ok { + return protoreflect.ValueOfMessage(m.ProtoReflect()) } - return pref.ValueOfMessage(legacyWrapMessage(v)) + return protoreflect.ValueOfMessage(legacyWrapMessage(v)) } -func (c *messageConverter) GoValueOf(v pref.Value) reflect.Value { +func (c *messageConverter) GoValueOf(v protoreflect.Value) reflect.Value { m := v.Message() var rv reflect.Value if u, ok := m.(unwrapper); ok { @@ -460,7 +460,7 @@ func (c *messageConverter) GoValueOf(v pref.Value) reflect.Value { return rv } -func (c *messageConverter) IsValidPB(v pref.Value) bool { +func (c *messageConverter) IsValidPB(v protoreflect.Value) bool { m := v.Message() var rv reflect.Value if u, ok := m.(unwrapper); ok { @@ -478,14 +478,14 @@ func (c *messageConverter) IsValidGo(v reflect.Value) bool { return v.IsValid() && v.Type() == c.goType } -func (c *messageConverter) New() pref.Value { +func (c *messageConverter) New() protoreflect.Value { if c.isNonPointer() { return c.PBValueOf(reflect.New(c.goType).Elem()) } return c.PBValueOf(reflect.New(c.goType.Elem())) } -func (c *messageConverter) Zero() pref.Value { +func (c *messageConverter) Zero() protoreflect.Value { return c.PBValueOf(reflect.Zero(c.goType)) } diff --git a/vendor/google.golang.org/protobuf/internal/impl/convert_list.go b/vendor/google.golang.org/protobuf/internal/impl/convert_list.go index 6fccab52..f8913651 100644 --- a/vendor/google.golang.org/protobuf/internal/impl/convert_list.go +++ b/vendor/google.golang.org/protobuf/internal/impl/convert_list.go @@ -8,10 +8,10 @@ import ( "fmt" "reflect" - pref "google.golang.org/protobuf/reflect/protoreflect" + "google.golang.org/protobuf/reflect/protoreflect" ) -func newListConverter(t reflect.Type, fd pref.FieldDescriptor) Converter { +func newListConverter(t reflect.Type, fd protoreflect.FieldDescriptor) Converter { switch { case t.Kind() == reflect.Ptr && t.Elem().Kind() == reflect.Slice: return &listPtrConverter{t, newSingularConverter(t.Elem().Elem(), fd)} @@ -26,16 +26,16 @@ type listConverter struct { c Converter } -func (c *listConverter) PBValueOf(v reflect.Value) pref.Value { +func (c *listConverter) PBValueOf(v reflect.Value) protoreflect.Value { if v.Type() != c.goType { panic(fmt.Sprintf("invalid type: got %v, want %v", v.Type(), c.goType)) } pv := reflect.New(c.goType) pv.Elem().Set(v) - return pref.ValueOfList(&listReflect{pv, c.c}) + return protoreflect.ValueOfList(&listReflect{pv, c.c}) } -func (c *listConverter) GoValueOf(v pref.Value) reflect.Value { +func (c *listConverter) GoValueOf(v protoreflect.Value) reflect.Value { rv := v.List().(*listReflect).v if rv.IsNil() { return reflect.Zero(c.goType) @@ -43,7 +43,7 @@ func (c *listConverter) GoValueOf(v pref.Value) reflect.Value { return rv.Elem() } -func (c *listConverter) IsValidPB(v pref.Value) bool { +func (c *listConverter) IsValidPB(v protoreflect.Value) bool { list, ok := v.Interface().(*listReflect) if !ok { return false @@ -55,12 +55,12 @@ func (c *listConverter) IsValidGo(v reflect.Value) bool { return v.IsValid() && v.Type() == c.goType } -func (c *listConverter) New() pref.Value { - return pref.ValueOfList(&listReflect{reflect.New(c.goType), c.c}) +func (c *listConverter) New() protoreflect.Value { + return protoreflect.ValueOfList(&listReflect{reflect.New(c.goType), c.c}) } -func (c *listConverter) Zero() pref.Value { - return pref.ValueOfList(&listReflect{reflect.Zero(reflect.PtrTo(c.goType)), c.c}) +func (c *listConverter) Zero() protoreflect.Value { + return protoreflect.ValueOfList(&listReflect{reflect.Zero(reflect.PtrTo(c.goType)), c.c}) } type listPtrConverter struct { @@ -68,18 +68,18 @@ type listPtrConverter struct { c Converter } -func (c *listPtrConverter) PBValueOf(v reflect.Value) pref.Value { +func (c *listPtrConverter) PBValueOf(v reflect.Value) protoreflect.Value { if v.Type() != c.goType { panic(fmt.Sprintf("invalid type: got %v, want %v", v.Type(), c.goType)) } - return pref.ValueOfList(&listReflect{v, c.c}) + return protoreflect.ValueOfList(&listReflect{v, c.c}) } -func (c *listPtrConverter) GoValueOf(v pref.Value) reflect.Value { +func (c *listPtrConverter) GoValueOf(v protoreflect.Value) reflect.Value { return v.List().(*listReflect).v } -func (c *listPtrConverter) IsValidPB(v pref.Value) bool { +func (c *listPtrConverter) IsValidPB(v protoreflect.Value) bool { list, ok := v.Interface().(*listReflect) if !ok { return false @@ -91,11 +91,11 @@ func (c *listPtrConverter) IsValidGo(v reflect.Value) bool { return v.IsValid() && v.Type() == c.goType } -func (c *listPtrConverter) New() pref.Value { +func (c *listPtrConverter) New() protoreflect.Value { return c.PBValueOf(reflect.New(c.goType.Elem())) } -func (c *listPtrConverter) Zero() pref.Value { +func (c *listPtrConverter) Zero() protoreflect.Value { return c.PBValueOf(reflect.Zero(c.goType)) } @@ -110,16 +110,16 @@ func (ls *listReflect) Len() int { } return ls.v.Elem().Len() } -func (ls *listReflect) Get(i int) pref.Value { +func (ls *listReflect) Get(i int) protoreflect.Value { return ls.conv.PBValueOf(ls.v.Elem().Index(i)) } -func (ls *listReflect) Set(i int, v pref.Value) { +func (ls *listReflect) Set(i int, v protoreflect.Value) { ls.v.Elem().Index(i).Set(ls.conv.GoValueOf(v)) } -func (ls *listReflect) Append(v pref.Value) { +func (ls *listReflect) Append(v protoreflect.Value) { ls.v.Elem().Set(reflect.Append(ls.v.Elem(), ls.conv.GoValueOf(v))) } -func (ls *listReflect) AppendMutable() pref.Value { +func (ls *listReflect) AppendMutable() protoreflect.Value { if _, ok := ls.conv.(*messageConverter); !ok { panic("invalid AppendMutable on list with non-message type") } @@ -130,7 +130,7 @@ func (ls *listReflect) AppendMutable() pref.Value { func (ls *listReflect) Truncate(i int) { ls.v.Elem().Set(ls.v.Elem().Slice(0, i)) } -func (ls *listReflect) NewElement() pref.Value { +func (ls *listReflect) NewElement() protoreflect.Value { return ls.conv.New() } func (ls *listReflect) IsValid() bool { diff --git a/vendor/google.golang.org/protobuf/internal/impl/convert_map.go b/vendor/google.golang.org/protobuf/internal/impl/convert_map.go index de06b259..f30b0a05 100644 --- a/vendor/google.golang.org/protobuf/internal/impl/convert_map.go +++ b/vendor/google.golang.org/protobuf/internal/impl/convert_map.go @@ -8,7 +8,7 @@ import ( "fmt" "reflect" - pref "google.golang.org/protobuf/reflect/protoreflect" + "google.golang.org/protobuf/reflect/protoreflect" ) type mapConverter struct { @@ -16,7 +16,7 @@ type mapConverter struct { keyConv, valConv Converter } -func newMapConverter(t reflect.Type, fd pref.FieldDescriptor) *mapConverter { +func newMapConverter(t reflect.Type, fd protoreflect.FieldDescriptor) *mapConverter { if t.Kind() != reflect.Map { panic(fmt.Sprintf("invalid Go type %v for field %v", t, fd.FullName())) } @@ -27,18 +27,18 @@ func newMapConverter(t reflect.Type, fd pref.FieldDescriptor) *mapConverter { } } -func (c *mapConverter) PBValueOf(v reflect.Value) pref.Value { +func (c *mapConverter) PBValueOf(v reflect.Value) protoreflect.Value { if v.Type() != c.goType { panic(fmt.Sprintf("invalid type: got %v, want %v", v.Type(), c.goType)) } - return pref.ValueOfMap(&mapReflect{v, c.keyConv, c.valConv}) + return protoreflect.ValueOfMap(&mapReflect{v, c.keyConv, c.valConv}) } -func (c *mapConverter) GoValueOf(v pref.Value) reflect.Value { +func (c *mapConverter) GoValueOf(v protoreflect.Value) reflect.Value { return v.Map().(*mapReflect).v } -func (c *mapConverter) IsValidPB(v pref.Value) bool { +func (c *mapConverter) IsValidPB(v protoreflect.Value) bool { mapv, ok := v.Interface().(*mapReflect) if !ok { return false @@ -50,11 +50,11 @@ func (c *mapConverter) IsValidGo(v reflect.Value) bool { return v.IsValid() && v.Type() == c.goType } -func (c *mapConverter) New() pref.Value { +func (c *mapConverter) New() protoreflect.Value { return c.PBValueOf(reflect.MakeMap(c.goType)) } -func (c *mapConverter) Zero() pref.Value { +func (c *mapConverter) Zero() protoreflect.Value { return c.PBValueOf(reflect.Zero(c.goType)) } @@ -67,29 +67,29 @@ type mapReflect struct { func (ms *mapReflect) Len() int { return ms.v.Len() } -func (ms *mapReflect) Has(k pref.MapKey) bool { +func (ms *mapReflect) Has(k protoreflect.MapKey) bool { rk := ms.keyConv.GoValueOf(k.Value()) rv := ms.v.MapIndex(rk) return rv.IsValid() } -func (ms *mapReflect) Get(k pref.MapKey) pref.Value { +func (ms *mapReflect) Get(k protoreflect.MapKey) protoreflect.Value { rk := ms.keyConv.GoValueOf(k.Value()) rv := ms.v.MapIndex(rk) if !rv.IsValid() { - return pref.Value{} + return protoreflect.Value{} } return ms.valConv.PBValueOf(rv) } -func (ms *mapReflect) Set(k pref.MapKey, v pref.Value) { +func (ms *mapReflect) Set(k protoreflect.MapKey, v protoreflect.Value) { rk := ms.keyConv.GoValueOf(k.Value()) rv := ms.valConv.GoValueOf(v) ms.v.SetMapIndex(rk, rv) } -func (ms *mapReflect) Clear(k pref.MapKey) { +func (ms *mapReflect) Clear(k protoreflect.MapKey) { rk := ms.keyConv.GoValueOf(k.Value()) ms.v.SetMapIndex(rk, reflect.Value{}) } -func (ms *mapReflect) Mutable(k pref.MapKey) pref.Value { +func (ms *mapReflect) Mutable(k protoreflect.MapKey) protoreflect.Value { if _, ok := ms.valConv.(*messageConverter); !ok { panic("invalid Mutable on map with non-message value type") } @@ -100,7 +100,7 @@ func (ms *mapReflect) Mutable(k pref.MapKey) pref.Value { } return v } -func (ms *mapReflect) Range(f func(pref.MapKey, pref.Value) bool) { +func (ms *mapReflect) Range(f func(protoreflect.MapKey, protoreflect.Value) bool) { iter := mapRange(ms.v) for iter.Next() { k := ms.keyConv.PBValueOf(iter.Key()).MapKey() @@ -110,7 +110,7 @@ func (ms *mapReflect) Range(f func(pref.MapKey, pref.Value) bool) { } } } -func (ms *mapReflect) NewValue() pref.Value { +func (ms *mapReflect) NewValue() protoreflect.Value { return ms.valConv.New() } func (ms *mapReflect) IsValid() bool { diff --git a/vendor/google.golang.org/protobuf/internal/impl/decode.go b/vendor/google.golang.org/protobuf/internal/impl/decode.go index c65b0325..cda0520c 100644 --- a/vendor/google.golang.org/protobuf/internal/impl/decode.go +++ b/vendor/google.golang.org/protobuf/internal/impl/decode.go @@ -12,9 +12,8 @@ import ( "google.golang.org/protobuf/internal/flags" "google.golang.org/protobuf/proto" "google.golang.org/protobuf/reflect/protoreflect" - preg "google.golang.org/protobuf/reflect/protoregistry" + "google.golang.org/protobuf/reflect/protoregistry" "google.golang.org/protobuf/runtime/protoiface" - piface "google.golang.org/protobuf/runtime/protoiface" ) var errDecode = errors.New("cannot parse invalid wire-format data") @@ -38,14 +37,16 @@ func (o unmarshalOptions) Options() proto.UnmarshalOptions { } } -func (o unmarshalOptions) DiscardUnknown() bool { return o.flags&piface.UnmarshalDiscardUnknown != 0 } +func (o unmarshalOptions) DiscardUnknown() bool { + return o.flags&protoiface.UnmarshalDiscardUnknown != 0 +} func (o unmarshalOptions) IsDefault() bool { - return o.flags == 0 && o.resolver == preg.GlobalTypes + return o.flags == 0 && o.resolver == protoregistry.GlobalTypes } var lazyUnmarshalOptions = unmarshalOptions{ - resolver: preg.GlobalTypes, + resolver: protoregistry.GlobalTypes, depth: protowire.DefaultRecursionLimit, } @@ -55,7 +56,7 @@ type unmarshalOutput struct { } // unmarshal is protoreflect.Methods.Unmarshal. -func (mi *MessageInfo) unmarshal(in piface.UnmarshalInput) (piface.UnmarshalOutput, error) { +func (mi *MessageInfo) unmarshal(in protoiface.UnmarshalInput) (protoiface.UnmarshalOutput, error) { var p pointer if ms, ok := in.Message.(*messageState); ok { p = ms.pointer() @@ -67,11 +68,11 @@ func (mi *MessageInfo) unmarshal(in piface.UnmarshalInput) (piface.UnmarshalOutp resolver: in.Resolver, depth: in.Depth, }) - var flags piface.UnmarshalOutputFlags + var flags protoiface.UnmarshalOutputFlags if out.initialized { - flags |= piface.UnmarshalInitialized + flags |= protoiface.UnmarshalInitialized } - return piface.UnmarshalOutput{ + return protoiface.UnmarshalOutput{ Flags: flags, }, err } @@ -210,7 +211,7 @@ func (mi *MessageInfo) unmarshalExtension(b []byte, num protowire.Number, wtyp p var err error xt, err = opts.resolver.FindExtensionByNumber(mi.Desc.FullName(), num) if err != nil { - if err == preg.NotFound { + if err == protoregistry.NotFound { return out, errUnknown } return out, errors.New("%v: unable to resolve extension %v: %v", mi.Desc.FullName(), num, err) diff --git a/vendor/google.golang.org/protobuf/internal/impl/enum.go b/vendor/google.golang.org/protobuf/internal/impl/enum.go index 8c1eab4b..5f3ef5ad 100644 --- a/vendor/google.golang.org/protobuf/internal/impl/enum.go +++ b/vendor/google.golang.org/protobuf/internal/impl/enum.go @@ -7,15 +7,15 @@ package impl import ( "reflect" - pref "google.golang.org/protobuf/reflect/protoreflect" + "google.golang.org/protobuf/reflect/protoreflect" ) type EnumInfo struct { GoReflectType reflect.Type // int32 kind - Desc pref.EnumDescriptor + Desc protoreflect.EnumDescriptor } -func (t *EnumInfo) New(n pref.EnumNumber) pref.Enum { - return reflect.ValueOf(n).Convert(t.GoReflectType).Interface().(pref.Enum) +func (t *EnumInfo) New(n protoreflect.EnumNumber) protoreflect.Enum { + return reflect.ValueOf(n).Convert(t.GoReflectType).Interface().(protoreflect.Enum) } -func (t *EnumInfo) Descriptor() pref.EnumDescriptor { return t.Desc } +func (t *EnumInfo) Descriptor() protoreflect.EnumDescriptor { return t.Desc } diff --git a/vendor/google.golang.org/protobuf/internal/impl/extension.go b/vendor/google.golang.org/protobuf/internal/impl/extension.go index e904fd99..cb25b0ba 100644 --- a/vendor/google.golang.org/protobuf/internal/impl/extension.go +++ b/vendor/google.golang.org/protobuf/internal/impl/extension.go @@ -9,8 +9,8 @@ import ( "sync" "sync/atomic" - pref "google.golang.org/protobuf/reflect/protoreflect" - piface "google.golang.org/protobuf/runtime/protoiface" + "google.golang.org/protobuf/reflect/protoreflect" + "google.golang.org/protobuf/runtime/protoiface" ) // ExtensionInfo implements ExtensionType. @@ -45,7 +45,7 @@ type ExtensionInfo struct { // since the message may no longer implement the MessageV1 interface. // // Deprecated: Use the ExtendedType method instead. - ExtendedType piface.MessageV1 + ExtendedType protoiface.MessageV1 // ExtensionType is the zero value of the extension type. // @@ -83,31 +83,31 @@ const ( extensionInfoFullInit = 2 ) -func InitExtensionInfo(xi *ExtensionInfo, xd pref.ExtensionDescriptor, goType reflect.Type) { +func InitExtensionInfo(xi *ExtensionInfo, xd protoreflect.ExtensionDescriptor, goType reflect.Type) { xi.goType = goType xi.desc = extensionTypeDescriptor{xd, xi} xi.init = extensionInfoDescInit } -func (xi *ExtensionInfo) New() pref.Value { +func (xi *ExtensionInfo) New() protoreflect.Value { return xi.lazyInit().New() } -func (xi *ExtensionInfo) Zero() pref.Value { +func (xi *ExtensionInfo) Zero() protoreflect.Value { return xi.lazyInit().Zero() } -func (xi *ExtensionInfo) ValueOf(v interface{}) pref.Value { +func (xi *ExtensionInfo) ValueOf(v interface{}) protoreflect.Value { return xi.lazyInit().PBValueOf(reflect.ValueOf(v)) } -func (xi *ExtensionInfo) InterfaceOf(v pref.Value) interface{} { +func (xi *ExtensionInfo) InterfaceOf(v protoreflect.Value) interface{} { return xi.lazyInit().GoValueOf(v).Interface() } -func (xi *ExtensionInfo) IsValidValue(v pref.Value) bool { +func (xi *ExtensionInfo) IsValidValue(v protoreflect.Value) bool { return xi.lazyInit().IsValidPB(v) } func (xi *ExtensionInfo) IsValidInterface(v interface{}) bool { return xi.lazyInit().IsValidGo(reflect.ValueOf(v)) } -func (xi *ExtensionInfo) TypeDescriptor() pref.ExtensionTypeDescriptor { +func (xi *ExtensionInfo) TypeDescriptor() protoreflect.ExtensionTypeDescriptor { if atomic.LoadUint32(&xi.init) < extensionInfoDescInit { xi.lazyInitSlow() } @@ -144,13 +144,13 @@ func (xi *ExtensionInfo) lazyInitSlow() { } type extensionTypeDescriptor struct { - pref.ExtensionDescriptor + protoreflect.ExtensionDescriptor xi *ExtensionInfo } -func (xtd *extensionTypeDescriptor) Type() pref.ExtensionType { +func (xtd *extensionTypeDescriptor) Type() protoreflect.ExtensionType { return xtd.xi } -func (xtd *extensionTypeDescriptor) Descriptor() pref.ExtensionDescriptor { +func (xtd *extensionTypeDescriptor) Descriptor() protoreflect.ExtensionDescriptor { return xtd.ExtensionDescriptor } diff --git a/vendor/google.golang.org/protobuf/internal/impl/legacy_enum.go b/vendor/google.golang.org/protobuf/internal/impl/legacy_enum.go index f7d7ffb5..c2a803bb 100644 --- a/vendor/google.golang.org/protobuf/internal/impl/legacy_enum.go +++ b/vendor/google.golang.org/protobuf/internal/impl/legacy_enum.go @@ -13,13 +13,12 @@ import ( "google.golang.org/protobuf/internal/filedesc" "google.golang.org/protobuf/internal/strs" "google.golang.org/protobuf/reflect/protoreflect" - pref "google.golang.org/protobuf/reflect/protoreflect" ) // legacyEnumName returns the name of enums used in legacy code. // It is neither the protobuf full name nor the qualified Go name, // but rather an odd hybrid of both. -func legacyEnumName(ed pref.EnumDescriptor) string { +func legacyEnumName(ed protoreflect.EnumDescriptor) string { var protoPkg string enumName := string(ed.FullName()) if fd := ed.ParentFile(); fd != nil { @@ -34,68 +33,68 @@ func legacyEnumName(ed pref.EnumDescriptor) string { // legacyWrapEnum wraps v as a protoreflect.Enum, // where v must be a int32 kind and not implement the v2 API already. -func legacyWrapEnum(v reflect.Value) pref.Enum { +func legacyWrapEnum(v reflect.Value) protoreflect.Enum { et := legacyLoadEnumType(v.Type()) - return et.New(pref.EnumNumber(v.Int())) + return et.New(protoreflect.EnumNumber(v.Int())) } var legacyEnumTypeCache sync.Map // map[reflect.Type]protoreflect.EnumType // legacyLoadEnumType dynamically loads a protoreflect.EnumType for t, // where t must be an int32 kind and not implement the v2 API already. -func legacyLoadEnumType(t reflect.Type) pref.EnumType { +func legacyLoadEnumType(t reflect.Type) protoreflect.EnumType { // Fast-path: check if a EnumType is cached for this concrete type. if et, ok := legacyEnumTypeCache.Load(t); ok { - return et.(pref.EnumType) + return et.(protoreflect.EnumType) } // Slow-path: derive enum descriptor and initialize EnumType. - var et pref.EnumType + var et protoreflect.EnumType ed := LegacyLoadEnumDesc(t) et = &legacyEnumType{ desc: ed, goType: t, } if et, ok := legacyEnumTypeCache.LoadOrStore(t, et); ok { - return et.(pref.EnumType) + return et.(protoreflect.EnumType) } return et } type legacyEnumType struct { - desc pref.EnumDescriptor + desc protoreflect.EnumDescriptor goType reflect.Type m sync.Map // map[protoreflect.EnumNumber]proto.Enum } -func (t *legacyEnumType) New(n pref.EnumNumber) pref.Enum { +func (t *legacyEnumType) New(n protoreflect.EnumNumber) protoreflect.Enum { if e, ok := t.m.Load(n); ok { - return e.(pref.Enum) + return e.(protoreflect.Enum) } e := &legacyEnumWrapper{num: n, pbTyp: t, goTyp: t.goType} t.m.Store(n, e) return e } -func (t *legacyEnumType) Descriptor() pref.EnumDescriptor { +func (t *legacyEnumType) Descriptor() protoreflect.EnumDescriptor { return t.desc } type legacyEnumWrapper struct { - num pref.EnumNumber - pbTyp pref.EnumType + num protoreflect.EnumNumber + pbTyp protoreflect.EnumType goTyp reflect.Type } -func (e *legacyEnumWrapper) Descriptor() pref.EnumDescriptor { +func (e *legacyEnumWrapper) Descriptor() protoreflect.EnumDescriptor { return e.pbTyp.Descriptor() } -func (e *legacyEnumWrapper) Type() pref.EnumType { +func (e *legacyEnumWrapper) Type() protoreflect.EnumType { return e.pbTyp } -func (e *legacyEnumWrapper) Number() pref.EnumNumber { +func (e *legacyEnumWrapper) Number() protoreflect.EnumNumber { return e.num } -func (e *legacyEnumWrapper) ProtoReflect() pref.Enum { +func (e *legacyEnumWrapper) ProtoReflect() protoreflect.Enum { return e } func (e *legacyEnumWrapper) protoUnwrap() interface{} { @@ -105,8 +104,8 @@ func (e *legacyEnumWrapper) protoUnwrap() interface{} { } var ( - _ pref.Enum = (*legacyEnumWrapper)(nil) - _ unwrapper = (*legacyEnumWrapper)(nil) + _ protoreflect.Enum = (*legacyEnumWrapper)(nil) + _ unwrapper = (*legacyEnumWrapper)(nil) ) var legacyEnumDescCache sync.Map // map[reflect.Type]protoreflect.EnumDescriptor @@ -115,15 +114,15 @@ var legacyEnumDescCache sync.Map // map[reflect.Type]protoreflect.EnumDescriptor // which must be an int32 kind and not implement the v2 API already. // // This is exported for testing purposes. -func LegacyLoadEnumDesc(t reflect.Type) pref.EnumDescriptor { +func LegacyLoadEnumDesc(t reflect.Type) protoreflect.EnumDescriptor { // Fast-path: check if an EnumDescriptor is cached for this concrete type. if ed, ok := legacyEnumDescCache.Load(t); ok { - return ed.(pref.EnumDescriptor) + return ed.(protoreflect.EnumDescriptor) } // Slow-path: initialize EnumDescriptor from the raw descriptor. ev := reflect.Zero(t).Interface() - if _, ok := ev.(pref.Enum); ok { + if _, ok := ev.(protoreflect.Enum); ok { panic(fmt.Sprintf("%v already implements proto.Enum", t)) } edV1, ok := ev.(enumV1) @@ -132,7 +131,7 @@ func LegacyLoadEnumDesc(t reflect.Type) pref.EnumDescriptor { } b, idxs := edV1.EnumDescriptor() - var ed pref.EnumDescriptor + var ed protoreflect.EnumDescriptor if len(idxs) == 1 { ed = legacyLoadFileDesc(b).Enums().Get(idxs[0]) } else { @@ -158,10 +157,10 @@ var aberrantEnumDescCache sync.Map // map[reflect.Type]protoreflect.EnumDescript // We are unable to use the global enum registry since it is // unfortunately keyed by the protobuf full name, which we also do not know. // Thus, this produces some bogus enum descriptor based on the Go type name. -func aberrantLoadEnumDesc(t reflect.Type) pref.EnumDescriptor { +func aberrantLoadEnumDesc(t reflect.Type) protoreflect.EnumDescriptor { // Fast-path: check if an EnumDescriptor is cached for this concrete type. if ed, ok := aberrantEnumDescCache.Load(t); ok { - return ed.(pref.EnumDescriptor) + return ed.(protoreflect.EnumDescriptor) } // Slow-path: construct a bogus, but unique EnumDescriptor. @@ -182,7 +181,7 @@ func aberrantLoadEnumDesc(t reflect.Type) pref.EnumDescriptor { // An exhaustive query is clearly impractical, but can be best-effort. if ed, ok := aberrantEnumDescCache.LoadOrStore(t, ed); ok { - return ed.(pref.EnumDescriptor) + return ed.(protoreflect.EnumDescriptor) } return ed } @@ -192,7 +191,7 @@ func aberrantLoadEnumDesc(t reflect.Type) pref.EnumDescriptor { // It should be sufficiently unique within a program. // // This is exported for testing purposes. -func AberrantDeriveFullName(t reflect.Type) pref.FullName { +func AberrantDeriveFullName(t reflect.Type) protoreflect.FullName { sanitize := func(r rune) rune { switch { case r == '/': @@ -215,5 +214,5 @@ func AberrantDeriveFullName(t reflect.Type) pref.FullName { ss[i] = "x" + s } } - return pref.FullName(strings.Join(ss, ".")) + return protoreflect.FullName(strings.Join(ss, ".")) } diff --git a/vendor/google.golang.org/protobuf/internal/impl/legacy_export.go b/vendor/google.golang.org/protobuf/internal/impl/legacy_export.go index e3fb0b57..9b64ad5b 100644 --- a/vendor/google.golang.org/protobuf/internal/impl/legacy_export.go +++ b/vendor/google.golang.org/protobuf/internal/impl/legacy_export.go @@ -12,21 +12,21 @@ import ( "reflect" "google.golang.org/protobuf/internal/errors" - pref "google.golang.org/protobuf/reflect/protoreflect" - piface "google.golang.org/protobuf/runtime/protoiface" + "google.golang.org/protobuf/reflect/protoreflect" + "google.golang.org/protobuf/runtime/protoiface" ) // These functions exist to support exported APIs in generated protobufs. // While these are deprecated, they cannot be removed for compatibility reasons. // LegacyEnumName returns the name of enums used in legacy code. -func (Export) LegacyEnumName(ed pref.EnumDescriptor) string { +func (Export) LegacyEnumName(ed protoreflect.EnumDescriptor) string { return legacyEnumName(ed) } // LegacyMessageTypeOf returns the protoreflect.MessageType for m, // with name used as the message name if necessary. -func (Export) LegacyMessageTypeOf(m piface.MessageV1, name pref.FullName) pref.MessageType { +func (Export) LegacyMessageTypeOf(m protoiface.MessageV1, name protoreflect.FullName) protoreflect.MessageType { if mv := (Export{}).protoMessageV2Of(m); mv != nil { return mv.ProtoReflect().Type() } @@ -36,9 +36,9 @@ func (Export) LegacyMessageTypeOf(m piface.MessageV1, name pref.FullName) pref.M // UnmarshalJSONEnum unmarshals an enum from a JSON-encoded input. // The input can either be a string representing the enum value by name, // or a number representing the enum number itself. -func (Export) UnmarshalJSONEnum(ed pref.EnumDescriptor, b []byte) (pref.EnumNumber, error) { +func (Export) UnmarshalJSONEnum(ed protoreflect.EnumDescriptor, b []byte) (protoreflect.EnumNumber, error) { if b[0] == '"' { - var name pref.Name + var name protoreflect.Name if err := json.Unmarshal(b, &name); err != nil { return 0, errors.New("invalid input for enum %v: %s", ed.FullName(), b) } @@ -48,7 +48,7 @@ func (Export) UnmarshalJSONEnum(ed pref.EnumDescriptor, b []byte) (pref.EnumNumb } return ev.Number(), nil } else { - var num pref.EnumNumber + var num protoreflect.EnumNumber if err := json.Unmarshal(b, &num); err != nil { return 0, errors.New("invalid input for enum %v: %s", ed.FullName(), b) } @@ -81,8 +81,8 @@ func (Export) CompressGZIP(in []byte) (out []byte) { blockHeader[0] = 0x01 // final bit per RFC 1951, section 3.2.3. blockSize = len(in) } - binary.LittleEndian.PutUint16(blockHeader[1:3], uint16(blockSize)^0x0000) - binary.LittleEndian.PutUint16(blockHeader[3:5], uint16(blockSize)^0xffff) + binary.LittleEndian.PutUint16(blockHeader[1:3], uint16(blockSize)) + binary.LittleEndian.PutUint16(blockHeader[3:5], ^uint16(blockSize)) out = append(out, blockHeader[:]...) out = append(out, in[:blockSize]...) in = in[blockSize:] diff --git a/vendor/google.golang.org/protobuf/internal/impl/legacy_extension.go b/vendor/google.golang.org/protobuf/internal/impl/legacy_extension.go index 49e72316..87b30d05 100644 --- a/vendor/google.golang.org/protobuf/internal/impl/legacy_extension.go +++ b/vendor/google.golang.org/protobuf/internal/impl/legacy_extension.go @@ -12,16 +12,16 @@ import ( ptag "google.golang.org/protobuf/internal/encoding/tag" "google.golang.org/protobuf/internal/filedesc" "google.golang.org/protobuf/internal/pragma" - pref "google.golang.org/protobuf/reflect/protoreflect" - preg "google.golang.org/protobuf/reflect/protoregistry" - piface "google.golang.org/protobuf/runtime/protoiface" + "google.golang.org/protobuf/reflect/protoreflect" + "google.golang.org/protobuf/reflect/protoregistry" + "google.golang.org/protobuf/runtime/protoiface" ) func (xi *ExtensionInfo) initToLegacy() { xd := xi.desc - var parent piface.MessageV1 + var parent protoiface.MessageV1 messageName := xd.ContainingMessage().FullName() - if mt, _ := preg.GlobalTypes.FindMessageByName(messageName); mt != nil { + if mt, _ := protoregistry.GlobalTypes.FindMessageByName(messageName); mt != nil { // Create a new parent message and unwrap it if possible. mv := mt.New().Interface() t := reflect.TypeOf(mv) @@ -31,7 +31,7 @@ func (xi *ExtensionInfo) initToLegacy() { // Check whether the message implements the legacy v1 Message interface. mz := reflect.Zero(t).Interface() - if mz, ok := mz.(piface.MessageV1); ok { + if mz, ok := mz.(protoiface.MessageV1); ok { parent = mz } } @@ -46,7 +46,7 @@ func (xi *ExtensionInfo) initToLegacy() { // Reconstruct the legacy enum full name. var enumName string - if xd.Kind() == pref.EnumKind { + if xd.Kind() == protoreflect.EnumKind { enumName = legacyEnumName(xd.Enum()) } @@ -77,16 +77,16 @@ func (xi *ExtensionInfo) initFromLegacy() { // field number is specified. In such a case, use a placeholder. if xi.ExtendedType == nil || xi.ExtensionType == nil { xd := placeholderExtension{ - name: pref.FullName(xi.Name), - number: pref.FieldNumber(xi.Field), + name: protoreflect.FullName(xi.Name), + number: protoreflect.FieldNumber(xi.Field), } xi.desc = extensionTypeDescriptor{xd, xi} return } // Resolve enum or message dependencies. - var ed pref.EnumDescriptor - var md pref.MessageDescriptor + var ed protoreflect.EnumDescriptor + var md protoreflect.MessageDescriptor t := reflect.TypeOf(xi.ExtensionType) isOptional := t.Kind() == reflect.Ptr && t.Elem().Kind() != reflect.Struct isRepeated := t.Kind() == reflect.Slice && t.Elem().Kind() != reflect.Uint8 @@ -94,18 +94,18 @@ func (xi *ExtensionInfo) initFromLegacy() { t = t.Elem() } switch v := reflect.Zero(t).Interface().(type) { - case pref.Enum: + case protoreflect.Enum: ed = v.Descriptor() case enumV1: ed = LegacyLoadEnumDesc(t) - case pref.ProtoMessage: + case protoreflect.ProtoMessage: md = v.ProtoReflect().Descriptor() case messageV1: md = LegacyLoadMessageDesc(t) } // Derive basic field information from the struct tag. - var evs pref.EnumValueDescriptors + var evs protoreflect.EnumValueDescriptors if ed != nil { evs = ed.Values() } @@ -114,8 +114,8 @@ func (xi *ExtensionInfo) initFromLegacy() { // Construct a v2 ExtensionType. xd := &filedesc.Extension{L2: new(filedesc.ExtensionL2)} xd.L0.ParentFile = filedesc.SurrogateProto2 - xd.L0.FullName = pref.FullName(xi.Name) - xd.L1.Number = pref.FieldNumber(xi.Field) + xd.L0.FullName = protoreflect.FullName(xi.Name) + xd.L1.Number = protoreflect.FieldNumber(xi.Field) xd.L1.Cardinality = fd.L1.Cardinality xd.L1.Kind = fd.L1.Kind xd.L2.IsPacked = fd.L1.IsPacked @@ -138,39 +138,39 @@ func (xi *ExtensionInfo) initFromLegacy() { } type placeholderExtension struct { - name pref.FullName - number pref.FieldNumber + name protoreflect.FullName + number protoreflect.FieldNumber } -func (x placeholderExtension) ParentFile() pref.FileDescriptor { return nil } -func (x placeholderExtension) Parent() pref.Descriptor { return nil } -func (x placeholderExtension) Index() int { return 0 } -func (x placeholderExtension) Syntax() pref.Syntax { return 0 } -func (x placeholderExtension) Name() pref.Name { return x.name.Name() } -func (x placeholderExtension) FullName() pref.FullName { return x.name } -func (x placeholderExtension) IsPlaceholder() bool { return true } -func (x placeholderExtension) Options() pref.ProtoMessage { return descopts.Field } -func (x placeholderExtension) Number() pref.FieldNumber { return x.number } -func (x placeholderExtension) Cardinality() pref.Cardinality { return 0 } -func (x placeholderExtension) Kind() pref.Kind { return 0 } -func (x placeholderExtension) HasJSONName() bool { return false } -func (x placeholderExtension) JSONName() string { return "[" + string(x.name) + "]" } -func (x placeholderExtension) TextName() string { return "[" + string(x.name) + "]" } -func (x placeholderExtension) HasPresence() bool { return false } -func (x placeholderExtension) HasOptionalKeyword() bool { return false } -func (x placeholderExtension) IsExtension() bool { return true } -func (x placeholderExtension) IsWeak() bool { return false } -func (x placeholderExtension) IsPacked() bool { return false } -func (x placeholderExtension) IsList() bool { return false } -func (x placeholderExtension) IsMap() bool { return false } -func (x placeholderExtension) MapKey() pref.FieldDescriptor { return nil } -func (x placeholderExtension) MapValue() pref.FieldDescriptor { return nil } -func (x placeholderExtension) HasDefault() bool { return false } -func (x placeholderExtension) Default() pref.Value { return pref.Value{} } -func (x placeholderExtension) DefaultEnumValue() pref.EnumValueDescriptor { return nil } -func (x placeholderExtension) ContainingOneof() pref.OneofDescriptor { return nil } -func (x placeholderExtension) ContainingMessage() pref.MessageDescriptor { return nil } -func (x placeholderExtension) Enum() pref.EnumDescriptor { return nil } -func (x placeholderExtension) Message() pref.MessageDescriptor { return nil } -func (x placeholderExtension) ProtoType(pref.FieldDescriptor) { return } -func (x placeholderExtension) ProtoInternal(pragma.DoNotImplement) { return } +func (x placeholderExtension) ParentFile() protoreflect.FileDescriptor { return nil } +func (x placeholderExtension) Parent() protoreflect.Descriptor { return nil } +func (x placeholderExtension) Index() int { return 0 } +func (x placeholderExtension) Syntax() protoreflect.Syntax { return 0 } +func (x placeholderExtension) Name() protoreflect.Name { return x.name.Name() } +func (x placeholderExtension) FullName() protoreflect.FullName { return x.name } +func (x placeholderExtension) IsPlaceholder() bool { return true } +func (x placeholderExtension) Options() protoreflect.ProtoMessage { return descopts.Field } +func (x placeholderExtension) Number() protoreflect.FieldNumber { return x.number } +func (x placeholderExtension) Cardinality() protoreflect.Cardinality { return 0 } +func (x placeholderExtension) Kind() protoreflect.Kind { return 0 } +func (x placeholderExtension) HasJSONName() bool { return false } +func (x placeholderExtension) JSONName() string { return "[" + string(x.name) + "]" } +func (x placeholderExtension) TextName() string { return "[" + string(x.name) + "]" } +func (x placeholderExtension) HasPresence() bool { return false } +func (x placeholderExtension) HasOptionalKeyword() bool { return false } +func (x placeholderExtension) IsExtension() bool { return true } +func (x placeholderExtension) IsWeak() bool { return false } +func (x placeholderExtension) IsPacked() bool { return false } +func (x placeholderExtension) IsList() bool { return false } +func (x placeholderExtension) IsMap() bool { return false } +func (x placeholderExtension) MapKey() protoreflect.FieldDescriptor { return nil } +func (x placeholderExtension) MapValue() protoreflect.FieldDescriptor { return nil } +func (x placeholderExtension) HasDefault() bool { return false } +func (x placeholderExtension) Default() protoreflect.Value { return protoreflect.Value{} } +func (x placeholderExtension) DefaultEnumValue() protoreflect.EnumValueDescriptor { return nil } +func (x placeholderExtension) ContainingOneof() protoreflect.OneofDescriptor { return nil } +func (x placeholderExtension) ContainingMessage() protoreflect.MessageDescriptor { return nil } +func (x placeholderExtension) Enum() protoreflect.EnumDescriptor { return nil } +func (x placeholderExtension) Message() protoreflect.MessageDescriptor { return nil } +func (x placeholderExtension) ProtoType(protoreflect.FieldDescriptor) { return } +func (x placeholderExtension) ProtoInternal(pragma.DoNotImplement) { return } diff --git a/vendor/google.golang.org/protobuf/internal/impl/legacy_message.go b/vendor/google.golang.org/protobuf/internal/impl/legacy_message.go index 029feeef..61c483fa 100644 --- a/vendor/google.golang.org/protobuf/internal/impl/legacy_message.go +++ b/vendor/google.golang.org/protobuf/internal/impl/legacy_message.go @@ -16,14 +16,12 @@ import ( "google.golang.org/protobuf/internal/filedesc" "google.golang.org/protobuf/internal/strs" "google.golang.org/protobuf/reflect/protoreflect" - pref "google.golang.org/protobuf/reflect/protoreflect" "google.golang.org/protobuf/runtime/protoiface" - piface "google.golang.org/protobuf/runtime/protoiface" ) // legacyWrapMessage wraps v as a protoreflect.Message, // where v must be a *struct kind and not implement the v2 API already. -func legacyWrapMessage(v reflect.Value) pref.Message { +func legacyWrapMessage(v reflect.Value) protoreflect.Message { t := v.Type() if t.Kind() != reflect.Ptr || t.Elem().Kind() != reflect.Struct { return aberrantMessage{v: v} @@ -35,7 +33,7 @@ func legacyWrapMessage(v reflect.Value) pref.Message { // legacyLoadMessageType dynamically loads a protoreflect.Type for t, // where t must be not implement the v2 API already. // The provided name is used if it cannot be determined from the message. -func legacyLoadMessageType(t reflect.Type, name pref.FullName) protoreflect.MessageType { +func legacyLoadMessageType(t reflect.Type, name protoreflect.FullName) protoreflect.MessageType { if t.Kind() != reflect.Ptr || t.Elem().Kind() != reflect.Struct { return aberrantMessageType{t} } @@ -47,7 +45,7 @@ var legacyMessageTypeCache sync.Map // map[reflect.Type]*MessageInfo // legacyLoadMessageInfo dynamically loads a *MessageInfo for t, // where t must be a *struct kind and not implement the v2 API already. // The provided name is used if it cannot be determined from the message. -func legacyLoadMessageInfo(t reflect.Type, name pref.FullName) *MessageInfo { +func legacyLoadMessageInfo(t reflect.Type, name protoreflect.FullName) *MessageInfo { // Fast-path: check if a MessageInfo is cached for this concrete type. if mt, ok := legacyMessageTypeCache.Load(t); ok { return mt.(*MessageInfo) @@ -68,7 +66,7 @@ func legacyLoadMessageInfo(t reflect.Type, name pref.FullName) *MessageInfo { // supports deterministic serialization or not, but this // preserves the v1 implementation's behavior of always // calling Marshal methods when present. - mi.methods.Flags |= piface.SupportMarshalDeterministic + mi.methods.Flags |= protoiface.SupportMarshalDeterministic } if _, hasUnmarshal = v.(legacyUnmarshaler); hasUnmarshal { mi.methods.Unmarshal = legacyUnmarshal @@ -89,18 +87,18 @@ var legacyMessageDescCache sync.Map // map[reflect.Type]protoreflect.MessageDesc // which should be a *struct kind and must not implement the v2 API already. // // This is exported for testing purposes. -func LegacyLoadMessageDesc(t reflect.Type) pref.MessageDescriptor { +func LegacyLoadMessageDesc(t reflect.Type) protoreflect.MessageDescriptor { return legacyLoadMessageDesc(t, "") } -func legacyLoadMessageDesc(t reflect.Type, name pref.FullName) pref.MessageDescriptor { +func legacyLoadMessageDesc(t reflect.Type, name protoreflect.FullName) protoreflect.MessageDescriptor { // Fast-path: check if a MessageDescriptor is cached for this concrete type. if mi, ok := legacyMessageDescCache.Load(t); ok { - return mi.(pref.MessageDescriptor) + return mi.(protoreflect.MessageDescriptor) } // Slow-path: initialize MessageDescriptor from the raw descriptor. mv := reflect.Zero(t).Interface() - if _, ok := mv.(pref.ProtoMessage); ok { + if _, ok := mv.(protoreflect.ProtoMessage); ok { panic(fmt.Sprintf("%v already implements proto.Message", t)) } mdV1, ok := mv.(messageV1) @@ -164,7 +162,7 @@ var ( // // This is a best-effort derivation of the message descriptor using the protobuf // tags on the struct fields. -func aberrantLoadMessageDesc(t reflect.Type, name pref.FullName) pref.MessageDescriptor { +func aberrantLoadMessageDesc(t reflect.Type, name protoreflect.FullName) protoreflect.MessageDescriptor { aberrantMessageDescLock.Lock() defer aberrantMessageDescLock.Unlock() if aberrantMessageDescCache == nil { @@ -172,7 +170,7 @@ func aberrantLoadMessageDesc(t reflect.Type, name pref.FullName) pref.MessageDes } return aberrantLoadMessageDescReentrant(t, name) } -func aberrantLoadMessageDescReentrant(t reflect.Type, name pref.FullName) pref.MessageDescriptor { +func aberrantLoadMessageDescReentrant(t reflect.Type, name protoreflect.FullName) protoreflect.MessageDescriptor { // Fast-path: check if an MessageDescriptor is cached for this concrete type. if md, ok := aberrantMessageDescCache[t]; ok { return md @@ -225,9 +223,9 @@ func aberrantLoadMessageDescReentrant(t reflect.Type, name pref.FullName) pref.M vs := fn.Func.Call([]reflect.Value{reflect.Zero(fn.Type.In(0))})[0] for i := 0; i < vs.Len(); i++ { v := vs.Index(i) - md.L2.ExtensionRanges.List = append(md.L2.ExtensionRanges.List, [2]pref.FieldNumber{ - pref.FieldNumber(v.FieldByName("Start").Int()), - pref.FieldNumber(v.FieldByName("End").Int() + 1), + md.L2.ExtensionRanges.List = append(md.L2.ExtensionRanges.List, [2]protoreflect.FieldNumber{ + protoreflect.FieldNumber(v.FieldByName("Start").Int()), + protoreflect.FieldNumber(v.FieldByName("End").Int() + 1), }) md.L2.ExtensionRangeOptions = append(md.L2.ExtensionRangeOptions, nil) } @@ -245,7 +243,7 @@ func aberrantLoadMessageDescReentrant(t reflect.Type, name pref.FullName) pref.M n := len(md.L2.Oneofs.List) md.L2.Oneofs.List = append(md.L2.Oneofs.List, filedesc.Oneof{}) od := &md.L2.Oneofs.List[n] - od.L0.FullName = md.FullName().Append(pref.Name(tag)) + od.L0.FullName = md.FullName().Append(protoreflect.Name(tag)) od.L0.ParentFile = md.L0.ParentFile od.L0.Parent = md od.L0.Index = n @@ -267,14 +265,14 @@ func aberrantLoadMessageDescReentrant(t reflect.Type, name pref.FullName) pref.M return md } -func aberrantDeriveMessageName(t reflect.Type, name pref.FullName) pref.FullName { +func aberrantDeriveMessageName(t reflect.Type, name protoreflect.FullName) protoreflect.FullName { if name.IsValid() { return name } func() { defer func() { recover() }() // swallow possible nil panics if m, ok := reflect.Zero(t).Interface().(interface{ XXX_MessageName() string }); ok { - name = pref.FullName(m.XXX_MessageName()) + name = protoreflect.FullName(m.XXX_MessageName()) } }() if name.IsValid() { @@ -305,7 +303,7 @@ func aberrantAppendField(md *filedesc.Message, goType reflect.Type, tag, tagKey, fd.L0.Index = n if fd.L1.IsWeak || fd.L1.HasPacked { - fd.L1.Options = func() pref.ProtoMessage { + fd.L1.Options = func() protoreflect.ProtoMessage { opts := descopts.Field.ProtoReflect().New() if fd.L1.IsWeak { opts.Set(opts.Descriptor().Fields().ByName("weak"), protoreflect.ValueOfBool(true)) @@ -318,17 +316,17 @@ func aberrantAppendField(md *filedesc.Message, goType reflect.Type, tag, tagKey, } // Populate Enum and Message. - if fd.Enum() == nil && fd.Kind() == pref.EnumKind { + if fd.Enum() == nil && fd.Kind() == protoreflect.EnumKind { switch v := reflect.Zero(t).Interface().(type) { - case pref.Enum: + case protoreflect.Enum: fd.L1.Enum = v.Descriptor() default: fd.L1.Enum = LegacyLoadEnumDesc(t) } } - if fd.Message() == nil && (fd.Kind() == pref.MessageKind || fd.Kind() == pref.GroupKind) { + if fd.Message() == nil && (fd.Kind() == protoreflect.MessageKind || fd.Kind() == protoreflect.GroupKind) { switch v := reflect.Zero(t).Interface().(type) { - case pref.ProtoMessage: + case protoreflect.ProtoMessage: fd.L1.Message = v.ProtoReflect().Descriptor() case messageV1: fd.L1.Message = LegacyLoadMessageDesc(t) @@ -337,13 +335,13 @@ func aberrantAppendField(md *filedesc.Message, goType reflect.Type, tag, tagKey, n := len(md.L1.Messages.List) md.L1.Messages.List = append(md.L1.Messages.List, filedesc.Message{L2: new(filedesc.MessageL2)}) md2 := &md.L1.Messages.List[n] - md2.L0.FullName = md.FullName().Append(pref.Name(strs.MapEntryName(string(fd.Name())))) + md2.L0.FullName = md.FullName().Append(protoreflect.Name(strs.MapEntryName(string(fd.Name())))) md2.L0.ParentFile = md.L0.ParentFile md2.L0.Parent = md md2.L0.Index = n md2.L1.IsMapEntry = true - md2.L2.Options = func() pref.ProtoMessage { + md2.L2.Options = func() protoreflect.ProtoMessage { opts := descopts.Message.ProtoReflect().New() opts.Set(opts.Descriptor().Fields().ByName("map_entry"), protoreflect.ValueOfBool(true)) return opts.Interface() @@ -364,8 +362,8 @@ type placeholderEnumValues struct { protoreflect.EnumValueDescriptors } -func (placeholderEnumValues) ByNumber(n pref.EnumNumber) pref.EnumValueDescriptor { - return filedesc.PlaceholderEnumValue(pref.FullName(fmt.Sprintf("UNKNOWN_%d", n))) +func (placeholderEnumValues) ByNumber(n protoreflect.EnumNumber) protoreflect.EnumValueDescriptor { + return filedesc.PlaceholderEnumValue(protoreflect.FullName(fmt.Sprintf("UNKNOWN_%d", n))) } // legacyMarshaler is the proto.Marshaler interface superseded by protoiface.Methoder. @@ -383,7 +381,7 @@ type legacyMerger interface { Merge(protoiface.MessageV1) } -var aberrantProtoMethods = &piface.Methods{ +var aberrantProtoMethods = &protoiface.Methods{ Marshal: legacyMarshal, Unmarshal: legacyUnmarshal, Merge: legacyMerge, @@ -392,40 +390,40 @@ var aberrantProtoMethods = &piface.Methods{ // supports deterministic serialization or not, but this // preserves the v1 implementation's behavior of always // calling Marshal methods when present. - Flags: piface.SupportMarshalDeterministic, + Flags: protoiface.SupportMarshalDeterministic, } -func legacyMarshal(in piface.MarshalInput) (piface.MarshalOutput, error) { +func legacyMarshal(in protoiface.MarshalInput) (protoiface.MarshalOutput, error) { v := in.Message.(unwrapper).protoUnwrap() marshaler, ok := v.(legacyMarshaler) if !ok { - return piface.MarshalOutput{}, errors.New("%T does not implement Marshal", v) + return protoiface.MarshalOutput{}, errors.New("%T does not implement Marshal", v) } out, err := marshaler.Marshal() if in.Buf != nil { out = append(in.Buf, out...) } - return piface.MarshalOutput{ + return protoiface.MarshalOutput{ Buf: out, }, err } -func legacyUnmarshal(in piface.UnmarshalInput) (piface.UnmarshalOutput, error) { +func legacyUnmarshal(in protoiface.UnmarshalInput) (protoiface.UnmarshalOutput, error) { v := in.Message.(unwrapper).protoUnwrap() unmarshaler, ok := v.(legacyUnmarshaler) if !ok { - return piface.UnmarshalOutput{}, errors.New("%T does not implement Unmarshal", v) + return protoiface.UnmarshalOutput{}, errors.New("%T does not implement Unmarshal", v) } - return piface.UnmarshalOutput{}, unmarshaler.Unmarshal(in.Buf) + return protoiface.UnmarshalOutput{}, unmarshaler.Unmarshal(in.Buf) } -func legacyMerge(in piface.MergeInput) piface.MergeOutput { +func legacyMerge(in protoiface.MergeInput) protoiface.MergeOutput { // Check whether this supports the legacy merger. dstv := in.Destination.(unwrapper).protoUnwrap() merger, ok := dstv.(legacyMerger) if ok { merger.Merge(Export{}.ProtoMessageV1Of(in.Source)) - return piface.MergeOutput{Flags: piface.MergeComplete} + return protoiface.MergeOutput{Flags: protoiface.MergeComplete} } // If legacy merger is unavailable, implement merge in terms of @@ -433,29 +431,29 @@ func legacyMerge(in piface.MergeInput) piface.MergeOutput { srcv := in.Source.(unwrapper).protoUnwrap() marshaler, ok := srcv.(legacyMarshaler) if !ok { - return piface.MergeOutput{} + return protoiface.MergeOutput{} } dstv = in.Destination.(unwrapper).protoUnwrap() unmarshaler, ok := dstv.(legacyUnmarshaler) if !ok { - return piface.MergeOutput{} + return protoiface.MergeOutput{} } if !in.Source.IsValid() { // Legacy Marshal methods may not function on nil messages. // Check for a typed nil source only after we confirm that // legacy Marshal/Unmarshal methods are present, for // consistency. - return piface.MergeOutput{Flags: piface.MergeComplete} + return protoiface.MergeOutput{Flags: protoiface.MergeComplete} } b, err := marshaler.Marshal() if err != nil { - return piface.MergeOutput{} + return protoiface.MergeOutput{} } err = unmarshaler.Unmarshal(b) if err != nil { - return piface.MergeOutput{} + return protoiface.MergeOutput{} } - return piface.MergeOutput{Flags: piface.MergeComplete} + return protoiface.MergeOutput{Flags: protoiface.MergeComplete} } // aberrantMessageType implements MessageType for all types other than pointer-to-struct. @@ -463,19 +461,19 @@ type aberrantMessageType struct { t reflect.Type } -func (mt aberrantMessageType) New() pref.Message { +func (mt aberrantMessageType) New() protoreflect.Message { if mt.t.Kind() == reflect.Ptr { return aberrantMessage{reflect.New(mt.t.Elem())} } return aberrantMessage{reflect.Zero(mt.t)} } -func (mt aberrantMessageType) Zero() pref.Message { +func (mt aberrantMessageType) Zero() protoreflect.Message { return aberrantMessage{reflect.Zero(mt.t)} } func (mt aberrantMessageType) GoType() reflect.Type { return mt.t } -func (mt aberrantMessageType) Descriptor() pref.MessageDescriptor { +func (mt aberrantMessageType) Descriptor() protoreflect.MessageDescriptor { return LegacyLoadMessageDesc(mt.t) } @@ -499,56 +497,56 @@ func (m aberrantMessage) Reset() { } } -func (m aberrantMessage) ProtoReflect() pref.Message { +func (m aberrantMessage) ProtoReflect() protoreflect.Message { return m } -func (m aberrantMessage) Descriptor() pref.MessageDescriptor { +func (m aberrantMessage) Descriptor() protoreflect.MessageDescriptor { return LegacyLoadMessageDesc(m.v.Type()) } -func (m aberrantMessage) Type() pref.MessageType { +func (m aberrantMessage) Type() protoreflect.MessageType { return aberrantMessageType{m.v.Type()} } -func (m aberrantMessage) New() pref.Message { +func (m aberrantMessage) New() protoreflect.Message { if m.v.Type().Kind() == reflect.Ptr { return aberrantMessage{reflect.New(m.v.Type().Elem())} } return aberrantMessage{reflect.Zero(m.v.Type())} } -func (m aberrantMessage) Interface() pref.ProtoMessage { +func (m aberrantMessage) Interface() protoreflect.ProtoMessage { return m } -func (m aberrantMessage) Range(f func(pref.FieldDescriptor, pref.Value) bool) { +func (m aberrantMessage) Range(f func(protoreflect.FieldDescriptor, protoreflect.Value) bool) { return } -func (m aberrantMessage) Has(pref.FieldDescriptor) bool { +func (m aberrantMessage) Has(protoreflect.FieldDescriptor) bool { return false } -func (m aberrantMessage) Clear(pref.FieldDescriptor) { +func (m aberrantMessage) Clear(protoreflect.FieldDescriptor) { panic("invalid Message.Clear on " + string(m.Descriptor().FullName())) } -func (m aberrantMessage) Get(fd pref.FieldDescriptor) pref.Value { +func (m aberrantMessage) Get(fd protoreflect.FieldDescriptor) protoreflect.Value { if fd.Default().IsValid() { return fd.Default() } panic("invalid Message.Get on " + string(m.Descriptor().FullName())) } -func (m aberrantMessage) Set(pref.FieldDescriptor, pref.Value) { +func (m aberrantMessage) Set(protoreflect.FieldDescriptor, protoreflect.Value) { panic("invalid Message.Set on " + string(m.Descriptor().FullName())) } -func (m aberrantMessage) Mutable(pref.FieldDescriptor) pref.Value { +func (m aberrantMessage) Mutable(protoreflect.FieldDescriptor) protoreflect.Value { panic("invalid Message.Mutable on " + string(m.Descriptor().FullName())) } -func (m aberrantMessage) NewField(pref.FieldDescriptor) pref.Value { +func (m aberrantMessage) NewField(protoreflect.FieldDescriptor) protoreflect.Value { panic("invalid Message.NewField on " + string(m.Descriptor().FullName())) } -func (m aberrantMessage) WhichOneof(pref.OneofDescriptor) pref.FieldDescriptor { +func (m aberrantMessage) WhichOneof(protoreflect.OneofDescriptor) protoreflect.FieldDescriptor { panic("invalid Message.WhichOneof descriptor on " + string(m.Descriptor().FullName())) } -func (m aberrantMessage) GetUnknown() pref.RawFields { +func (m aberrantMessage) GetUnknown() protoreflect.RawFields { return nil } -func (m aberrantMessage) SetUnknown(pref.RawFields) { +func (m aberrantMessage) SetUnknown(protoreflect.RawFields) { // SetUnknown discards its input on messages which don't support unknown field storage. } func (m aberrantMessage) IsValid() bool { @@ -557,7 +555,7 @@ func (m aberrantMessage) IsValid() bool { } return false } -func (m aberrantMessage) ProtoMethods() *piface.Methods { +func (m aberrantMessage) ProtoMethods() *protoiface.Methods { return aberrantProtoMethods } func (m aberrantMessage) protoUnwrap() interface{} { diff --git a/vendor/google.golang.org/protobuf/internal/impl/merge.go b/vendor/google.golang.org/protobuf/internal/impl/merge.go index c65bbc04..7e65f64f 100644 --- a/vendor/google.golang.org/protobuf/internal/impl/merge.go +++ b/vendor/google.golang.org/protobuf/internal/impl/merge.go @@ -9,8 +9,8 @@ import ( "reflect" "google.golang.org/protobuf/proto" - pref "google.golang.org/protobuf/reflect/protoreflect" - piface "google.golang.org/protobuf/runtime/protoiface" + "google.golang.org/protobuf/reflect/protoreflect" + "google.golang.org/protobuf/runtime/protoiface" ) type mergeOptions struct{} @@ -20,17 +20,17 @@ func (o mergeOptions) Merge(dst, src proto.Message) { } // merge is protoreflect.Methods.Merge. -func (mi *MessageInfo) merge(in piface.MergeInput) piface.MergeOutput { +func (mi *MessageInfo) merge(in protoiface.MergeInput) protoiface.MergeOutput { dp, ok := mi.getPointer(in.Destination) if !ok { - return piface.MergeOutput{} + return protoiface.MergeOutput{} } sp, ok := mi.getPointer(in.Source) if !ok { - return piface.MergeOutput{} + return protoiface.MergeOutput{} } mi.mergePointer(dp, sp, mergeOptions{}) - return piface.MergeOutput{Flags: piface.MergeComplete} + return protoiface.MergeOutput{Flags: protoiface.MergeComplete} } func (mi *MessageInfo) mergePointer(dst, src pointer, opts mergeOptions) { @@ -64,7 +64,7 @@ func (mi *MessageInfo) mergePointer(dst, src pointer, opts mergeOptions) { continue } dx := (*dext)[num] - var dv pref.Value + var dv protoreflect.Value if dx.Type() == sx.Type() { dv = dx.Value() } @@ -85,15 +85,15 @@ func (mi *MessageInfo) mergePointer(dst, src pointer, opts mergeOptions) { } } -func mergeScalarValue(dst, src pref.Value, opts mergeOptions) pref.Value { +func mergeScalarValue(dst, src protoreflect.Value, opts mergeOptions) protoreflect.Value { return src } -func mergeBytesValue(dst, src pref.Value, opts mergeOptions) pref.Value { - return pref.ValueOfBytes(append(emptyBuf[:], src.Bytes()...)) +func mergeBytesValue(dst, src protoreflect.Value, opts mergeOptions) protoreflect.Value { + return protoreflect.ValueOfBytes(append(emptyBuf[:], src.Bytes()...)) } -func mergeListValue(dst, src pref.Value, opts mergeOptions) pref.Value { +func mergeListValue(dst, src protoreflect.Value, opts mergeOptions) protoreflect.Value { dstl := dst.List() srcl := src.List() for i, llen := 0, srcl.Len(); i < llen; i++ { @@ -102,29 +102,29 @@ func mergeListValue(dst, src pref.Value, opts mergeOptions) pref.Value { return dst } -func mergeBytesListValue(dst, src pref.Value, opts mergeOptions) pref.Value { +func mergeBytesListValue(dst, src protoreflect.Value, opts mergeOptions) protoreflect.Value { dstl := dst.List() srcl := src.List() for i, llen := 0, srcl.Len(); i < llen; i++ { sb := srcl.Get(i).Bytes() db := append(emptyBuf[:], sb...) - dstl.Append(pref.ValueOfBytes(db)) + dstl.Append(protoreflect.ValueOfBytes(db)) } return dst } -func mergeMessageListValue(dst, src pref.Value, opts mergeOptions) pref.Value { +func mergeMessageListValue(dst, src protoreflect.Value, opts mergeOptions) protoreflect.Value { dstl := dst.List() srcl := src.List() for i, llen := 0, srcl.Len(); i < llen; i++ { sm := srcl.Get(i).Message() dm := proto.Clone(sm.Interface()).ProtoReflect() - dstl.Append(pref.ValueOfMessage(dm)) + dstl.Append(protoreflect.ValueOfMessage(dm)) } return dst } -func mergeMessageValue(dst, src pref.Value, opts mergeOptions) pref.Value { +func mergeMessageValue(dst, src protoreflect.Value, opts mergeOptions) protoreflect.Value { opts.Merge(dst.Message().Interface(), src.Message().Interface()) return dst } diff --git a/vendor/google.golang.org/protobuf/internal/impl/message.go b/vendor/google.golang.org/protobuf/internal/impl/message.go index a104e28e..4f5fb67a 100644 --- a/vendor/google.golang.org/protobuf/internal/impl/message.go +++ b/vendor/google.golang.org/protobuf/internal/impl/message.go @@ -14,8 +14,7 @@ import ( "google.golang.org/protobuf/internal/genid" "google.golang.org/protobuf/reflect/protoreflect" - pref "google.golang.org/protobuf/reflect/protoreflect" - preg "google.golang.org/protobuf/reflect/protoregistry" + "google.golang.org/protobuf/reflect/protoregistry" ) // MessageInfo provides protobuf related functionality for a given Go type @@ -29,7 +28,7 @@ type MessageInfo struct { GoReflectType reflect.Type // pointer to struct // Desc is the underlying message descriptor type and must be populated. - Desc pref.MessageDescriptor + Desc protoreflect.MessageDescriptor // Exporter must be provided in a purego environment in order to provide // access to unexported fields. @@ -54,7 +53,7 @@ type exporter func(v interface{}, i int) interface{} // is generated by our implementation of protoc-gen-go (for v2 and on). // If it is unable to obtain a MessageInfo, it returns nil. func getMessageInfo(mt reflect.Type) *MessageInfo { - m, ok := reflect.Zero(mt).Interface().(pref.ProtoMessage) + m, ok := reflect.Zero(mt).Interface().(protoreflect.ProtoMessage) if !ok { return nil } @@ -97,7 +96,7 @@ func (mi *MessageInfo) initOnce() { // getPointer returns the pointer for a message, which should be of // the type of the MessageInfo. If the message is of a different type, // it returns ok==false. -func (mi *MessageInfo) getPointer(m pref.Message) (p pointer, ok bool) { +func (mi *MessageInfo) getPointer(m protoreflect.Message) (p pointer, ok bool) { switch m := m.(type) { case *messageState: return m.pointer(), m.messageInfo() == mi @@ -134,10 +133,10 @@ type structInfo struct { extensionOffset offset extensionType reflect.Type - fieldsByNumber map[pref.FieldNumber]reflect.StructField - oneofsByName map[pref.Name]reflect.StructField - oneofWrappersByType map[reflect.Type]pref.FieldNumber - oneofWrappersByNumber map[pref.FieldNumber]reflect.Type + fieldsByNumber map[protoreflect.FieldNumber]reflect.StructField + oneofsByName map[protoreflect.Name]reflect.StructField + oneofWrappersByType map[reflect.Type]protoreflect.FieldNumber + oneofWrappersByNumber map[protoreflect.FieldNumber]reflect.Type } func (mi *MessageInfo) makeStructInfo(t reflect.Type) structInfo { @@ -147,10 +146,10 @@ func (mi *MessageInfo) makeStructInfo(t reflect.Type) structInfo { unknownOffset: invalidOffset, extensionOffset: invalidOffset, - fieldsByNumber: map[pref.FieldNumber]reflect.StructField{}, - oneofsByName: map[pref.Name]reflect.StructField{}, - oneofWrappersByType: map[reflect.Type]pref.FieldNumber{}, - oneofWrappersByNumber: map[pref.FieldNumber]reflect.Type{}, + fieldsByNumber: map[protoreflect.FieldNumber]reflect.StructField{}, + oneofsByName: map[protoreflect.Name]reflect.StructField{}, + oneofWrappersByType: map[reflect.Type]protoreflect.FieldNumber{}, + oneofWrappersByNumber: map[protoreflect.FieldNumber]reflect.Type{}, } fieldLoop: @@ -180,12 +179,12 @@ fieldLoop: for _, s := range strings.Split(f.Tag.Get("protobuf"), ",") { if len(s) > 0 && strings.Trim(s, "0123456789") == "" { n, _ := strconv.ParseUint(s, 10, 64) - si.fieldsByNumber[pref.FieldNumber(n)] = f + si.fieldsByNumber[protoreflect.FieldNumber(n)] = f continue fieldLoop } } if s := f.Tag.Get("protobuf_oneof"); len(s) > 0 { - si.oneofsByName[pref.Name(s)] = f + si.oneofsByName[protoreflect.Name(s)] = f continue fieldLoop } } @@ -208,8 +207,8 @@ fieldLoop: for _, s := range strings.Split(f.Tag.Get("protobuf"), ",") { if len(s) > 0 && strings.Trim(s, "0123456789") == "" { n, _ := strconv.ParseUint(s, 10, 64) - si.oneofWrappersByType[tf] = pref.FieldNumber(n) - si.oneofWrappersByNumber[pref.FieldNumber(n)] = tf + si.oneofWrappersByType[tf] = protoreflect.FieldNumber(n) + si.oneofWrappersByNumber[protoreflect.FieldNumber(n)] = tf break } } @@ -219,7 +218,11 @@ fieldLoop: } func (mi *MessageInfo) New() protoreflect.Message { - return mi.MessageOf(reflect.New(mi.GoReflectType.Elem()).Interface()) + m := reflect.New(mi.GoReflectType.Elem()).Interface() + if r, ok := m.(protoreflect.ProtoMessage); ok { + return r.ProtoReflect() + } + return mi.MessageOf(m) } func (mi *MessageInfo) Zero() protoreflect.Message { return mi.MessageOf(reflect.Zero(mi.GoReflectType).Interface()) @@ -237,7 +240,7 @@ func (mi *MessageInfo) Message(i int) protoreflect.MessageType { fd := mi.Desc.Fields().Get(i) switch { case fd.IsWeak(): - mt, _ := preg.GlobalTypes.FindMessageByName(fd.Message().FullName()) + mt, _ := protoregistry.GlobalTypes.FindMessageByName(fd.Message().FullName()) return mt case fd.IsMap(): return mapEntryType{fd.Message(), mi.fieldTypes[fd.Number()]} diff --git a/vendor/google.golang.org/protobuf/internal/impl/message_reflect.go b/vendor/google.golang.org/protobuf/internal/impl/message_reflect.go index 9488b726..d9ea010b 100644 --- a/vendor/google.golang.org/protobuf/internal/impl/message_reflect.go +++ b/vendor/google.golang.org/protobuf/internal/impl/message_reflect.go @@ -10,17 +10,17 @@ import ( "google.golang.org/protobuf/internal/detrand" "google.golang.org/protobuf/internal/pragma" - pref "google.golang.org/protobuf/reflect/protoreflect" + "google.golang.org/protobuf/reflect/protoreflect" ) type reflectMessageInfo struct { - fields map[pref.FieldNumber]*fieldInfo - oneofs map[pref.Name]*oneofInfo + fields map[protoreflect.FieldNumber]*fieldInfo + oneofs map[protoreflect.Name]*oneofInfo // fieldTypes contains the zero value of an enum or message field. // For lists, it contains the element type. // For maps, it contains the entry value type. - fieldTypes map[pref.FieldNumber]interface{} + fieldTypes map[protoreflect.FieldNumber]interface{} // denseFields is a subset of fields where: // 0 < fieldDesc.Number() < len(denseFields) @@ -30,8 +30,8 @@ type reflectMessageInfo struct { // rangeInfos is a list of all fields (not belonging to a oneof) and oneofs. rangeInfos []interface{} // either *fieldInfo or *oneofInfo - getUnknown func(pointer) pref.RawFields - setUnknown func(pointer, pref.RawFields) + getUnknown func(pointer) protoreflect.RawFields + setUnknown func(pointer, protoreflect.RawFields) extensionMap func(pointer) *extensionMap nilMessage atomicNilMessage @@ -52,7 +52,7 @@ func (mi *MessageInfo) makeReflectFuncs(t reflect.Type, si structInfo) { // This code assumes that the struct is well-formed and panics if there are // any discrepancies. func (mi *MessageInfo) makeKnownFieldsFunc(si structInfo) { - mi.fields = map[pref.FieldNumber]*fieldInfo{} + mi.fields = map[protoreflect.FieldNumber]*fieldInfo{} md := mi.Desc fds := md.Fields() for i := 0; i < fds.Len(); i++ { @@ -82,7 +82,7 @@ func (mi *MessageInfo) makeKnownFieldsFunc(si structInfo) { mi.fields[fd.Number()] = &fi } - mi.oneofs = map[pref.Name]*oneofInfo{} + mi.oneofs = map[protoreflect.Name]*oneofInfo{} for i := 0; i < md.Oneofs().Len(); i++ { od := md.Oneofs().Get(i) mi.oneofs[od.Name()] = makeOneofInfo(od, si, mi.Exporter) @@ -117,13 +117,13 @@ func (mi *MessageInfo) makeUnknownFieldsFunc(t reflect.Type, si structInfo) { switch { case si.unknownOffset.IsValid() && si.unknownType == unknownFieldsAType: // Handle as []byte. - mi.getUnknown = func(p pointer) pref.RawFields { + mi.getUnknown = func(p pointer) protoreflect.RawFields { if p.IsNil() { return nil } return *p.Apply(mi.unknownOffset).Bytes() } - mi.setUnknown = func(p pointer, b pref.RawFields) { + mi.setUnknown = func(p pointer, b protoreflect.RawFields) { if p.IsNil() { panic("invalid SetUnknown on nil Message") } @@ -131,7 +131,7 @@ func (mi *MessageInfo) makeUnknownFieldsFunc(t reflect.Type, si structInfo) { } case si.unknownOffset.IsValid() && si.unknownType == unknownFieldsBType: // Handle as *[]byte. - mi.getUnknown = func(p pointer) pref.RawFields { + mi.getUnknown = func(p pointer) protoreflect.RawFields { if p.IsNil() { return nil } @@ -141,7 +141,7 @@ func (mi *MessageInfo) makeUnknownFieldsFunc(t reflect.Type, si structInfo) { } return **bp } - mi.setUnknown = func(p pointer, b pref.RawFields) { + mi.setUnknown = func(p pointer, b protoreflect.RawFields) { if p.IsNil() { panic("invalid SetUnknown on nil Message") } @@ -152,10 +152,10 @@ func (mi *MessageInfo) makeUnknownFieldsFunc(t reflect.Type, si structInfo) { **bp = b } default: - mi.getUnknown = func(pointer) pref.RawFields { + mi.getUnknown = func(pointer) protoreflect.RawFields { return nil } - mi.setUnknown = func(p pointer, _ pref.RawFields) { + mi.setUnknown = func(p pointer, _ protoreflect.RawFields) { if p.IsNil() { panic("invalid SetUnknown on nil Message") } @@ -224,7 +224,7 @@ func (mi *MessageInfo) makeFieldTypes(si structInfo) { } if ft != nil { if mi.fieldTypes == nil { - mi.fieldTypes = make(map[pref.FieldNumber]interface{}) + mi.fieldTypes = make(map[protoreflect.FieldNumber]interface{}) } mi.fieldTypes[fd.Number()] = reflect.Zero(ft).Interface() } @@ -233,7 +233,7 @@ func (mi *MessageInfo) makeFieldTypes(si structInfo) { type extensionMap map[int32]ExtensionField -func (m *extensionMap) Range(f func(pref.FieldDescriptor, pref.Value) bool) { +func (m *extensionMap) Range(f func(protoreflect.FieldDescriptor, protoreflect.Value) bool) { if m != nil { for _, x := range *m { xd := x.Type().TypeDescriptor() @@ -247,7 +247,7 @@ func (m *extensionMap) Range(f func(pref.FieldDescriptor, pref.Value) bool) { } } } -func (m *extensionMap) Has(xt pref.ExtensionType) (ok bool) { +func (m *extensionMap) Has(xt protoreflect.ExtensionType) (ok bool) { if m == nil { return false } @@ -266,10 +266,10 @@ func (m *extensionMap) Has(xt pref.ExtensionType) (ok bool) { } return true } -func (m *extensionMap) Clear(xt pref.ExtensionType) { +func (m *extensionMap) Clear(xt protoreflect.ExtensionType) { delete(*m, int32(xt.TypeDescriptor().Number())) } -func (m *extensionMap) Get(xt pref.ExtensionType) pref.Value { +func (m *extensionMap) Get(xt protoreflect.ExtensionType) protoreflect.Value { xd := xt.TypeDescriptor() if m != nil { if x, ok := (*m)[int32(xd.Number())]; ok { @@ -278,7 +278,7 @@ func (m *extensionMap) Get(xt pref.ExtensionType) pref.Value { } return xt.Zero() } -func (m *extensionMap) Set(xt pref.ExtensionType, v pref.Value) { +func (m *extensionMap) Set(xt protoreflect.ExtensionType, v protoreflect.Value) { xd := xt.TypeDescriptor() isValid := true switch { @@ -302,9 +302,9 @@ func (m *extensionMap) Set(xt pref.ExtensionType, v pref.Value) { x.Set(xt, v) (*m)[int32(xd.Number())] = x } -func (m *extensionMap) Mutable(xt pref.ExtensionType) pref.Value { +func (m *extensionMap) Mutable(xt protoreflect.ExtensionType) protoreflect.Value { xd := xt.TypeDescriptor() - if xd.Kind() != pref.MessageKind && xd.Kind() != pref.GroupKind && !xd.IsList() && !xd.IsMap() { + if xd.Kind() != protoreflect.MessageKind && xd.Kind() != protoreflect.GroupKind && !xd.IsList() && !xd.IsMap() { panic("invalid Mutable on field with non-composite type") } if x, ok := (*m)[int32(xd.Number())]; ok { @@ -320,7 +320,6 @@ func (m *extensionMap) Mutable(xt pref.ExtensionType) pref.Value { // in an allocation-free way without needing to have a shadow Go type generated // for every message type. This technique only works using unsafe. // -// // Example generated code: // // type M struct { @@ -351,12 +350,11 @@ func (m *extensionMap) Mutable(xt pref.ExtensionType) pref.Value { // It has access to the message info as its first field, and a pointer to the // MessageState is identical to a pointer to the concrete message value. // -// // Requirements: -// • The type M must implement protoreflect.ProtoMessage. -// • The address of m must not be nil. -// • The address of m and the address of m.state must be equal, -// even though they are different Go types. +// - The type M must implement protoreflect.ProtoMessage. +// - The address of m must not be nil. +// - The address of m and the address of m.state must be equal, +// even though they are different Go types. type MessageState struct { pragma.NoUnkeyedLiterals pragma.DoNotCompare @@ -368,8 +366,8 @@ type MessageState struct { type messageState MessageState var ( - _ pref.Message = (*messageState)(nil) - _ unwrapper = (*messageState)(nil) + _ protoreflect.Message = (*messageState)(nil) + _ unwrapper = (*messageState)(nil) ) // messageDataType is a tuple of a pointer to the message data and @@ -387,16 +385,16 @@ type ( ) var ( - _ pref.Message = (*messageReflectWrapper)(nil) - _ unwrapper = (*messageReflectWrapper)(nil) - _ pref.ProtoMessage = (*messageIfaceWrapper)(nil) - _ unwrapper = (*messageIfaceWrapper)(nil) + _ protoreflect.Message = (*messageReflectWrapper)(nil) + _ unwrapper = (*messageReflectWrapper)(nil) + _ protoreflect.ProtoMessage = (*messageIfaceWrapper)(nil) + _ unwrapper = (*messageIfaceWrapper)(nil) ) // MessageOf returns a reflective view over a message. The input must be a // pointer to a named Go struct. If the provided type has a ProtoReflect method, // it must be implemented by calling this method. -func (mi *MessageInfo) MessageOf(m interface{}) pref.Message { +func (mi *MessageInfo) MessageOf(m interface{}) protoreflect.Message { if reflect.TypeOf(m) != mi.GoReflectType { panic(fmt.Sprintf("type mismatch: got %T, want %v", m, mi.GoReflectType)) } @@ -421,7 +419,7 @@ func (m *messageIfaceWrapper) Reset() { rv.Elem().Set(reflect.Zero(rv.Type().Elem())) } } -func (m *messageIfaceWrapper) ProtoReflect() pref.Message { +func (m *messageIfaceWrapper) ProtoReflect() protoreflect.Message { return (*messageReflectWrapper)(m) } func (m *messageIfaceWrapper) protoUnwrap() interface{} { @@ -430,7 +428,7 @@ func (m *messageIfaceWrapper) protoUnwrap() interface{} { // checkField verifies that the provided field descriptor is valid. // Exactly one of the returned values is populated. -func (mi *MessageInfo) checkField(fd pref.FieldDescriptor) (*fieldInfo, pref.ExtensionType) { +func (mi *MessageInfo) checkField(fd protoreflect.FieldDescriptor) (*fieldInfo, protoreflect.ExtensionType) { var fi *fieldInfo if n := fd.Number(); 0 < n && int(n) < len(mi.denseFields) { fi = mi.denseFields[n] @@ -455,7 +453,7 @@ func (mi *MessageInfo) checkField(fd pref.FieldDescriptor) (*fieldInfo, pref.Ext if !mi.Desc.ExtensionRanges().Has(fd.Number()) { panic(fmt.Sprintf("extension %v extends %v outside the extension range", fd.FullName(), mi.Desc.FullName())) } - xtd, ok := fd.(pref.ExtensionTypeDescriptor) + xtd, ok := fd.(protoreflect.ExtensionTypeDescriptor) if !ok { panic(fmt.Sprintf("extension %v does not implement protoreflect.ExtensionTypeDescriptor", fd.FullName())) } diff --git a/vendor/google.golang.org/protobuf/internal/impl/message_reflect_field.go b/vendor/google.golang.org/protobuf/internal/impl/message_reflect_field.go index 343cf872..5e736c60 100644 --- a/vendor/google.golang.org/protobuf/internal/impl/message_reflect_field.go +++ b/vendor/google.golang.org/protobuf/internal/impl/message_reflect_field.go @@ -11,24 +11,24 @@ import ( "sync" "google.golang.org/protobuf/internal/flags" - pref "google.golang.org/protobuf/reflect/protoreflect" - preg "google.golang.org/protobuf/reflect/protoregistry" + "google.golang.org/protobuf/reflect/protoreflect" + "google.golang.org/protobuf/reflect/protoregistry" ) type fieldInfo struct { - fieldDesc pref.FieldDescriptor + fieldDesc protoreflect.FieldDescriptor // These fields are used for protobuf reflection support. has func(pointer) bool clear func(pointer) - get func(pointer) pref.Value - set func(pointer, pref.Value) - mutable func(pointer) pref.Value - newMessage func() pref.Message - newField func() pref.Value + get func(pointer) protoreflect.Value + set func(pointer, protoreflect.Value) + mutable func(pointer) protoreflect.Value + newMessage func() protoreflect.Message + newField func() protoreflect.Value } -func fieldInfoForMissing(fd pref.FieldDescriptor) fieldInfo { +func fieldInfoForMissing(fd protoreflect.FieldDescriptor) fieldInfo { // This never occurs for generated message types. // It implies that a hand-crafted type has missing Go fields // for specific protobuf message fields. @@ -40,19 +40,19 @@ func fieldInfoForMissing(fd pref.FieldDescriptor) fieldInfo { clear: func(p pointer) { panic("missing Go struct field for " + string(fd.FullName())) }, - get: func(p pointer) pref.Value { + get: func(p pointer) protoreflect.Value { return fd.Default() }, - set: func(p pointer, v pref.Value) { + set: func(p pointer, v protoreflect.Value) { panic("missing Go struct field for " + string(fd.FullName())) }, - mutable: func(p pointer) pref.Value { + mutable: func(p pointer) protoreflect.Value { panic("missing Go struct field for " + string(fd.FullName())) }, - newMessage: func() pref.Message { + newMessage: func() protoreflect.Message { panic("missing Go struct field for " + string(fd.FullName())) }, - newField: func() pref.Value { + newField: func() protoreflect.Value { if v := fd.Default(); v.IsValid() { return v } @@ -61,7 +61,7 @@ func fieldInfoForMissing(fd pref.FieldDescriptor) fieldInfo { } } -func fieldInfoForOneof(fd pref.FieldDescriptor, fs reflect.StructField, x exporter, ot reflect.Type) fieldInfo { +func fieldInfoForOneof(fd protoreflect.FieldDescriptor, fs reflect.StructField, x exporter, ot reflect.Type) fieldInfo { ft := fs.Type if ft.Kind() != reflect.Interface { panic(fmt.Sprintf("field %v has invalid type: got %v, want interface kind", fd.FullName(), ft)) @@ -102,7 +102,7 @@ func fieldInfoForOneof(fd pref.FieldDescriptor, fs reflect.StructField, x export } rv.Set(reflect.Zero(rv.Type())) }, - get: func(p pointer) pref.Value { + get: func(p pointer) protoreflect.Value { if p.IsNil() { return conv.Zero() } @@ -113,7 +113,7 @@ func fieldInfoForOneof(fd pref.FieldDescriptor, fs reflect.StructField, x export rv = rv.Elem().Elem().Field(0) return conv.PBValueOf(rv) }, - set: func(p pointer, v pref.Value) { + set: func(p pointer, v protoreflect.Value) { rv := p.Apply(fieldOffset).AsValueOf(fs.Type).Elem() if rv.IsNil() || rv.Elem().Type().Elem() != ot || rv.Elem().IsNil() { rv.Set(reflect.New(ot)) @@ -121,7 +121,7 @@ func fieldInfoForOneof(fd pref.FieldDescriptor, fs reflect.StructField, x export rv = rv.Elem().Elem().Field(0) rv.Set(conv.GoValueOf(v)) }, - mutable: func(p pointer) pref.Value { + mutable: func(p pointer) protoreflect.Value { if !isMessage { panic(fmt.Sprintf("field %v with invalid Mutable call on field with non-composite type", fd.FullName())) } @@ -131,20 +131,20 @@ func fieldInfoForOneof(fd pref.FieldDescriptor, fs reflect.StructField, x export } rv = rv.Elem().Elem().Field(0) if rv.Kind() == reflect.Ptr && rv.IsNil() { - rv.Set(conv.GoValueOf(pref.ValueOfMessage(conv.New().Message()))) + rv.Set(conv.GoValueOf(protoreflect.ValueOfMessage(conv.New().Message()))) } return conv.PBValueOf(rv) }, - newMessage: func() pref.Message { + newMessage: func() protoreflect.Message { return conv.New().Message() }, - newField: func() pref.Value { + newField: func() protoreflect.Value { return conv.New() }, } } -func fieldInfoForMap(fd pref.FieldDescriptor, fs reflect.StructField, x exporter) fieldInfo { +func fieldInfoForMap(fd protoreflect.FieldDescriptor, fs reflect.StructField, x exporter) fieldInfo { ft := fs.Type if ft.Kind() != reflect.Map { panic(fmt.Sprintf("field %v has invalid type: got %v, want map kind", fd.FullName(), ft)) @@ -166,7 +166,7 @@ func fieldInfoForMap(fd pref.FieldDescriptor, fs reflect.StructField, x exporter rv := p.Apply(fieldOffset).AsValueOf(fs.Type).Elem() rv.Set(reflect.Zero(rv.Type())) }, - get: func(p pointer) pref.Value { + get: func(p pointer) protoreflect.Value { if p.IsNil() { return conv.Zero() } @@ -176,7 +176,7 @@ func fieldInfoForMap(fd pref.FieldDescriptor, fs reflect.StructField, x exporter } return conv.PBValueOf(rv) }, - set: func(p pointer, v pref.Value) { + set: func(p pointer, v protoreflect.Value) { rv := p.Apply(fieldOffset).AsValueOf(fs.Type).Elem() pv := conv.GoValueOf(v) if pv.IsNil() { @@ -184,20 +184,20 @@ func fieldInfoForMap(fd pref.FieldDescriptor, fs reflect.StructField, x exporter } rv.Set(pv) }, - mutable: func(p pointer) pref.Value { + mutable: func(p pointer) protoreflect.Value { v := p.Apply(fieldOffset).AsValueOf(fs.Type).Elem() if v.IsNil() { v.Set(reflect.MakeMap(fs.Type)) } return conv.PBValueOf(v) }, - newField: func() pref.Value { + newField: func() protoreflect.Value { return conv.New() }, } } -func fieldInfoForList(fd pref.FieldDescriptor, fs reflect.StructField, x exporter) fieldInfo { +func fieldInfoForList(fd protoreflect.FieldDescriptor, fs reflect.StructField, x exporter) fieldInfo { ft := fs.Type if ft.Kind() != reflect.Slice { panic(fmt.Sprintf("field %v has invalid type: got %v, want slice kind", fd.FullName(), ft)) @@ -219,7 +219,7 @@ func fieldInfoForList(fd pref.FieldDescriptor, fs reflect.StructField, x exporte rv := p.Apply(fieldOffset).AsValueOf(fs.Type).Elem() rv.Set(reflect.Zero(rv.Type())) }, - get: func(p pointer) pref.Value { + get: func(p pointer) protoreflect.Value { if p.IsNil() { return conv.Zero() } @@ -229,7 +229,7 @@ func fieldInfoForList(fd pref.FieldDescriptor, fs reflect.StructField, x exporte } return conv.PBValueOf(rv) }, - set: func(p pointer, v pref.Value) { + set: func(p pointer, v protoreflect.Value) { rv := p.Apply(fieldOffset).AsValueOf(fs.Type).Elem() pv := conv.GoValueOf(v) if pv.IsNil() { @@ -237,11 +237,11 @@ func fieldInfoForList(fd pref.FieldDescriptor, fs reflect.StructField, x exporte } rv.Set(pv.Elem()) }, - mutable: func(p pointer) pref.Value { + mutable: func(p pointer) protoreflect.Value { v := p.Apply(fieldOffset).AsValueOf(fs.Type) return conv.PBValueOf(v) }, - newField: func() pref.Value { + newField: func() protoreflect.Value { return conv.New() }, } @@ -252,7 +252,7 @@ var ( emptyBytes = reflect.ValueOf([]byte{}) ) -func fieldInfoForScalar(fd pref.FieldDescriptor, fs reflect.StructField, x exporter) fieldInfo { +func fieldInfoForScalar(fd protoreflect.FieldDescriptor, fs reflect.StructField, x exporter) fieldInfo { ft := fs.Type nullable := fd.HasPresence() isBytes := ft.Kind() == reflect.Slice && ft.Elem().Kind() == reflect.Uint8 @@ -300,7 +300,7 @@ func fieldInfoForScalar(fd pref.FieldDescriptor, fs reflect.StructField, x expor rv := p.Apply(fieldOffset).AsValueOf(fs.Type).Elem() rv.Set(reflect.Zero(rv.Type())) }, - get: func(p pointer) pref.Value { + get: func(p pointer) protoreflect.Value { if p.IsNil() { return conv.Zero() } @@ -315,7 +315,7 @@ func fieldInfoForScalar(fd pref.FieldDescriptor, fs reflect.StructField, x expor } return conv.PBValueOf(rv) }, - set: func(p pointer, v pref.Value) { + set: func(p pointer, v protoreflect.Value) { rv := p.Apply(fieldOffset).AsValueOf(fs.Type).Elem() if nullable && rv.Kind() == reflect.Ptr { if rv.IsNil() { @@ -332,23 +332,23 @@ func fieldInfoForScalar(fd pref.FieldDescriptor, fs reflect.StructField, x expor } } }, - newField: func() pref.Value { + newField: func() protoreflect.Value { return conv.New() }, } } -func fieldInfoForWeakMessage(fd pref.FieldDescriptor, weakOffset offset) fieldInfo { +func fieldInfoForWeakMessage(fd protoreflect.FieldDescriptor, weakOffset offset) fieldInfo { if !flags.ProtoLegacy { panic("no support for proto1 weak fields") } var once sync.Once - var messageType pref.MessageType + var messageType protoreflect.MessageType lazyInit := func() { once.Do(func() { messageName := fd.Message().FullName() - messageType, _ = preg.GlobalTypes.FindMessageByName(messageName) + messageType, _ = protoregistry.GlobalTypes.FindMessageByName(messageName) if messageType == nil { panic(fmt.Sprintf("weak message %v for field %v is not linked in", messageName, fd.FullName())) } @@ -368,18 +368,18 @@ func fieldInfoForWeakMessage(fd pref.FieldDescriptor, weakOffset offset) fieldIn clear: func(p pointer) { p.Apply(weakOffset).WeakFields().clear(num) }, - get: func(p pointer) pref.Value { + get: func(p pointer) protoreflect.Value { lazyInit() if p.IsNil() { - return pref.ValueOfMessage(messageType.Zero()) + return protoreflect.ValueOfMessage(messageType.Zero()) } m, ok := p.Apply(weakOffset).WeakFields().get(num) if !ok { - return pref.ValueOfMessage(messageType.Zero()) + return protoreflect.ValueOfMessage(messageType.Zero()) } - return pref.ValueOfMessage(m.ProtoReflect()) + return protoreflect.ValueOfMessage(m.ProtoReflect()) }, - set: func(p pointer, v pref.Value) { + set: func(p pointer, v protoreflect.Value) { lazyInit() m := v.Message() if m.Descriptor() != messageType.Descriptor() { @@ -390,7 +390,7 @@ func fieldInfoForWeakMessage(fd pref.FieldDescriptor, weakOffset offset) fieldIn } p.Apply(weakOffset).WeakFields().set(num, m.Interface()) }, - mutable: func(p pointer) pref.Value { + mutable: func(p pointer) protoreflect.Value { lazyInit() fs := p.Apply(weakOffset).WeakFields() m, ok := fs.get(num) @@ -398,20 +398,20 @@ func fieldInfoForWeakMessage(fd pref.FieldDescriptor, weakOffset offset) fieldIn m = messageType.New().Interface() fs.set(num, m) } - return pref.ValueOfMessage(m.ProtoReflect()) + return protoreflect.ValueOfMessage(m.ProtoReflect()) }, - newMessage: func() pref.Message { + newMessage: func() protoreflect.Message { lazyInit() return messageType.New() }, - newField: func() pref.Value { + newField: func() protoreflect.Value { lazyInit() - return pref.ValueOfMessage(messageType.New()) + return protoreflect.ValueOfMessage(messageType.New()) }, } } -func fieldInfoForMessage(fd pref.FieldDescriptor, fs reflect.StructField, x exporter) fieldInfo { +func fieldInfoForMessage(fd protoreflect.FieldDescriptor, fs reflect.StructField, x exporter) fieldInfo { ft := fs.Type conv := NewConverter(ft, fd) @@ -433,47 +433,47 @@ func fieldInfoForMessage(fd pref.FieldDescriptor, fs reflect.StructField, x expo rv := p.Apply(fieldOffset).AsValueOf(fs.Type).Elem() rv.Set(reflect.Zero(rv.Type())) }, - get: func(p pointer) pref.Value { + get: func(p pointer) protoreflect.Value { if p.IsNil() { return conv.Zero() } rv := p.Apply(fieldOffset).AsValueOf(fs.Type).Elem() return conv.PBValueOf(rv) }, - set: func(p pointer, v pref.Value) { + set: func(p pointer, v protoreflect.Value) { rv := p.Apply(fieldOffset).AsValueOf(fs.Type).Elem() rv.Set(conv.GoValueOf(v)) if fs.Type.Kind() == reflect.Ptr && rv.IsNil() { panic(fmt.Sprintf("field %v has invalid nil pointer", fd.FullName())) } }, - mutable: func(p pointer) pref.Value { + mutable: func(p pointer) protoreflect.Value { rv := p.Apply(fieldOffset).AsValueOf(fs.Type).Elem() if fs.Type.Kind() == reflect.Ptr && rv.IsNil() { rv.Set(conv.GoValueOf(conv.New())) } return conv.PBValueOf(rv) }, - newMessage: func() pref.Message { + newMessage: func() protoreflect.Message { return conv.New().Message() }, - newField: func() pref.Value { + newField: func() protoreflect.Value { return conv.New() }, } } type oneofInfo struct { - oneofDesc pref.OneofDescriptor - which func(pointer) pref.FieldNumber + oneofDesc protoreflect.OneofDescriptor + which func(pointer) protoreflect.FieldNumber } -func makeOneofInfo(od pref.OneofDescriptor, si structInfo, x exporter) *oneofInfo { +func makeOneofInfo(od protoreflect.OneofDescriptor, si structInfo, x exporter) *oneofInfo { oi := &oneofInfo{oneofDesc: od} if od.IsSynthetic() { fs := si.fieldsByNumber[od.Fields().Get(0).Number()] fieldOffset := offsetOf(fs, x) - oi.which = func(p pointer) pref.FieldNumber { + oi.which = func(p pointer) protoreflect.FieldNumber { if p.IsNil() { return 0 } @@ -486,7 +486,7 @@ func makeOneofInfo(od pref.OneofDescriptor, si structInfo, x exporter) *oneofInf } else { fs := si.oneofsByName[od.Name()] fieldOffset := offsetOf(fs, x) - oi.which = func(p pointer) pref.FieldNumber { + oi.which = func(p pointer) protoreflect.FieldNumber { if p.IsNil() { return 0 } diff --git a/vendor/google.golang.org/protobuf/internal/impl/validate.go b/vendor/google.golang.org/protobuf/internal/impl/validate.go index 08cfb605..a24e6bbd 100644 --- a/vendor/google.golang.org/protobuf/internal/impl/validate.go +++ b/vendor/google.golang.org/protobuf/internal/impl/validate.go @@ -16,9 +16,9 @@ import ( "google.golang.org/protobuf/internal/flags" "google.golang.org/protobuf/internal/genid" "google.golang.org/protobuf/internal/strs" - pref "google.golang.org/protobuf/reflect/protoreflect" - preg "google.golang.org/protobuf/reflect/protoregistry" - piface "google.golang.org/protobuf/runtime/protoiface" + "google.golang.org/protobuf/reflect/protoreflect" + "google.golang.org/protobuf/reflect/protoregistry" + "google.golang.org/protobuf/runtime/protoiface" ) // ValidationStatus is the result of validating the wire-format encoding of a message. @@ -56,20 +56,20 @@ func (v ValidationStatus) String() string { // of the message type. // // This function is exposed for testing. -func Validate(mt pref.MessageType, in piface.UnmarshalInput) (out piface.UnmarshalOutput, _ ValidationStatus) { +func Validate(mt protoreflect.MessageType, in protoiface.UnmarshalInput) (out protoiface.UnmarshalOutput, _ ValidationStatus) { mi, ok := mt.(*MessageInfo) if !ok { return out, ValidationUnknown } if in.Resolver == nil { - in.Resolver = preg.GlobalTypes + in.Resolver = protoregistry.GlobalTypes } o, st := mi.validate(in.Buf, 0, unmarshalOptions{ flags: in.Flags, resolver: in.Resolver, }) if o.initialized { - out.Flags |= piface.UnmarshalInitialized + out.Flags |= protoiface.UnmarshalInitialized } return out, st } @@ -106,22 +106,22 @@ const ( validationTypeMessageSetItem ) -func newFieldValidationInfo(mi *MessageInfo, si structInfo, fd pref.FieldDescriptor, ft reflect.Type) validationInfo { +func newFieldValidationInfo(mi *MessageInfo, si structInfo, fd protoreflect.FieldDescriptor, ft reflect.Type) validationInfo { var vi validationInfo switch { case fd.ContainingOneof() != nil && !fd.ContainingOneof().IsSynthetic(): switch fd.Kind() { - case pref.MessageKind: + case protoreflect.MessageKind: vi.typ = validationTypeMessage if ot, ok := si.oneofWrappersByNumber[fd.Number()]; ok { vi.mi = getMessageInfo(ot.Field(0).Type) } - case pref.GroupKind: + case protoreflect.GroupKind: vi.typ = validationTypeGroup if ot, ok := si.oneofWrappersByNumber[fd.Number()]; ok { vi.mi = getMessageInfo(ot.Field(0).Type) } - case pref.StringKind: + case protoreflect.StringKind: if strs.EnforceUTF8(fd) { vi.typ = validationTypeUTF8String } @@ -129,7 +129,7 @@ func newFieldValidationInfo(mi *MessageInfo, si structInfo, fd pref.FieldDescrip default: vi = newValidationInfo(fd, ft) } - if fd.Cardinality() == pref.Required { + if fd.Cardinality() == protoreflect.Required { // Avoid overflow. The required field check is done with a 64-bit mask, with // any message containing more than 64 required fields always reported as // potentially uninitialized, so it is not important to get a precise count @@ -142,22 +142,22 @@ func newFieldValidationInfo(mi *MessageInfo, si structInfo, fd pref.FieldDescrip return vi } -func newValidationInfo(fd pref.FieldDescriptor, ft reflect.Type) validationInfo { +func newValidationInfo(fd protoreflect.FieldDescriptor, ft reflect.Type) validationInfo { var vi validationInfo switch { case fd.IsList(): switch fd.Kind() { - case pref.MessageKind: + case protoreflect.MessageKind: vi.typ = validationTypeMessage if ft.Kind() == reflect.Slice { vi.mi = getMessageInfo(ft.Elem()) } - case pref.GroupKind: + case protoreflect.GroupKind: vi.typ = validationTypeGroup if ft.Kind() == reflect.Slice { vi.mi = getMessageInfo(ft.Elem()) } - case pref.StringKind: + case protoreflect.StringKind: vi.typ = validationTypeBytes if strs.EnforceUTF8(fd) { vi.typ = validationTypeUTF8String @@ -175,33 +175,33 @@ func newValidationInfo(fd pref.FieldDescriptor, ft reflect.Type) validationInfo case fd.IsMap(): vi.typ = validationTypeMap switch fd.MapKey().Kind() { - case pref.StringKind: + case protoreflect.StringKind: if strs.EnforceUTF8(fd) { vi.keyType = validationTypeUTF8String } } switch fd.MapValue().Kind() { - case pref.MessageKind: + case protoreflect.MessageKind: vi.valType = validationTypeMessage if ft.Kind() == reflect.Map { vi.mi = getMessageInfo(ft.Elem()) } - case pref.StringKind: + case protoreflect.StringKind: if strs.EnforceUTF8(fd) { vi.valType = validationTypeUTF8String } } default: switch fd.Kind() { - case pref.MessageKind: + case protoreflect.MessageKind: vi.typ = validationTypeMessage if !fd.IsWeak() { vi.mi = getMessageInfo(ft) } - case pref.GroupKind: + case protoreflect.GroupKind: vi.typ = validationTypeGroup vi.mi = getMessageInfo(ft) - case pref.StringKind: + case protoreflect.StringKind: vi.typ = validationTypeBytes if strs.EnforceUTF8(fd) { vi.typ = validationTypeUTF8String @@ -314,11 +314,11 @@ State: break } messageName := fd.Message().FullName() - messageType, err := preg.GlobalTypes.FindMessageByName(messageName) + messageType, err := protoregistry.GlobalTypes.FindMessageByName(messageName) switch err { case nil: vi.mi, _ = messageType.(*MessageInfo) - case preg.NotFound: + case protoregistry.NotFound: vi.typ = validationTypeBytes default: return out, ValidationUnknown @@ -335,7 +335,7 @@ State: // unmarshaling to begin failing. Supporting this requires some way to // determine if the resolver is frozen. xt, err := opts.resolver.FindExtensionByNumber(st.mi.Desc.FullName(), num) - if err != nil && err != preg.NotFound { + if err != nil && err != protoregistry.NotFound { return out, ValidationUnknown } if err == nil { @@ -513,7 +513,7 @@ State: } xt, err := opts.resolver.FindExtensionByNumber(st.mi.Desc.FullName(), typeid) switch { - case err == preg.NotFound: + case err == protoregistry.NotFound: b = b[n:] case err != nil: return out, ValidationUnknown diff --git a/vendor/google.golang.org/protobuf/internal/impl/weak.go b/vendor/google.golang.org/protobuf/internal/impl/weak.go index 009cbefd..eb79a7ba 100644 --- a/vendor/google.golang.org/protobuf/internal/impl/weak.go +++ b/vendor/google.golang.org/protobuf/internal/impl/weak.go @@ -7,7 +7,7 @@ package impl import ( "fmt" - pref "google.golang.org/protobuf/reflect/protoreflect" + "google.golang.org/protobuf/reflect/protoreflect" "google.golang.org/protobuf/reflect/protoregistry" ) @@ -17,32 +17,32 @@ import ( // defined directly on it. type weakFields WeakFields -func (w weakFields) get(num pref.FieldNumber) (pref.ProtoMessage, bool) { +func (w weakFields) get(num protoreflect.FieldNumber) (protoreflect.ProtoMessage, bool) { m, ok := w[int32(num)] return m, ok } -func (w *weakFields) set(num pref.FieldNumber, m pref.ProtoMessage) { +func (w *weakFields) set(num protoreflect.FieldNumber, m protoreflect.ProtoMessage) { if *w == nil { *w = make(weakFields) } (*w)[int32(num)] = m } -func (w *weakFields) clear(num pref.FieldNumber) { +func (w *weakFields) clear(num protoreflect.FieldNumber) { delete(*w, int32(num)) } -func (Export) HasWeak(w WeakFields, num pref.FieldNumber) bool { +func (Export) HasWeak(w WeakFields, num protoreflect.FieldNumber) bool { _, ok := w[int32(num)] return ok } -func (Export) ClearWeak(w *WeakFields, num pref.FieldNumber) { +func (Export) ClearWeak(w *WeakFields, num protoreflect.FieldNumber) { delete(*w, int32(num)) } -func (Export) GetWeak(w WeakFields, num pref.FieldNumber, name pref.FullName) pref.ProtoMessage { +func (Export) GetWeak(w WeakFields, num protoreflect.FieldNumber, name protoreflect.FullName) protoreflect.ProtoMessage { if m, ok := w[int32(num)]; ok { return m } @@ -53,7 +53,7 @@ func (Export) GetWeak(w WeakFields, num pref.FieldNumber, name pref.FullName) pr return mt.Zero().Interface() } -func (Export) SetWeak(w *WeakFields, num pref.FieldNumber, name pref.FullName, m pref.ProtoMessage) { +func (Export) SetWeak(w *WeakFields, num protoreflect.FieldNumber, name protoreflect.FullName, m protoreflect.ProtoMessage) { if m != nil { mt, _ := protoregistry.GlobalTypes.FindMessageByName(name) if mt == nil { diff --git a/vendor/google.golang.org/protobuf/internal/order/order.go b/vendor/google.golang.org/protobuf/internal/order/order.go index 2a24953f..33745ed0 100644 --- a/vendor/google.golang.org/protobuf/internal/order/order.go +++ b/vendor/google.golang.org/protobuf/internal/order/order.go @@ -5,12 +5,12 @@ package order import ( - pref "google.golang.org/protobuf/reflect/protoreflect" + "google.golang.org/protobuf/reflect/protoreflect" ) // FieldOrder specifies the ordering to visit message fields. // It is a function that reports whether x is ordered before y. -type FieldOrder func(x, y pref.FieldDescriptor) bool +type FieldOrder func(x, y protoreflect.FieldDescriptor) bool var ( // AnyFieldOrder specifies no specific field ordering. @@ -18,9 +18,9 @@ var ( // LegacyFieldOrder sorts fields in the same ordering as emitted by // wire serialization in the github.com/golang/protobuf implementation. - LegacyFieldOrder FieldOrder = func(x, y pref.FieldDescriptor) bool { + LegacyFieldOrder FieldOrder = func(x, y protoreflect.FieldDescriptor) bool { ox, oy := x.ContainingOneof(), y.ContainingOneof() - inOneof := func(od pref.OneofDescriptor) bool { + inOneof := func(od protoreflect.OneofDescriptor) bool { return od != nil && !od.IsSynthetic() } @@ -41,14 +41,14 @@ var ( } // NumberFieldOrder sorts fields by their field number. - NumberFieldOrder FieldOrder = func(x, y pref.FieldDescriptor) bool { + NumberFieldOrder FieldOrder = func(x, y protoreflect.FieldDescriptor) bool { return x.Number() < y.Number() } // IndexNameFieldOrder sorts non-extension fields before extension fields. // Non-extensions are sorted according to their declaration index. // Extensions are sorted according to their full name. - IndexNameFieldOrder FieldOrder = func(x, y pref.FieldDescriptor) bool { + IndexNameFieldOrder FieldOrder = func(x, y protoreflect.FieldDescriptor) bool { // Non-extension fields sort before extension fields. if x.IsExtension() != y.IsExtension() { return !x.IsExtension() && y.IsExtension() @@ -64,7 +64,7 @@ var ( // KeyOrder specifies the ordering to visit map entries. // It is a function that reports whether x is ordered before y. -type KeyOrder func(x, y pref.MapKey) bool +type KeyOrder func(x, y protoreflect.MapKey) bool var ( // AnyKeyOrder specifies no specific key ordering. @@ -72,7 +72,7 @@ var ( // GenericKeyOrder sorts false before true, numeric keys in ascending order, // and strings in lexicographical ordering according to UTF-8 codepoints. - GenericKeyOrder KeyOrder = func(x, y pref.MapKey) bool { + GenericKeyOrder KeyOrder = func(x, y protoreflect.MapKey) bool { switch x.Interface().(type) { case bool: return !x.Bool() && y.Bool() diff --git a/vendor/google.golang.org/protobuf/internal/order/range.go b/vendor/google.golang.org/protobuf/internal/order/range.go index c8090e0c..1665a68e 100644 --- a/vendor/google.golang.org/protobuf/internal/order/range.go +++ b/vendor/google.golang.org/protobuf/internal/order/range.go @@ -9,12 +9,12 @@ import ( "sort" "sync" - pref "google.golang.org/protobuf/reflect/protoreflect" + "google.golang.org/protobuf/reflect/protoreflect" ) type messageField struct { - fd pref.FieldDescriptor - v pref.Value + fd protoreflect.FieldDescriptor + v protoreflect.Value } var messageFieldPool = sync.Pool{ @@ -25,8 +25,8 @@ type ( // FieldRnger is an interface for visiting all fields in a message. // The protoreflect.Message type implements this interface. FieldRanger interface{ Range(VisitField) } - // VisitField is called everytime a message field is visited. - VisitField = func(pref.FieldDescriptor, pref.Value) bool + // VisitField is called every time a message field is visited. + VisitField = func(protoreflect.FieldDescriptor, protoreflect.Value) bool ) // RangeFields iterates over the fields of fs according to the specified order. @@ -47,7 +47,7 @@ func RangeFields(fs FieldRanger, less FieldOrder, fn VisitField) { }() // Collect all fields in the message and sort them. - fs.Range(func(fd pref.FieldDescriptor, v pref.Value) bool { + fs.Range(func(fd protoreflect.FieldDescriptor, v protoreflect.Value) bool { fields = append(fields, messageField{fd, v}) return true }) @@ -64,8 +64,8 @@ func RangeFields(fs FieldRanger, less FieldOrder, fn VisitField) { } type mapEntry struct { - k pref.MapKey - v pref.Value + k protoreflect.MapKey + v protoreflect.Value } var mapEntryPool = sync.Pool{ @@ -76,8 +76,8 @@ type ( // EntryRanger is an interface for visiting all fields in a message. // The protoreflect.Map type implements this interface. EntryRanger interface{ Range(VisitEntry) } - // VisitEntry is called everytime a map entry is visited. - VisitEntry = func(pref.MapKey, pref.Value) bool + // VisitEntry is called every time a map entry is visited. + VisitEntry = func(protoreflect.MapKey, protoreflect.Value) bool ) // RangeEntries iterates over the entries of es according to the specified order. @@ -98,7 +98,7 @@ func RangeEntries(es EntryRanger, less KeyOrder, fn VisitEntry) { }() // Collect all entries in the map and sort them. - es.Range(func(k pref.MapKey, v pref.Value) bool { + es.Range(func(k protoreflect.MapKey, v protoreflect.Value) bool { entries = append(entries, mapEntry{k, v}) return true }) diff --git a/vendor/google.golang.org/protobuf/internal/strs/strings_unsafe.go b/vendor/google.golang.org/protobuf/internal/strs/strings_unsafe.go index 56a8a4ed..fea589c4 100644 --- a/vendor/google.golang.org/protobuf/internal/strs/strings_unsafe.go +++ b/vendor/google.golang.org/protobuf/internal/strs/strings_unsafe.go @@ -10,7 +10,7 @@ package strs import ( "unsafe" - pref "google.golang.org/protobuf/reflect/protoreflect" + "google.golang.org/protobuf/reflect/protoreflect" ) type ( @@ -59,7 +59,7 @@ type Builder struct { // AppendFullName is equivalent to protoreflect.FullName.Append, // but optimized for large batches where each name has a shared lifetime. -func (sb *Builder) AppendFullName(prefix pref.FullName, name pref.Name) pref.FullName { +func (sb *Builder) AppendFullName(prefix protoreflect.FullName, name protoreflect.Name) protoreflect.FullName { n := len(prefix) + len(".") + len(name) if len(prefix) == 0 { n -= len(".") @@ -68,7 +68,7 @@ func (sb *Builder) AppendFullName(prefix pref.FullName, name pref.Name) pref.Ful sb.buf = append(sb.buf, prefix...) sb.buf = append(sb.buf, '.') sb.buf = append(sb.buf, name...) - return pref.FullName(sb.last(n)) + return protoreflect.FullName(sb.last(n)) } // MakeString is equivalent to string(b), but optimized for large batches diff --git a/vendor/google.golang.org/protobuf/internal/version/version.go b/vendor/google.golang.org/protobuf/internal/version/version.go index 3d40d524..b480c501 100644 --- a/vendor/google.golang.org/protobuf/internal/version/version.go +++ b/vendor/google.golang.org/protobuf/internal/version/version.go @@ -12,54 +12,54 @@ import ( // These constants determine the current version of this module. // -// // For our release process, we enforce the following rules: -// * Tagged releases use a tag that is identical to String. -// * Tagged releases never reference a commit where the String -// contains "devel". -// * The set of all commits in this repository where String -// does not contain "devel" must have a unique String. -// +// - Tagged releases use a tag that is identical to String. +// - Tagged releases never reference a commit where the String +// contains "devel". +// - The set of all commits in this repository where String +// does not contain "devel" must have a unique String. // // Steps for tagging a new release: -// 1. Create a new CL. // -// 2. Update Minor, Patch, and/or PreRelease as necessary. -// PreRelease must not contain the string "devel". +// 1. Create a new CL. // -// 3. Since the last released minor version, have there been any changes to -// generator that relies on new functionality in the runtime? -// If yes, then increment RequiredGenerated. +// 2. Update Minor, Patch, and/or PreRelease as necessary. +// PreRelease must not contain the string "devel". // -// 4. Since the last released minor version, have there been any changes to -// the runtime that removes support for old .pb.go source code? -// If yes, then increment SupportMinimum. +// 3. Since the last released minor version, have there been any changes to +// generator that relies on new functionality in the runtime? +// If yes, then increment RequiredGenerated. // -// 5. Send out the CL for review and submit it. -// Note that the next CL in step 8 must be submitted after this CL -// without any other CLs in-between. +// 4. Since the last released minor version, have there been any changes to +// the runtime that removes support for old .pb.go source code? +// If yes, then increment SupportMinimum. // -// 6. Tag a new version, where the tag is is the current String. +// 5. Send out the CL for review and submit it. +// Note that the next CL in step 8 must be submitted after this CL +// without any other CLs in-between. // -// 7. Write release notes for all notable changes -// between this release and the last release. +// 6. Tag a new version, where the tag is is the current String. // -// 8. Create a new CL. +// 7. Write release notes for all notable changes +// between this release and the last release. // -// 9. Update PreRelease to include the string "devel". -// For example: "" -> "devel" or "rc.1" -> "rc.1.devel" +// 8. Create a new CL. // -// 10. Send out the CL for review and submit it. +// 9. Update PreRelease to include the string "devel". +// For example: "" -> "devel" or "rc.1" -> "rc.1.devel" +// +// 10. Send out the CL for review and submit it. const ( Major = 1 Minor = 28 - Patch = 0 + Patch = 1 PreRelease = "" ) // String formats the version string for this module in semver format. // // Examples: +// // v1.20.1 // v1.21.0-rc.1 func String() string { diff --git a/vendor/google.golang.org/protobuf/proto/decode.go b/vendor/google.golang.org/protobuf/proto/decode.go index 11bf7173..48d47946 100644 --- a/vendor/google.golang.org/protobuf/proto/decode.go +++ b/vendor/google.golang.org/protobuf/proto/decode.go @@ -19,7 +19,8 @@ import ( // UnmarshalOptions configures the unmarshaler. // // Example usage: -// err := UnmarshalOptions{DiscardUnknown: true}.Unmarshal(b, m) +// +// err := UnmarshalOptions{DiscardUnknown: true}.Unmarshal(b, m) type UnmarshalOptions struct { pragma.NoUnkeyedLiterals diff --git a/vendor/google.golang.org/protobuf/proto/doc.go b/vendor/google.golang.org/protobuf/proto/doc.go index c52d8c4a..08d2a46f 100644 --- a/vendor/google.golang.org/protobuf/proto/doc.go +++ b/vendor/google.golang.org/protobuf/proto/doc.go @@ -6,18 +6,17 @@ // // For documentation on protocol buffers in general, see: // -// https://developers.google.com/protocol-buffers +// https://developers.google.com/protocol-buffers // // For a tutorial on using protocol buffers with Go, see: // -// https://developers.google.com/protocol-buffers/docs/gotutorial +// https://developers.google.com/protocol-buffers/docs/gotutorial // // For a guide to generated Go protocol buffer code, see: // -// https://developers.google.com/protocol-buffers/docs/reference/go-generated +// https://developers.google.com/protocol-buffers/docs/reference/go-generated // -// -// Binary serialization +// # Binary serialization // // This package contains functions to convert to and from the wire format, // an efficient binary serialization of protocol buffers. @@ -30,8 +29,7 @@ // • Unmarshal converts a message from the wire format. // The UnmarshalOptions type provides more control over wire unmarshaling. // -// -// Basic message operations +// # Basic message operations // // • Clone makes a deep copy of a message. // @@ -45,8 +43,7 @@ // // • CheckInitialized reports whether all required fields in a message are set. // -// -// Optional scalar constructors +// # Optional scalar constructors // // The API for some generated messages represents optional scalar fields // as pointers to a value. For example, an optional string field has the @@ -61,16 +58,14 @@ // // Optional scalar fields are only supported in proto2. // -// -// Extension accessors +// # Extension accessors // // • HasExtension, GetExtension, SetExtension, and ClearExtension // access extension field values in a protocol buffer message. // // Extension fields are only supported in proto2. // -// -// Related packages +// # Related packages // // • Package "google.golang.org/protobuf/encoding/protojson" converts messages to // and from JSON. diff --git a/vendor/google.golang.org/protobuf/proto/encode.go b/vendor/google.golang.org/protobuf/proto/encode.go index d18239c2..bf7f816d 100644 --- a/vendor/google.golang.org/protobuf/proto/encode.go +++ b/vendor/google.golang.org/protobuf/proto/encode.go @@ -16,7 +16,8 @@ import ( // MarshalOptions configures the marshaler. // // Example usage: -// b, err := MarshalOptions{Deterministic: true}.Marshal(m) +// +// b, err := MarshalOptions{Deterministic: true}.Marshal(m) type MarshalOptions struct { pragma.NoUnkeyedLiterals @@ -101,7 +102,9 @@ func (o MarshalOptions) Marshal(m Message) ([]byte, error) { // otherwise it returns a non-nil empty buffer. // // This is to assist the edge-case where user-code does the following: +// // m1.OptionalBytes, _ = proto.Marshal(m2) +// // where they expect the proto2 "optional_bytes" field to be populated // if any only if m2 is a valid message. func emptyBytesForMessage(m Message) []byte { diff --git a/vendor/google.golang.org/protobuf/proto/equal.go b/vendor/google.golang.org/protobuf/proto/equal.go index 4dba2b96..67948dd1 100644 --- a/vendor/google.golang.org/protobuf/proto/equal.go +++ b/vendor/google.golang.org/protobuf/proto/equal.go @@ -10,7 +10,7 @@ import ( "reflect" "google.golang.org/protobuf/encoding/protowire" - pref "google.golang.org/protobuf/reflect/protoreflect" + "google.golang.org/protobuf/reflect/protoreflect" ) // Equal reports whether two messages are equal. @@ -33,6 +33,10 @@ func Equal(x, y Message) bool { if x == nil || y == nil { return x == nil && y == nil } + if reflect.TypeOf(x).Kind() == reflect.Ptr && x == y { + // Avoid an expensive comparison if both inputs are identical pointers. + return true + } mx := x.ProtoReflect() my := y.ProtoReflect() if mx.IsValid() != my.IsValid() { @@ -42,14 +46,14 @@ func Equal(x, y Message) bool { } // equalMessage compares two messages. -func equalMessage(mx, my pref.Message) bool { +func equalMessage(mx, my protoreflect.Message) bool { if mx.Descriptor() != my.Descriptor() { return false } nx := 0 equal := true - mx.Range(func(fd pref.FieldDescriptor, vx pref.Value) bool { + mx.Range(func(fd protoreflect.FieldDescriptor, vx protoreflect.Value) bool { nx++ vy := my.Get(fd) equal = my.Has(fd) && equalField(fd, vx, vy) @@ -59,7 +63,7 @@ func equalMessage(mx, my pref.Message) bool { return false } ny := 0 - my.Range(func(fd pref.FieldDescriptor, vx pref.Value) bool { + my.Range(func(fd protoreflect.FieldDescriptor, vx protoreflect.Value) bool { ny++ return true }) @@ -71,7 +75,7 @@ func equalMessage(mx, my pref.Message) bool { } // equalField compares two fields. -func equalField(fd pref.FieldDescriptor, x, y pref.Value) bool { +func equalField(fd protoreflect.FieldDescriptor, x, y protoreflect.Value) bool { switch { case fd.IsList(): return equalList(fd, x.List(), y.List()) @@ -83,12 +87,12 @@ func equalField(fd pref.FieldDescriptor, x, y pref.Value) bool { } // equalMap compares two maps. -func equalMap(fd pref.FieldDescriptor, x, y pref.Map) bool { +func equalMap(fd protoreflect.FieldDescriptor, x, y protoreflect.Map) bool { if x.Len() != y.Len() { return false } equal := true - x.Range(func(k pref.MapKey, vx pref.Value) bool { + x.Range(func(k protoreflect.MapKey, vx protoreflect.Value) bool { vy := y.Get(k) equal = y.Has(k) && equalValue(fd.MapValue(), vx, vy) return equal @@ -97,7 +101,7 @@ func equalMap(fd pref.FieldDescriptor, x, y pref.Map) bool { } // equalList compares two lists. -func equalList(fd pref.FieldDescriptor, x, y pref.List) bool { +func equalList(fd protoreflect.FieldDescriptor, x, y protoreflect.List) bool { if x.Len() != y.Len() { return false } @@ -110,31 +114,31 @@ func equalList(fd pref.FieldDescriptor, x, y pref.List) bool { } // equalValue compares two singular values. -func equalValue(fd pref.FieldDescriptor, x, y pref.Value) bool { +func equalValue(fd protoreflect.FieldDescriptor, x, y protoreflect.Value) bool { switch fd.Kind() { - case pref.BoolKind: + case protoreflect.BoolKind: return x.Bool() == y.Bool() - case pref.EnumKind: + case protoreflect.EnumKind: return x.Enum() == y.Enum() - case pref.Int32Kind, pref.Sint32Kind, - pref.Int64Kind, pref.Sint64Kind, - pref.Sfixed32Kind, pref.Sfixed64Kind: + case protoreflect.Int32Kind, protoreflect.Sint32Kind, + protoreflect.Int64Kind, protoreflect.Sint64Kind, + protoreflect.Sfixed32Kind, protoreflect.Sfixed64Kind: return x.Int() == y.Int() - case pref.Uint32Kind, pref.Uint64Kind, - pref.Fixed32Kind, pref.Fixed64Kind: + case protoreflect.Uint32Kind, protoreflect.Uint64Kind, + protoreflect.Fixed32Kind, protoreflect.Fixed64Kind: return x.Uint() == y.Uint() - case pref.FloatKind, pref.DoubleKind: + case protoreflect.FloatKind, protoreflect.DoubleKind: fx := x.Float() fy := y.Float() if math.IsNaN(fx) || math.IsNaN(fy) { return math.IsNaN(fx) && math.IsNaN(fy) } return fx == fy - case pref.StringKind: + case protoreflect.StringKind: return x.String() == y.String() - case pref.BytesKind: + case protoreflect.BytesKind: return bytes.Equal(x.Bytes(), y.Bytes()) - case pref.MessageKind, pref.GroupKind: + case protoreflect.MessageKind, protoreflect.GroupKind: return equalMessage(x.Message(), y.Message()) default: return x.Interface() == y.Interface() @@ -143,7 +147,7 @@ func equalValue(fd pref.FieldDescriptor, x, y pref.Value) bool { // equalUnknown compares unknown fields by direct comparison on the raw bytes // of each individual field number. -func equalUnknown(x, y pref.RawFields) bool { +func equalUnknown(x, y protoreflect.RawFields) bool { if len(x) != len(y) { return false } @@ -151,8 +155,8 @@ func equalUnknown(x, y pref.RawFields) bool { return true } - mx := make(map[pref.FieldNumber]pref.RawFields) - my := make(map[pref.FieldNumber]pref.RawFields) + mx := make(map[protoreflect.FieldNumber]protoreflect.RawFields) + my := make(map[protoreflect.FieldNumber]protoreflect.RawFields) for len(x) > 0 { fnum, _, n := protowire.ConsumeField(x) mx[fnum] = append(mx[fnum], x[:n]...) diff --git a/vendor/google.golang.org/protobuf/reflect/protodesc/desc_resolve.go b/vendor/google.golang.org/protobuf/reflect/protodesc/desc_resolve.go index cebb36cd..27d7e350 100644 --- a/vendor/google.golang.org/protobuf/reflect/protodesc/desc_resolve.go +++ b/vendor/google.golang.org/protobuf/reflect/protodesc/desc_resolve.go @@ -155,9 +155,9 @@ func (r *resolver) findTarget(k protoreflect.Kind, scope protoreflect.FullName, // // Suppose the scope was "fizz.buzz" and the reference was "Foo.Bar", // then the following full names are searched: -// * fizz.buzz.Foo.Bar -// * fizz.Foo.Bar -// * Foo.Bar +// - fizz.buzz.Foo.Bar +// - fizz.Foo.Bar +// - Foo.Bar func (r *resolver) findDescriptor(scope protoreflect.FullName, ref partialName) (protoreflect.Descriptor, error) { if !ref.IsValid() { return nil, errors.New("invalid name reference: %q", ref) diff --git a/vendor/google.golang.org/protobuf/reflect/protoreflect/proto.go b/vendor/google.golang.org/protobuf/reflect/protoreflect/proto.go index dd85915b..55aa1492 100644 --- a/vendor/google.golang.org/protobuf/reflect/protoreflect/proto.go +++ b/vendor/google.golang.org/protobuf/reflect/protoreflect/proto.go @@ -8,8 +8,7 @@ // defined in proto source files and value interfaces which provide the // ability to examine and manipulate the contents of messages. // -// -// Protocol Buffer Descriptors +// # Protocol Buffer Descriptors // // Protobuf descriptors (e.g., EnumDescriptor or MessageDescriptor) // are immutable objects that represent protobuf type information. @@ -26,8 +25,7 @@ // The "google.golang.org/protobuf/reflect/protodesc" package converts between // google.protobuf.DescriptorProto messages and protobuf descriptors. // -// -// Go Type Descriptors +// # Go Type Descriptors // // A type descriptor (e.g., EnumType or MessageType) is a constructor for // a concrete Go type that represents the associated protobuf descriptor. @@ -41,8 +39,7 @@ // The "google.golang.org/protobuf/types/dynamicpb" package can be used to // create Go type descriptors from protobuf descriptors. // -// -// Value Interfaces +// # Value Interfaces // // The Enum and Message interfaces provide a reflective view over an // enum or message instance. For enums, it provides the ability to retrieve @@ -55,13 +52,11 @@ // The "github.com/golang/protobuf/proto".MessageReflect function can be used // to obtain a reflective view on older messages. // -// -// Relationships +// # Relationships // // The following diagrams demonstrate the relationships between // various types declared in this package. // -// // ┌───────────────────────────────────┐ // V │ // ┌────────────── New(n) ─────────────┐ │ @@ -83,7 +78,6 @@ // // • An Enum is a concrete enum instance. Generated enums implement Enum. // -// // ┌──────────────── New() ─────────────────┐ // │ │ // │ ┌─── Descriptor() ─────┐ │ ┌── Interface() ───┐ @@ -98,12 +92,22 @@ // // • A MessageType describes a concrete Go message type. // It has a MessageDescriptor and can construct a Message instance. +// Just as how Go's reflect.Type is a reflective description of a Go type, +// a MessageType is a reflective description of a Go type for a protobuf message. // // • A MessageDescriptor describes an abstract protobuf message type. +// It has no understanding of Go types. In order to construct a MessageType +// from just a MessageDescriptor, you can consider looking up the message type +// in the global registry using protoregistry.GlobalTypes.FindMessageByName +// or constructing a dynamic MessageType using dynamicpb.NewMessageType. // -// • A Message is a concrete message instance. Generated messages implement -// ProtoMessage, which can convert to/from a Message. -// +// • A Message is a reflective view over a concrete message instance. +// Generated messages implement ProtoMessage, which can convert to a Message. +// Just as how Go's reflect.Value is a reflective view over a Go value, +// a Message is a reflective view over a concrete protobuf message instance. +// Using Go reflection as an analogy, the ProtoReflect method is similar to +// calling reflect.ValueOf, and the Message.Interface method is similar to +// calling reflect.Value.Interface. // // ┌── TypeDescriptor() ──┐ ┌───── Descriptor() ─────┐ // │ V │ V diff --git a/vendor/google.golang.org/protobuf/reflect/protoreflect/source.go b/vendor/google.golang.org/protobuf/reflect/protoreflect/source.go index 121ba3a0..0b994288 100644 --- a/vendor/google.golang.org/protobuf/reflect/protoreflect/source.go +++ b/vendor/google.golang.org/protobuf/reflect/protoreflect/source.go @@ -87,6 +87,7 @@ func (p1 SourcePath) Equal(p2 SourcePath) bool { // in a future version of this module. // // Example output: +// // .message_type[6].nested_type[15].field[3] func (p SourcePath) String() string { b := p.appendFileDescriptorProto(nil) diff --git a/vendor/google.golang.org/protobuf/reflect/protoreflect/type.go b/vendor/google.golang.org/protobuf/reflect/protoreflect/type.go index 8e53c44a..3867470d 100644 --- a/vendor/google.golang.org/protobuf/reflect/protoreflect/type.go +++ b/vendor/google.golang.org/protobuf/reflect/protoreflect/type.go @@ -480,6 +480,7 @@ type ExtensionDescriptors interface { // relative to the parent that it is declared within. // // For example: +// // syntax = "proto2"; // package example; // message FooMessage { diff --git a/vendor/google.golang.org/protobuf/reflect/protoreflect/value_union.go b/vendor/google.golang.org/protobuf/reflect/protoreflect/value_union.go index eb7764c3..ca8e28c5 100644 --- a/vendor/google.golang.org/protobuf/reflect/protoreflect/value_union.go +++ b/vendor/google.golang.org/protobuf/reflect/protoreflect/value_union.go @@ -50,6 +50,7 @@ import ( // always references the source object. // // For example: +// // // Append a 0 to a "repeated int32" field. // // Since the Value returned by Mutable is guaranteed to alias // // the source message, modifying the Value modifies the message. @@ -392,6 +393,7 @@ func (v Value) MapKey() MapKey { // ╚═════════╧═════════════════════════════════════╝ // // A MapKey is constructed and accessed through a Value: +// // k := ValueOf("hash").MapKey() // convert string to MapKey // s := k.String() // convert MapKey to string // diff --git a/vendor/google.golang.org/protobuf/reflect/protoregistry/registry.go b/vendor/google.golang.org/protobuf/reflect/protoregistry/registry.go index 59f024c4..58352a69 100644 --- a/vendor/google.golang.org/protobuf/reflect/protoregistry/registry.go +++ b/vendor/google.golang.org/protobuf/reflect/protoregistry/registry.go @@ -30,9 +30,11 @@ import ( // conflictPolicy configures the policy for handling registration conflicts. // // It can be over-written at compile time with a linker-initialized variable: +// // go build -ldflags "-X google.golang.org/protobuf/reflect/protoregistry.conflictPolicy=warn" // // It can be over-written at program execution with an environment variable: +// // GOLANG_PROTOBUF_REGISTRATION_CONFLICT=warn ./main // // Neither of the above are covered by the compatibility promise and diff --git a/vendor/google.golang.org/protobuf/runtime/protoimpl/version.go b/vendor/google.golang.org/protobuf/runtime/protoimpl/version.go index ff094e1b..a105cb23 100644 --- a/vendor/google.golang.org/protobuf/runtime/protoimpl/version.go +++ b/vendor/google.golang.org/protobuf/runtime/protoimpl/version.go @@ -26,16 +26,19 @@ const ( // EnforceVersion is used by code generated by protoc-gen-go // to statically enforce minimum and maximum versions of this package. // A compilation failure implies either that: -// * the runtime package is too old and needs to be updated OR -// * the generated code is too old and needs to be regenerated. +// - the runtime package is too old and needs to be updated OR +// - the generated code is too old and needs to be regenerated. // // The runtime package can be upgraded by running: +// // go get google.golang.org/protobuf // // The generated code can be regenerated by running: +// // protoc --go_out=${PROTOC_GEN_GO_ARGS} ${PROTO_FILES} // // Example usage by generated code: +// // const ( // // Verify that this generated code is sufficiently up-to-date. // _ = protoimpl.EnforceVersion(genVersion - protoimpl.MinVersion) @@ -49,6 +52,7 @@ const ( type EnforceVersion uint // This enforces the following invariant: +// // MinVersion ≤ GenVersion ≤ MaxVersion const ( _ = EnforceVersion(GenVersion - MinVersion) diff --git a/vendor/google.golang.org/protobuf/types/known/fieldmaskpb/field_mask.pb.go b/vendor/google.golang.org/protobuf/types/known/fieldmaskpb/field_mask.pb.go index 7f94443d..1b2085d4 100644 --- a/vendor/google.golang.org/protobuf/types/known/fieldmaskpb/field_mask.pb.go +++ b/vendor/google.golang.org/protobuf/types/known/fieldmaskpb/field_mask.pb.go @@ -394,7 +394,7 @@ func numValidPaths(m proto.Message, paths []string) int { // Identify the next message to search within. md = fd.Message() // may be nil - // Repeated fields are only allowed at the last postion. + // Repeated fields are only allowed at the last position. if fd.IsList() || fd.IsMap() { md = nil } diff --git a/vendor/modules.txt b/vendor/modules.txt index 20807476..8072ffd6 100644 --- a/vendor/modules.txt +++ b/vendor/modules.txt @@ -1,13 +1,14 @@ -# github.com/BurntSushi/toml v0.3.1 -## explicit +# github.com/BurntSushi/toml v1.2.0 +## explicit; go 1.16 github.com/BurntSushi/toml +github.com/BurntSushi/toml/internal # github.com/apparentlymart/go-cidr v1.1.0 ## explicit github.com/apparentlymart/go-cidr/cidr # github.com/beorn7/perks v1.0.1 ## explicit; go 1.11 github.com/beorn7/perks/quantile -# github.com/certifi/gocertifi v0.0.0-20200211180108-c7c1fbc02894 +# github.com/certifi/gocertifi v0.0.0-20210507211836-431795d63e8d ## explicit; go 1.12 github.com/certifi/gocertifi # github.com/cespare/xxhash/v2 v2.1.2 @@ -113,9 +114,16 @@ github.com/flynn/go-shlex # github.com/fsnotify/fsnotify v1.4.9 ## explicit; go 1.13 github.com/fsnotify/fsnotify -# github.com/getsentry/raven-go v0.0.0-20180517221441-ed7bcb39ff10 +# github.com/getsentry/raven-go v0.2.0 ## explicit github.com/getsentry/raven-go +# github.com/getsentry/sentry-go v0.16.0 +## explicit; go 1.19 +github.com/getsentry/sentry-go +github.com/getsentry/sentry-go/internal/debug +github.com/getsentry/sentry-go/internal/otel/baggage +github.com/getsentry/sentry-go/internal/otel/baggage/internal/baggage +github.com/getsentry/sentry-go/internal/ratelimit # github.com/go-logr/logr v1.2.3 ## explicit; go 1.16 github.com/go-logr/logr @@ -200,11 +208,11 @@ github.com/marten-seemann/qtls-go1-18 # github.com/marten-seemann/qtls-go1-19 v0.1.0-beta.1 => github.com/cloudflare/qtls-pq v0.0.0-20230103171656-05e84f90909e ## explicit; go 1.19 github.com/marten-seemann/qtls-go1-19 -# github.com/mattn/go-colorable v0.1.8 -## explicit; go 1.13 +# github.com/mattn/go-colorable v0.1.13 +## explicit; go 1.15 github.com/mattn/go-colorable -# github.com/mattn/go-isatty v0.0.12 -## explicit; go 1.12 +# github.com/mattn/go-isatty v0.0.16 +## explicit; go 1.15 github.com/mattn/go-isatty # github.com/matttproud/golang_protobuf_extensions v1.0.1 ## explicit @@ -412,6 +420,12 @@ golang.org/x/sys/windows/svc/mgr golang.org/x/term # golang.org/x/text v0.5.0 ## explicit; go 1.17 +golang.org/x/text/cases +golang.org/x/text/internal +golang.org/x/text/internal/language +golang.org/x/text/internal/language/compact +golang.org/x/text/internal/tag +golang.org/x/text/language golang.org/x/text/secure/bidirule golang.org/x/text/transform golang.org/x/text/unicode/bidi @@ -501,7 +515,7 @@ google.golang.org/grpc/serviceconfig google.golang.org/grpc/stats google.golang.org/grpc/status google.golang.org/grpc/tap -# google.golang.org/protobuf v1.28.0 +# google.golang.org/protobuf v1.28.1 ## explicit; go 1.11 google.golang.org/protobuf/encoding/protojson google.golang.org/protobuf/encoding/prototext