curben
/
phishing-filter
mirror of https://gitlab.com/malware-filter/phishing-filter
1
0
Fork 0
Code Issues Releases Wiki Activity
phishing-filter/dist/phishing-filter-ag.txt

8367 lines
403 KiB
Plaintext
Raw Normal View History

feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
! Title: Phishing URL Blocklist (AdGuard)
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
! Updated: Mon, 27 Sep 2021 12:01:59 +0000
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
! Expires: 1 day (update frequency)
Filter updated: Thu, 31 Dec 2020 00:06:14 UTC
2020-12-31 00:06:15 +00:00
! Homepage: https://gitlab.com/curben/phishing-filter
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
! License: https://gitlab.com/curben/phishing-filter#license
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
! Source: https://www.phishtank.com/ & https://openphish.com/
Filter updated: Fri, 02 Apr 2021 12:06:43 UTC
2021-04-02 12:06:43 +00:00
! Notice: https://curben.gitlab.io/phishing-filter-mirror is moved to https://curben.gitlab.io/malware-filter
Filter updated: Sat, 22 May 2021 12:07:44 UTC
2021-05-22 12:07:44 +00:00
||000098.ihostfull.com$all
Filter updated: Sun, 15 Aug 2021 00:01:57 +0000
2021-08-15 00:01:57 +00:00
||006.zzz.com.ua$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||00hw1.mjt.lu$all
Filter updated: Fri, 13 Aug 2021 00:01:48 +0000
2021-08-13 00:01:48 +00:00
||0103023segurity.byethost14.com$all
Filter updated: Sat, 20 Feb 2021 00:06:47 UTC
2021-02-20 00:06:47 +00:00
||02-billing-support.org$all
Filter updated: Tue, 01 Jun 2021 00:06:26 UTC
2021-06-01 00:06:26 +00:00
||036.trendsbygwen.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||045a3c0.wcomhost.com/ameli-assurance/remboursement/login/$all
||045a3c0.wcomhost.com/ameli-assurance/remboursement/login/iframe-page2.html$all
Filter updated: Tue, 07 Sep 2021 00:01:46 +0000
2021-09-07 00:01:46 +00:00
||048618c.netsolhost.com/chase/secure.php?8f377965d91a85323ff298d1521c290f=$all
Filter updated: Wed, 15 Sep 2021 12:01:46 +0000
2021-09-15 12:01:46 +00:00
||0492d3a.wcomhost.com/ameli-assurance/vos-remboursements/portailas/$all
Filter updated: Tue, 14 Sep 2021 00:01:48 +0000
2021-09-14 00:01:48 +00:00
||06btevocale.qlihost.ru$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||07dd96.htmlcomponentservice.com$all
Filter updated: Fri, 24 Sep 2021 00:01:50 +0000
2021-09-24 00:01:51 +00:00
||0941ce23b87674e83d9a5ccbd65b9fe5-dot-goff039302032323.rj.r.appspot.com$all
Filter updated: Tue, 07 Sep 2021 12:01:49 +0000
2021-09-07 12:01:49 +00:00
||0bs.de$all
Filter updated: Wed, 18 Aug 2021 00:01:50 +0000
2021-08-18 00:01:50 +00:00
||0ddbdb7c8f4432481.temporary.link$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||0f243f4a77683abfc0e2cad4fe6570d63eaca83e.000webhostapp.com$all
Filter updated: Fri, 03 Sep 2021 12:01:48 +0000
2021-09-03 12:01:48 +00:00
||0faa1bbe3578b9623adc96038420d8e6-dot-goff039302032323.rj.r.appspot.com$all
Filter updated: Sat, 28 Aug 2021 00:33:51 +0000
2021-08-28 00:33:51 +00:00
||0i.is$all
Filter updated: Fri, 30 Jul 2021 12:01:52 +0000
2021-07-30 12:01:52 +00:00
||0tnr44.stat-pulse.com$all
Filter updated: Wed, 12 May 2021 00:06:26 UTC
2021-05-12 00:06:26 +00:00
||0xpnkh.raphitari.com$all
Filter updated: Fri, 10 Sep 2021 00:02:17 +0000
2021-09-10 00:02:17 +00:00
||1.shacky6tens.one$all
Filter updated: Mon, 28 Jun 2021 12:06:20 +0000
2021-06-28 12:06:20 +00:00
||101.32.192.174$all
Filter updated: Wed, 16 Jun 2021 00:06:45 +0000
2021-06-16 00:06:45 +00:00
||102update1.creatorlink.net$all
Filter updated: Wed, 20 Jan 2021 12:06:49 UTC
2021-01-20 12:06:49 +00:00
||103.114.16.4$all
Filter updated: Sat, 31 Oct 2020 12:06:36 UTC
2020-10-31 12:06:36 +00:00
||104.168.173.244$all
Filter updated: Thu, 15 Oct 2020 12:06:30 UTC
2020-10-15 12:06:30 +00:00
||104.168.173.248$all
Filter updated: Tue, 20 Jul 2021 12:01:48 +0000
2021-07-20 12:01:48 +00:00
||104thphoenix.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||106.12.192.247$all
Filter updated: Sun, 04 Jul 2021 00:02:10 +0000
2021-07-04 00:02:10 +00:00
||107.172.198.119$all
Filter updated: Sun, 15 Aug 2021 00:01:57 +0000
2021-08-15 00:01:57 +00:00
||10bet.com/sports-betting-bonus/?siteid=50538$all
Filter updated: Mon, 20 Sep 2021 12:02:05 +0000
2021-09-20 12:02:05 +00:00
||10xdoge.org$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||113.125.21.66$all
Filter updated: Mon, 28 Jun 2021 12:06:20 +0000
2021-06-28 12:06:20 +00:00
||119.28.91.122$all
Filter updated: Wed, 18 Aug 2021 12:02:35 +0000
2021-08-18 12:02:36 +00:00
||119.8.55.19$all
Filter updated: Thu, 13 May 2021 00:06:46 UTC
2021-05-13 00:06:46 +00:00
||11bp7.trk.elasticemail.com$all
Filter updated: Tue, 09 Feb 2021 12:06:34 UTC
2021-02-09 12:06:34 +00:00
||11dbs.com$all
Filter updated: Thu, 29 Jul 2021 00:01:57 +0000
2021-07-29 00:01:57 +00:00
||11owd.trk.elasticemail.com$all
Filter updated: Thu, 19 Aug 2021 00:01:47 +0000
2021-08-19 00:01:47 +00:00
||11wgz.trk.elasticemail.com$all
Filter updated: Wed, 15 Sep 2021 00:01:54 +0000
2021-09-15 00:01:55 +00:00
||121techyard.com$all
Filter updated: Tue, 27 Jul 2021 00:02:10 +0000
2021-07-27 00:02:10 +00:00
||122zh.trk.elasticemail.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||123formbuilder.com/form-5134768/serra-es$all
||123formbuilder.com/form-5220557/$all
Filter updated: Sun, 13 Sep 2020 00:07:18 UTC
2020-09-13 00:07:18 +00:00
||123formbuilder.com/form-5559915/microsoft-team$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||123formbuilder.com/form-5578660/form$all
Filter updated: Mon, 28 Jun 2021 12:06:20 +0000
2021-06-28 12:06:20 +00:00
||124.156.136.189$all
Filter updated: Fri, 03 Sep 2021 00:01:54 +0000
2021-09-03 00:01:55 +00:00
||1249d4d7.6u56u665y6h45g45tg3.pages.dev$all
Filter updated: Thu, 29 Jul 2021 00:01:57 +0000
2021-07-29 00:01:57 +00:00
||124wi.trk.elasticemail.com$all
Filter updated: Wed, 18 Aug 2021 00:01:50 +0000
2021-08-18 00:01:50 +00:00
||127qs.trk.elasticemail.com$all
Filter updated: Tue, 17 Aug 2021 00:02:45 +0000
2021-08-17 00:02:45 +00:00
||12a1j.trk.elasticemail.com$all
Filter updated: Thu, 02 Sep 2021 12:02:02 +0000
2021-09-02 12:02:02 +00:00
||12fmu.trk.elasticemail.com$all
Filter updated: Thu, 26 Aug 2021 00:02:01 +0000
2021-08-26 00:02:01 +00:00
||12gxe.trk.elasticemail.com$all
Filter updated: Tue, 07 Sep 2021 00:01:46 +0000
2021-09-07 00:01:46 +00:00
||12jnv.trk.elasticemail.com$all
Filter updated: Fri, 03 Sep 2021 12:01:48 +0000
2021-09-03 12:01:48 +00:00
||12jz9.trk.elasticemail.com$all
Filter updated: Tue, 07 Sep 2021 00:01:46 +0000
2021-09-07 00:01:46 +00:00
||12lb1.trk.elasticemail.com$all
Filter updated: Thu, 09 Sep 2021 00:01:56 +0000
2021-09-09 00:01:56 +00:00
||12lk2.trk.elasticemail.com$all
Filter updated: Fri, 10 Sep 2021 12:02:02 +0000
2021-09-10 12:02:02 +00:00
||12mak.trk.elasticemail.com$all
Filter updated: Sat, 11 Sep 2021 00:34:15 +0000
2021-09-11 00:34:15 +00:00
||12mo7.trk.elasticemail.com$all
||12mob.trk.elasticemail.com$all
Filter updated: Thu, 16 Sep 2021 12:02:15 +0000
2021-09-16 12:02:15 +00:00
||12oei.trk.elasticemail.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||130.211.30.154$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||132-226-117-122.cprapid.com$all
Filter updated: Tue, 27 Jul 2021 00:02:10 +0000
2021-07-27 00:02:10 +00:00
||132artisan.lavanup.com$all
Filter updated: Mon, 30 Aug 2021 00:02:03 +0000
2021-08-30 00:02:03 +00:00
||13721372.32304ey.ninishop.org$all
Filter updated: Thu, 03 Sep 2020 12:06:37 UTC
2020-09-03 12:06:37 +00:00
||14.63.195.13$all
Filter updated: Thu, 10 Jun 2021 00:06:48 UTC
2021-06-10 00:06:48 +00:00
||140.trendsbygwen.com$all
Filter updated: Tue, 21 Sep 2021 00:01:40 +0000
2021-09-21 00:01:40 +00:00
||141.118.125.34.bc.googleusercontent.com/sms/?=/internetbanking.caixa.gov.br/renovar/=assinatura/eletronica#$all
||141.118.125.34.bc.googleusercontent.com/sms/?=/internetbanking.caixa.gov.br/renovar/=assinatura/eletronica$all
||141.118.125.34.bc.googleusercontent.com/sms/?=/internetbanking.caixa.gov.br/renovar/=assinatura/eletronica/$all
||141.118.125.34.bc.googleusercontent.com/sms/?=/internetbanking.caixa.gov.br/renovar/=assinatura/eletronica0$all
||141.118.125.34.bc.googleusercontent.com/sms/?=/internetbanking.caixa.gov.br/renovar/=assinatura/eletronica1$all
||141.118.125.34.bc.googleusercontent.com/sms/?=/internetbanking.caixa.gov.br/renovar/=assinatura/eletronica2$all
||141.118.125.34.bc.googleusercontent.com/sms/?=/internetbanking.caixa.gov.br/renovar/=assinatura/eletronica3$all
||141.118.125.34.bc.googleusercontent.com/sms/?=/internetbanking.caixa.gov.br/renovar/=assinatura/eletronicaa$all
||141.118.125.34.bc.googleusercontent.com/sms/?=/internetbanking.caixa.gov.br/renovar/=assinatura/eletronican$all
||141.118.125.34.bc.googleusercontent.com/sms/?=/internetbanking.caixa.gov.br/renovar/=assinatura/eletronicax$all
||141.118.125.34.bc.googleusercontent.com/sms/?=/internetbanking.caixa.gov.br/renovar/=assinatura/eletronicm$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||141.164.50.243$all
Filter updated: Mon, 20 Sep 2021 00:01:41 +0000
2021-09-20 00:01:41 +00:00
||148.72.157.11$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||149.210.143.165$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||154.30.211.130.bc.googleusercontent.com$all
Filter updated: Sun, 05 Sep 2021 12:01:36 +0000
2021-09-05 12:01:37 +00:00
||157.240.18.15/?id=http://www.cdph.ca.gov/programs/chcq/lcp/pages/afl-20-33.aspx&fields=og_object{engagement}&callback=_ate.cbs.rcb_fiqs0$all
||157.240.18.35/?_fb_noscript=1$all
Filter updated: Wed, 25 Nov 2020 12:06:48 UTC
2020-11-25 12:06:48 +00:00
||157.240.194.18$all
||157.240.194.35$all
Filter updated: Sun, 05 Sep 2021 12:01:36 +0000
2021-09-05 12:01:37 +00:00
||157.240.22.35/?_fb_noscript=1$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||159.203.115.201$all
||159.65.133.234$all
Filter updated: Tue, 07 Sep 2021 00:01:46 +0000
2021-09-07 00:01:46 +00:00
||164.145.95.34.bc.googleusercontent.com/atualizacao/sinbc/?auth=e0oweiqzvazs3fkdtebmh5bsrdwyh7blk4jczvxonru8ik0igqfvatjouosiidz3pabeg93llcoeejyqxdrtxlyjcbzp6yfk4yssz3cogt8amdqbvgkt0hf46dmz28adsiiki3rm6jcsxw88ay9hvw$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||165.22.103.235$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||167.86.94.52$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||172.217.21.162$all
Filter updated: Sat, 11 Sep 2021 12:01:27 +0000
2021-09-11 12:01:27 +00:00
||172.86.125.196$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||173.212.239.242$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||173.232.146.126$all
Filter updated: Fri, 16 Jul 2021 12:01:57 +0000
2021-07-16 12:01:57 +00:00
||176.121.14.53$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||17896-2008.s1.webspace.re$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||179.43.140.147$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||180betper.blogspot.com$all
Filter updated: Sat, 21 Aug 2021 00:01:53 +0000
2021-08-21 00:01:54 +00:00
||183709ef9b6572a103f79032b1586b81-dot-goff039302032323.rj.r.appspot.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||185.177.54.1$all
||185.177.54.2$all
||185.177.54.9$all
Filter updated: Wed, 09 Jun 2021 00:06:30 UTC
2021-06-09 00:06:31 +00:00
||18614247159c.byethost24.com$all
Filter updated: Tue, 21 Sep 2021 00:01:40 +0000
2021-09-21 00:01:40 +00:00
||188.166.40.187$all
Filter updated: Wed, 22 Sep 2021 12:01:56 +0000
2021-09-22 12:01:56 +00:00
||188.225.40.227$all
Filter updated: Sat, 18 Sep 2021 12:01:34 +0000
2021-09-18 12:01:34 +00:00
||188.93.233.68$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||188elexusbet.blogspot.com$all
Filter updated: Mon, 23 Nov 2020 12:06:43 UTC
2020-11-23 12:06:44 +00:00
||190854.8b.io$all
Filter updated: Tue, 22 Jun 2021 00:06:28 +0000
2021-06-22 00:06:29 +00:00
||192.210.243.179$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||193.135.153.242$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||1artemisbet.blogspot.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||1dom.club$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||1drv.ms/b/s!auksoo1k68f1grbxbhid1sl-ye8w$all
||1drv.ms/o/s!asdoqhdzchzkceksme1zxz0tbys$all
Filter updated: Fri, 27 Aug 2021 12:01:40 +0000
2021-08-27 12:01:40 +00:00
||1drv.ms/o/s!bdl5r1ki9tc3gqvi-1haort04ahz?e=2lalmxflvewx2tjousf09g&at=9$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||1drv.ms/o/s!biwi80oasoewgxoqavzz0prwohuk?e=c-d9fhgd9ue1qswmmond5w&at=9$all
Filter updated: Tue, 10 Aug 2021 12:02:08 +0000
2021-08-10 12:02:08 +00:00
||1drv.ms/u/s!akaql-drpuriguznqx6yfuzunc_ava?e=woq9jy$all
Filter updated: Tue, 23 Mar 2021 12:16:28 UTC
2021-03-23 12:16:28 +00:00
||1drv.ms/u/s!aklt5-l7t4i2xvktl7g9mdgfcknm?e=cfngyw$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||1drv.ms/u/s!aqzh3mzuvkddmbmdyu98fbfw9doy?e=mdjorx$all
||1drv.ms/u/s!auzzdh9o3pd3cutlhnbnixde2iu?e=bypust$all
||1drv.ms/u/s!avhfkscca3-jeadxnym7-7yxw9g?e=o7d49o$all
||1drv.ms/w/s!aguoqd84zse3gt7r1mqpd90amvv3$all
||1drv.ms/w/s!at6abcmxoqeqgrrahazju3fo1ojj$all
||1drv.ms/xs/s!am4xl7rvugywaxod-4xmpezy4mk?wdformid=%7ba1c5478a-c065-4b6f-b415-c1a0973f4392%7d$all
||1drv.ms/xs/s!am4xl7rvugywaxod-4xmpezy4mk?wdformid=%7ba1c5478a-c065-4b6f-b415-c1a0973f4392%7d%3e$all
Filter updated: Thu, 25 Feb 2021 12:07:26 UTC
2021-02-25 12:07:26 +00:00
||1inich.exchange$all
Filter updated: Tue, 20 Jul 2021 12:01:48 +0000
2021-07-20 12:01:48 +00:00
||1m5yp.csb.app$all
Filter updated: Sat, 19 Jun 2021 12:06:28 +0000
2021-06-19 12:06:28 +00:00
||1millionnfts.art$all
Filter updated: Mon, 19 Apr 2021 12:07:09 UTC
2021-04-19 12:07:09 +00:00
||1ncih.exchange$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||1ogin-microsoftqinpbfhejkkpbeq-furdxysscvftlnjd-qfcrydbfrcbsfso.netlify.app$all
Filter updated: Mon, 17 May 2021 00:06:19 UTC
2021-05-17 00:06:19 +00:00
||1onlinebancogalicia.vzpla.net$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||1repair.co.uk$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||1sultanbet.blogspot.com$all
Filter updated: Thu, 09 Sep 2021 00:01:56 +0000
2021-09-09 00:01:56 +00:00
||1und1center.tumblr.com$all
Filter updated: Wed, 25 Aug 2021 12:02:06 +0000
2021-08-25 12:02:07 +00:00
||1w5v7.weblium.site$all
Filter updated: Thu, 03 Sep 2020 12:06:37 UTC
2020-09-03 12:06:37 +00:00
||2.136.95.251$all
Filter updated: Tue, 21 Sep 2021 00:01:40 +0000
2021-09-21 00:01:40 +00:00
||20.90.154.8$all
Filter updated: Tue, 18 May 2021 00:06:34 UTC
2021-05-18 00:06:34 +00:00
||2021attintellectualproperty.webflow.io$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||204.44.71.206$all
Filter updated: Wed, 25 Nov 2020 00:06:21 UTC
2020-11-25 00:06:21 +00:00
||205.204.101.13$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||206.189.85.218$all
||208.82.115.230$all
||209.97.188.25$all
Filter updated: Fri, 06 Aug 2021 00:01:52 +0000
2021-08-06 00:01:52 +00:00
||21234.ultimatefreehost.in$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||212897764576871473832-dot-bn058.csb.app$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||217.151.153.188$all
Filter updated: Mon, 18 Jan 2021 12:06:33 UTC
2021-01-18 12:06:33 +00:00
||217651.8b.io$all
Filter updated: Mon, 06 Sep 2021 12:01:50 +0000
2021-09-06 12:01:50 +00:00
||218.220.125.34.bc.googleusercontent.com/sms/?hash=renovar%202021%20sms$all
Filter updated: Thu, 12 Nov 2020 12:06:49 UTC
2020-11-12 12:06:49 +00:00
||222.231.3.128$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||22222.leissx2.com$all
Filter updated: Thu, 27 May 2021 12:06:26 UTC
2021-05-27 12:06:26 +00:00
||222289.ihostfull.com$all
Filter updated: Sat, 29 May 2021 00:06:23 UTC
2021-05-29 00:06:23 +00:00
||23341.ihostfull.com$all
Filter updated: Tue, 14 Sep 2021 12:01:44 +0000
2021-09-14 12:01:44 +00:00
||24-gb.blogspot.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||2482689012.yolasite.com$all
Filter updated: Wed, 10 Mar 2021 12:10:46 UTC
2021-03-10 12:10:46 +00:00
||24a69f75.orson.website$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||24yrs.com$all
Filter updated: Fri, 03 Sep 2021 00:01:54 +0000
2021-09-03 00:01:55 +00:00
||2524santan-d-er0.hostfree.pw$all
Filter updated: Tue, 29 Sep 2020 00:06:27 UTC
2020-09-29 00:06:27 +00:00
||25tnr.app.link$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||26042d80911e3100dc5c1fc96a634183.s3.eu-west-1.amazonaws.com$all
Filter updated: Fri, 30 Jul 2021 12:01:52 +0000
2021-07-30 12:01:52 +00:00
||264js.skipdns.link$all
Filter updated: Mon, 19 Apr 2021 12:07:09 UTC
2021-04-19 12:07:09 +00:00
||299kensingtonroad.my.webex.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||2fa.bthei.com$all
Filter updated: Fri, 09 Jul 2021 00:01:59 +0000
2021-07-09 00:01:59 +00:00
||2ffth.csb.app$all
Filter updated: Sat, 18 Sep 2021 00:14:48 +0000
2021-09-18 00:14:48 +00:00
||2muoqba.000webhostapp.com$all
Filter updated: Thu, 29 Jul 2021 00:01:57 +0000
2021-07-29 00:01:57 +00:00
||2na.io$all
Filter updated: Thu, 09 Sep 2021 12:02:27 +0000
2021-09-09 12:02:27 +00:00
||2pil.ru$all
Filter updated: Wed, 05 May 2021 12:12:51 UTC
2021-05-05 12:12:51 +00:00
||2qibxad421.site44.com$all
Filter updated: Fri, 30 Jul 2021 12:01:52 +0000
2021-07-30 12:01:52 +00:00
||2qnzq.skipdns.link$all
Filter updated: Sat, 04 Sep 2021 00:17:00 +0000
2021-09-04 00:17:00 +00:00
||2wnrlyj.xyz$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||30v0jdqba94.typeform.com$all
Filter updated: Wed, 21 Oct 2020 12:06:42 UTC
2020-10-21 12:06:42 +00:00
||30ywc.codesandbox.io$all
Filter updated: Wed, 25 Nov 2020 12:06:48 UTC
2020-11-25 12:06:48 +00:00
||31.13.71.1$all
Filter updated: Sat, 29 May 2021 00:06:23 UTC
2021-05-29 00:06:23 +00:00
||31134.ihostfull.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||31jan.page.link$all
Filter updated: Tue, 10 Aug 2021 00:01:49 +0000
2021-08-10 00:01:49 +00:00
||32541514546544.hyperphp.com$all
Filter updated: Tue, 21 Sep 2021 00:01:40 +0000
2021-09-21 00:01:40 +00:00
||34.76.47.182$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||3456654456765.hyperphp.com$all
||3456765434.hyperphp.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||35.186.228.86$all
||35.199.84.117$all
Filter updated: Fri, 13 Aug 2021 00:01:48 +0000
2021-08-13 00:01:48 +00:00
||3541164541541445.hyperphp.com$all
Filter updated: Fri, 24 Sep 2021 00:01:50 +0000
2021-09-24 00:01:51 +00:00
||366486d4d9b41b8ed89201b3f4bc4cd9-dot-goff039302032323.rj.r.appspot.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||377080202567359722137708020256735972.blogspot.com/?m=0%5c$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||3782365.com$all
Filter updated: Fri, 29 Jan 2021 00:06:14 UTC
2021-01-29 00:06:14 +00:00
||386f9e87.ithemeshosting.com.php73-39.lan3-1.websitetestlink.com$all
Filter updated: Sat, 04 Sep 2021 00:17:00 +0000
2021-09-04 00:17:00 +00:00
||38awdrt.xyz$all
Filter updated: Tue, 31 Aug 2021 00:01:55 +0000
2021-08-31 00:01:55 +00:00
||3a10a178.s6t6sj4s46tu4sys54y5.pages.dev$all
Filter updated: Tue, 15 Sep 2020 12:06:49 UTC
2020-09-15 12:06:49 +00:00
||3ff7c459-86b2-4f6d-b6b0-ba6402ef6cb0.htmlcomponentservice.com$all
Filter updated: Wed, 10 Feb 2021 00:06:29 UTC
2021-02-10 00:06:29 +00:00
||3glite.wapka.co$all
Filter updated: Fri, 07 May 2021 12:12:56 UTC
2021-05-07 12:12:56 +00:00
||3j124.csb.app$all
Filter updated: Mon, 23 Aug 2021 12:02:18 +0000
2021-08-23 12:02:19 +00:00
||3khx4xj.xyz$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||3mvirugambakkam.com$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||3name.com$all
Filter updated: Fri, 30 Jul 2021 12:01:52 +0000
2021-07-30 12:01:52 +00:00
||3ngq0.skipdns.link$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||3no.ro$all
Filter updated: Wed, 25 Aug 2021 12:02:06 +0000
2021-08-25 12:02:07 +00:00
||3o2.co$all
Filter updated: Wed, 01 Sep 2021 12:01:58 +0000
2021-09-01 12:01:58 +00:00
||3oyynxmehx7.typeform.com$all
Filter updated: Mon, 26 Jul 2021 00:02:16 +0000
2021-07-26 00:02:17 +00:00
||3q3.de$all
Filter updated: Fri, 15 Jan 2021 00:06:14 UTC
2021-01-15 00:06:14 +00:00
||3rdstreetmarket.com/wp-content/themes/3rdst/8-login-form/$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||3sekabet.blogspot.com$all
Filter updated: Fri, 20 Nov 2020 00:06:19 UTC
2020-11-20 00:06:19 +00:00
||3wondersexpeditions.com$all
Filter updated: Tue, 31 Aug 2021 12:01:54 +0000
2021-08-31 12:01:54 +00:00
||3yteacv.xyz$all
Filter updated: Tue, 14 Sep 2021 00:01:48 +0000
2021-09-14 00:01:48 +00:00
||4115511456415145.hyperphp.com$all
Filter updated: Wed, 14 Jul 2021 00:03:28 +0000
2021-07-14 00:03:28 +00:00
||414614415641654.hyperphp.com$all
Filter updated: Mon, 07 Jun 2021 00:06:20 UTC
2021-06-07 00:06:20 +00:00
||4234655432432gal.eshost.com.ar$all
Filter updated: Fri, 30 Jul 2021 12:01:52 +0000
2021-07-30 12:01:52 +00:00
||42k8m.skipdns.link$all
Filter updated: Wed, 22 Sep 2021 00:02:26 +0000
2021-09-22 00:02:26 +00:00
||43-245-61-213.cprapid.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||43-245-61-213.cprapid.com/index.php/false/false/py1n.html/discovercard.com/dfs/accounthome/summary/-www.schwab.com/secure.accurint.com/unfcu2.org/login1/wachovia.com/myaccounts.aspx/investing.schwab.com/secure/schwab/https:/snsbank.nl/false$all
Filter updated: Sun, 11 Jul 2021 00:02:18 +0000
2021-07-11 00:02:18 +00:00
||4404trck.com$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||44444.leissx4.com$all
Filter updated: Tue, 14 Sep 2021 00:01:48 +0000
2021-09-14 00:01:48 +00:00
||44514156145145.hyperphp.com$all
Filter updated: Fri, 20 Aug 2021 00:01:56 +0000
2021-08-20 00:01:56 +00:00
||45.200.124.118$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||45.40.130.40$all
Filter updated: Sun, 17 Jan 2021 00:06:45 UTC
2021-01-17 00:06:45 +00:00
||45.76.76.126$all
Filter updated: Fri, 17 Sep 2021 00:01:45 +0000
2021-09-17 00:01:46 +00:00
||45.91.225.229$all
Filter updated: Wed, 07 Jul 2021 00:01:56 +0000
2021-07-07 00:01:57 +00:00
||4565434344354.hyperphp.com$all
||4565465565433.hyperphp.com$all
Filter updated: Wed, 28 Apr 2021 12:07:34 UTC
2021-04-28 12:07:34 +00:00
||45help43.creatorlink.net$all
Filter updated: Tue, 21 Sep 2021 00:01:40 +0000
2021-09-21 00:01:40 +00:00
||46.196.247.35.bc.googleusercontent.com/atualizacao/sinbc/home/v1/login/?auth=2oxmrcecjd1afj5was1ruch1cgdaubtiwmswjttn6ug4oyqcjnhmpzqg8c0lgjxeinxkiqbjxt3eaifx5vvbqew4t0anizkjoidn2cwnayoxcorj6htj9uj3wwt6rdiywrigttqpor09dkoxeoy1cg$all
||46.196.247.35.bc.googleusercontent.com/atualizacao/sinbc/home/v1/login/?auth=3oxmrcecjd1afj5was1ruch1cgdaubtiwmswjttn6ug4oyqcjnhmpzqg8c0lgjxeinxkiqbjxt3eaifx5vvbqew4t0anizkjoidn2cwnayoxcorj6htj9uj3wwt6rdiywrigttqpor09dkoxeoy1cg$all
||46.196.247.35.bc.googleusercontent.com/atualizacao/sinbc/home/v1/login/?auth=lchqus8gssgjbyi4x2chpl5t5igztsik9q7cjf4lqfwenuucuaplvfte5xsloxct6aycgqm43eucznyci8kjbg85mmbninsii6tqgbsdls45f6rmdo7f9preqlf2zeep3ebedurdrivmzhbddfzh5f$all
||46.196.247.35.bc.googleusercontent.com/atualizacao/sinbc/home/v1/login/?auth=mk7xicgem2ve5hriuebnkr7el7kakm3zgc8uikkogzjw5q3wvyord1qg6vljw7atxhsh9sd31rppo9tdinvsdniouiykpn5nor62hknln2oa1q3wtdngnf4uurq2ypc00vnpd43khxpk8apbasnkgg$all
||46.196.247.35.bc.googleusercontent.com/atualizacao/sinbc/home/v2/login/?auth=qqzhkpmbmrgcnufs35kwclfmxiu4dh0nftfughzvvjsjn0ivyizmpaugoupfiaxondispdy1qw6u0uot5v8czqnl7s6gtgoygpc05osneiu5trq3af4lb70m1rsy46xhttni1dsbuavad88dcvoskv$all
||46.196.247.35.bc.googleusercontent.com/atualizacao/sinbc/home/v2/login/?auth=wqcp5co7fduh7rxd4tumzvmldub81mbq7k3av9ssvrlfxrxku8kc6rn2twc5lwm89kyd3lazwiolynj6w6n6zwyo6heqqm6bjmaejswjczeuo7nfj4izhq5ejewn8bsruinzn0itnjwnyhpkzg0ief$all
||46.196.247.35.bc.googleusercontent.com/atualizacao/sinbc/home/v2/seguranca/?auth=9uipy1zeqdjqyu58hfp7elqvirnxtozxyqvgloqxz8bg69psuqkuedtv8abdwupoa7t0al8zbjrwz9vwup4kn9pddzqv9dzt3ud3goc8ol8a85qqusqe33uoblrhl2i3ouxn4jzqz92ux0natwzemi$all
||46.196.247.35.bc.googleusercontent.com/atualizacao/sinbc/home/v2/seguranca/?auth=mqa65vt1bv5ujjwl9swyatzzi19uvjvy24kjow7eppaw7jqznmurypaiya7oc4s91ydomz9hacgx67c2j35gtzjrchiugkzmrjzbah3jsdvns9qlqqp4ixwxqjthqgkkxnkbpd8swowenhiqdecmqb$all
||46.196.247.35.bc.googleusercontent.com/atualizacao/sinbc/home/v2/seguranca/?auth=oqa65vt1bv5ujjwl9swyatzzi19uvjvy24kjow7eppaw7jqznmurypaiya7oc4s91ydomz9hacgx67c2j35gtzjrchiugkzmrjzbah3jsdvns9qlqqp4ixwxqjthqgkkxnkbpd8swowenhiqdecmqb$all
||46.196.247.35.bc.googleusercontent.com/atualizacao/sinbc/home/v2/seguranca/?auth=pqa65vt1bv5ujjwl9swyatzzi19uvjvy24kjow7eppaw7jqznmurypaiya7oc4s91ydomz9hacgx67c2j35gtzjrchiugkzmrjzbah3jsdvns9qlqqp4ixwxqjthqgkkxnkbpd8swowenhiqdecmqb$all
||46.196.247.35.bc.googleusercontent.com/atualizacao/sinbc/home/v2/seguranca/?auth=xqa65vt1bv5ujjwl9swyatzzi19uvjvy24kjow7eppaw7jqznmurypaiya7oc4s91ydomz9hacgx67c2j35gtzjrchiugkzmrjzbah3jsdvns9qlqqp4ixwxqjthqgkkxnkbpd8swowenhiqdecmqb$all
||46.196.247.35.bc.googleusercontent.com/atualizacao/sinbc/home/v2/seguranca/?auth=zqa65vt1bv5ujjwl9swyatzzi19uvjvy24kjow7eppaw7jqznmurypaiya7oc4s91ydomz9hacgx67c2j35gtzjrchiugkzmrjzbah3jsdvns9qlqqp4ixwxqjthqgkkxnkbpd8swowenhiqdecmqb$all
||46.196.247.35.bc.googleusercontent.com/atualizacao/sinbc/home/v4/login/?auth=uhnhllsv5eruj0114y7spskwjd6k0st8bpjtndo3irw5bdmoiw1wuu0ggnennq9sr4fiwogruh3h7vhajt7fbxvlw6dvble4pejdxr2wcepchbl05xujlaxhzndbgjghpzuobqgsimxd6yyafbyted$all
||46.196.247.35.bc.googleusercontent.com/atualizacao/sinbc/home/v4/seguranca/?auth=bn5neccbepwzdne6ebclzixt8r9sheyqo0k0q7gmo8pfwnaqwyhxmncqxv2rcpzwocg1uwgwde51cyc1jhkfgkdgfxs6llrcfxbkbkvi9wl15ueoplzwnxxxxf9rzuqaaasvpp0bkn2prowlcbkfwq$all
||46.196.247.35.bc.googleusercontent.com/atualizacao/sinbc/home/v4/seguranca/?auth=cn5neccbepwzdne6ebclzixt8r9sheyqo0k0q7gmo8pfwnaqwyhxmncqxv2rcpzwocg1uwgwde51cyc1jhkfgkdgfxs6llrcfxbkbkvi9wl15ueoplzwnxxxxf9rzuqaaasvpp0bkn2prowlcbkfwq$all
||46.196.247.35.bc.googleusercontent.com/atualizacao/sinbc/home/v4/seguranca/?auth=qn5neccbepwzdne6ebclzixt8r9sheyqo0k0q7gmo8pfwnaqwyhxmncqxv2rcpzwocg1uwgwde51cyc1jhkfgkdgfxs6llrcfxbkbkvi9wl15ueoplzwnxxxxf9rzuqaaasvpp0bkn2prowlcbkfwq$all
||46.196.247.35.bc.googleusercontent.com/atualizacao/sinbc/home/v4/seguranca/?auth=xn5neccbepwzdne6ebclzixt8r9sheyqo0k0q7gmo8pfwnaqwyhxmncqxv2rcpzwocg1uwgwde51cyc1jhkfgkdgfxs6llrcfxbkbkvi9wl15ueoplzwnxxxxf9rzuqaaasvpp0bkn2prowlcbkfwq$all
||46.196.247.35.bc.googleusercontent.com/atualizacao/sinbc/home/v4/seguranca/?auth=yn5neccbepwzdne6ebclzixt8r9sheyqo0k0q7gmo8pfwnaqwyhxmncqxv2rcpzwocg1uwgwde51cyc1jhkfgkdgfxs6llrcfxbkbkvi9wl15ueoplzwnxxxxf9rzuqaaasvpp0bkn2prowlcbkfwq$all
||46.196.247.35.bc.googleusercontent.com/atualizacao/sinbc/home/v4/seguranca/?auth=zn5neccbepwzdne6ebclzixt8r9sheyqo0k0q7gmo8pfwnaqwyhxmncqxv2rcpzwocg1uwgwde51cyc1jhkfgkdgfxs6llrcfxbkbkvi9wl15ueoplzwnxxxxf9rzuqaaasvpp0bkn2prowlcbkfwq$all
Filter updated: Fri, 10 Sep 2021 00:02:17 +0000
2021-09-10 00:02:17 +00:00
||46.196.247.35.bc.googleusercontent.com/atualizacao/sinbc/mobile/v5/login/?auth=ukzjcdhun48xyqjisv6uzu5vdckkofar0vu7uhf3mglaxi1szkvtfz3okyj7jdyv9sqh4xwcgyzxqgwoncszisixiw4kxl846zqwgl1wyibmznxcxgk0jlngmruigsrnac86xjnefb7jvxtyfqzddq$all
Filter updated: Wed, 18 Aug 2021 12:02:35 +0000
2021-08-18 12:02:36 +00:00
||47.57.15.46$all
Filter updated: Wed, 22 Sep 2021 12:01:56 +0000
2021-09-22 12:01:56 +00:00
||47.89.152.194$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||47.98.243.165$all
Filter updated: Fri, 25 Jun 2021 00:06:14 +0000
2021-06-25 00:06:14 +00:00
||47.99.172.49$all
Filter updated: Thu, 03 Sep 2020 12:06:37 UTC
2020-09-03 12:06:37 +00:00
||472a4262-a2a1-4785-b3aa-4816cba070ed.htmlcomponentservice.com$all
Filter updated: Fri, 04 Dec 2020 00:06:15 UTC
2020-12-04 00:06:16 +00:00
||48tlp.codesandbox.io$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||49.235.62.58$all
Filter updated: Wed, 15 Sep 2021 12:01:46 +0000
2021-09-15 12:01:46 +00:00
||4datasolution.com$all
Filter updated: Fri, 24 Sep 2021 00:01:50 +0000
2021-09-24 00:01:51 +00:00
||4ea81b21bbd213fef855e114424d147f-dot-goff039302032323.rj.r.appspot.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||4jv02.app.link$all
Filter updated: Fri, 13 Aug 2021 00:01:48 +0000
2021-08-13 00:01:48 +00:00
||4l7rtd.hyperphp.com$all
Filter updated: Sat, 13 Mar 2021 00:09:54 UTC
2021-03-13 00:09:54 +00:00
||4lxkd.r.ag.d.sendibm3.com$all
Filter updated: Fri, 30 Jul 2021 12:01:52 +0000
2021-07-30 12:01:52 +00:00
||4pjqi.skipdns.link$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||4sekabet.blogspot.com$all
Filter updated: Thu, 17 Jun 2021 12:06:40 +0000
2021-06-17 12:06:40 +00:00
||4zwkx.codesandbox.io$all
Filter updated: Sun, 05 Sep 2021 00:02:15 +0000
2021-09-05 00:02:15 +00:00
||502c2dae4e5cfad452551b5d7032b151-dot-goff039302032323.rj.r.appspot.com$all
Filter updated: Thu, 12 Aug 2021 00:01:53 +0000
2021-08-12 00:01:54 +00:00
||51.222.193.66$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||51.255.64.58$all
Filter updated: Fri, 13 Aug 2021 00:01:48 +0000
2021-08-13 00:01:48 +00:00
||5145365411654.hyperphp.com$all
Filter updated: Tue, 27 Jul 2021 12:01:59 +0000
2021-07-27 12:01:59 +00:00
||5164845456464.hyperphp.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||5181365.com$all
Filter updated: Tue, 14 Sep 2021 00:01:48 +0000
2021-09-14 00:01:48 +00:00
||53411545416514.hyperphp.com$all
Filter updated: Sat, 10 Jul 2021 00:01:42 +0000
2021-07-10 00:01:42 +00:00
||54145451353212.hyperphp.com$all
||54154514564564.hyperphp.com$all
Filter updated: Wed, 04 Aug 2021 12:01:54 +0000
2021-08-04 12:01:54 +00:00
||54314324212214.hyperphp.com$all
Filter updated: Tue, 27 Jul 2021 12:01:59 +0000
2021-07-27 12:01:59 +00:00
||545415645665145.hyperphp.com$all
Filter updated: Tue, 10 Aug 2021 00:01:49 +0000
2021-08-10 00:01:49 +00:00
||5454451456445.hyperphp.com$all
Filter updated: Tue, 14 Sep 2021 00:01:48 +0000
2021-09-14 00:01:48 +00:00
||545644546451441.hyperphp.com$all
Filter updated: Tue, 27 Jul 2021 12:01:59 +0000
2021-07-27 12:01:59 +00:00
||5481818174145614.hyperphp.com$all
Filter updated: Sat, 21 Aug 2021 00:01:53 +0000
2021-08-21 00:01:54 +00:00
||54fa3ab2df92b2a2ac008992e729203a-dot-goff039302032323.rj.r.appspot.com$all
Filter updated: Tue, 27 Jul 2021 00:02:10 +0000
2021-07-27 00:02:10 +00:00
||54sadwd.j3byerqkbs.workers.dev$all
Filter updated: Thu, 02 Sep 2021 00:01:59 +0000
2021-09-02 00:01:59 +00:00
||55454615466641.hyperphp.com$all
Filter updated: Wed, 07 Jul 2021 00:01:56 +0000
2021-07-07 00:01:57 +00:00
||556554354654345.hyperphp.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||55bgf.csb.app$all
Filter updated: Wed, 25 Aug 2021 12:02:06 +0000
2021-08-25 12:02:07 +00:00
||55jkomtn2w3.typeform.com$all
Filter updated: Tue, 10 Aug 2021 00:01:49 +0000
2021-08-10 00:01:49 +00:00
||56146251545.hyperphp.com$all
Filter updated: Sat, 10 Jul 2021 00:01:42 +0000
2021-07-10 00:01:42 +00:00
||5615464545642.hyperphp.com$all
Filter updated: Fri, 02 Jul 2021 12:01:53 +0000
2021-07-02 12:01:53 +00:00
||563908.selcdn.ru$all
Filter updated: Thu, 01 Jul 2021 12:02:02 +0000
2021-07-01 12:02:03 +00:00
||563910.selcdn.ru$all
Filter updated: Fri, 13 Aug 2021 00:01:48 +0000
2021-08-13 00:01:48 +00:00
||565441514551444.hyperphp.com$all
Filter updated: Wed, 15 Sep 2021 12:01:46 +0000
2021-09-15 12:01:46 +00:00
||566656565564415.hyperphp.com$all
Filter updated: Tue, 24 Aug 2021 00:02:23 +0000
2021-08-24 00:02:24 +00:00
||56669663.hyperphp.com$all
Filter updated: Wed, 08 Sep 2021 00:02:08 +0000
2021-09-08 00:02:08 +00:00
||567656474653364.hyperphp.com$all
Filter updated: Sat, 03 Jul 2021 00:01:56 +0000
2021-07-03 00:01:56 +00:00
||567656575654657.hyperphp.com$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||567765654456.hyperphp.com$all
Filter updated: Wed, 07 Jul 2021 00:01:56 +0000
2021-07-07 00:01:57 +00:00
||5758496488684.hyperphp.com$all
Filter updated: Wed, 11 Aug 2021 00:01:55 +0000
2021-08-11 00:01:55 +00:00
||57754114545454.hyperphp.com$all
Filter updated: Wed, 25 Aug 2021 12:02:06 +0000
2021-08-25 12:02:07 +00:00
||579026.selcdn.ru$all
Filter updated: Wed, 22 Sep 2021 12:01:56 +0000
2021-09-22 12:01:56 +00:00
||597924.selcdn.ru$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||598503.selcdn.ru$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||598507.selcdn.ru$all
Filter updated: Tue, 21 Sep 2021 12:02:11 +0000
2021-09-21 12:02:11 +00:00
||599116.selcdn.ru$all
Filter updated: Sat, 04 Sep 2021 12:01:40 +0000
2021-09-04 12:01:40 +00:00
||5a9df6761251a805681d59e162d86423-dot-goff039302032323.rj.r.appspot.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||5b0f6cb9-0485-4fc7-9775-eb74bb45bbf6.htmlcomponentservice.com$all
Filter updated: Thu, 23 Sep 2021 00:02:18 +0000
2021-09-23 00:02:18 +00:00
||5e841ae2.srvr-cloudmail-srvr6765e7tg.pages.dev$all
Filter updated: Sat, 31 Jul 2021 00:01:51 +0000
2021-07-31 00:01:51 +00:00
||5ff9bedcda4386938.temporary.link$all
Filter updated: Sun, 11 Jul 2021 00:02:18 +0000
2021-07-11 00:02:18 +00:00
||5pl.us$all
Filter updated: Tue, 02 Mar 2021 12:07:41 UTC
2021-03-02 12:07:42 +00:00
||5thavegroominglounge.com$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||5x.to/3ax$all
Filter updated: Thu, 03 Sep 2020 12:06:37 UTC
2020-09-03 12:06:37 +00:00
||5x726-alternate.app.link$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||60minutesoffame.com$all
Filter updated: Fri, 06 Aug 2021 00:01:52 +0000
2021-08-06 00:01:52 +00:00
||61da8ae6.6u6566hrrthsh45.pages.dev$all
Filter updated: Mon, 22 Feb 2021 12:07:47 UTC
2021-02-22 12:07:48 +00:00
||629afe26.orson.website$all
Filter updated: Thu, 16 Sep 2021 12:02:15 +0000
2021-09-16 12:02:15 +00:00
||63454545645454.hyperphp.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||638ca12d-ba2f-451c-8418-faf56b7de7ff.htmlcomponentservice.com$all
||650vm.app.link$all
Filter updated: Tue, 14 Sep 2021 00:01:48 +0000
2021-09-14 00:01:48 +00:00
||655566564564.hyperphp.com$all
Filter updated: Fri, 28 May 2021 00:06:28 UTC
2021-05-28 00:06:29 +00:00
||6574.ihostfull.com$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||66.29.149.238$all
Filter updated: Fri, 02 Jul 2021 00:01:50 +0000
2021-07-02 00:01:51 +00:00
||66.42.59.83$all
Filter updated: Fri, 16 Apr 2021 00:06:41 UTC
2021-04-16 00:06:41 +00:00
||66.49.196.115$all
Filter updated: Wed, 01 Sep 2021 00:02:20 +0000
2021-09-01 00:02:20 +00:00
||6600035.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||6615365.com$all
Filter updated: Thu, 08 Jul 2021 00:02:02 +0000
2021-07-08 00:02:02 +00:00
||661544415541455.hyperphp.com$all
Filter updated: Fri, 10 Sep 2021 00:02:17 +0000
2021-09-10 00:02:17 +00:00
||67d799f0-7b49-48fb-ac08-8954e4a48b81-a0fe.viosoria-das.ga$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||68.178.252.133$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||6825365.com$all
Filter updated: Fri, 03 Sep 2021 00:01:54 +0000
2021-09-03 00:01:55 +00:00
||688745.hyperphp.com$all
Filter updated: Fri, 24 Sep 2021 00:01:50 +0000
2021-09-24 00:01:51 +00:00
||6b6ee980cb147a4ec53464500670dd46-dot-goff039302032323.rj.r.appspot.com$all
Filter updated: Fri, 24 Sep 2021 12:02:36 +0000
2021-09-24 12:02:36 +00:00
||6b6ee980cb147a4ec53464500670dd46-dot-goff039302032323.rj.r.appspot.com/#?em=jennifer.blachford@nb.com$all
Filter updated: Thu, 02 Sep 2021 12:02:02 +0000
2021-09-02 12:02:02 +00:00
||6c7f0acc.sibforms.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||6e33r.codesandbox.io$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||70.40.208.244$all
Filter updated: Thu, 22 Jul 2021 00:01:54 +0000
2021-07-22 00:01:54 +00:00
||7002x0788s6.typeform.com$all
Filter updated: Tue, 21 Sep 2021 00:01:40 +0000
2021-09-21 00:01:40 +00:00
||72.11.143.173$all
Filter updated: Fri, 24 Sep 2021 00:01:50 +0000
2021-09-24 00:01:51 +00:00
||738vjijegloopmglobald833bkcmue3778ewebprokl3e.weebly.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||7585365.com$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||768675643546534.hyperphp.com$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||77777.leissx7.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||779zt.csb.app$all
Filter updated: Fri, 16 Oct 2020 00:06:22 UTC
2020-10-16 00:06:22 +00:00
||78.108.89.240$all
Filter updated: Wed, 15 Sep 2021 00:01:54 +0000
2021-09-15 00:01:55 +00:00
||7a4298b9.sso-mail-secure234ds23d23wd1.pages.dev$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||7college.du.ac.bd$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||7d54v.app.link$all
||7ku50.csb.app$all
Filter updated: Fri, 30 Jul 2021 12:01:52 +0000
2021-07-30 12:01:52 +00:00
||7p1qy.skipdns.link$all
Filter updated: Fri, 19 Mar 2021 12:06:36 UTC
2021-03-19 12:06:36 +00:00
||7wr4u.csb.app$all
Filter updated: Sun, 28 Mar 2021 00:07:02 UTC
2021-03-28 00:07:03 +00:00
||7yu3v.csb.app$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||800emailsupport.com$all
Filter updated: Wed, 23 Dec 2020 12:06:36 UTC
2020-12-23 12:06:36 +00:00
||8010361370310234068010361370310234.blogspot.be$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||8010361370310234068010361370310234.blogspot.com/?m=0%5c$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||8093cb2147fcdea8b26f98018f5113bd-dot-goff039302032323.rj.r.appspot.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||82.165.27.36$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||8325365.com$all
Filter updated: Wed, 26 May 2021 12:06:39 UTC
2021-05-26 12:06:39 +00:00
||853.trendsbygwen.com$all
Filter updated: Tue, 31 Aug 2021 00:01:55 +0000
2021-08-31 00:01:55 +00:00
||856966555.hyperphp.com$all
Filter updated: Tue, 14 Sep 2021 00:01:48 +0000
2021-09-14 00:01:48 +00:00
||866614545641445.hyperphp.com$all
Filter updated: Wed, 08 Sep 2021 00:02:08 +0000
2021-09-08 00:02:08 +00:00
||8765423564342.hyperphp.com$all
Filter updated: Sat, 03 Jul 2021 00:01:56 +0000
2021-07-03 00:01:56 +00:00
||87656765564534.hyperphp.com$all
Filter updated: Fri, 24 Sep 2021 12:02:36 +0000
2021-09-24 12:02:36 +00:00
||8765913c501c2e58a4af1bbee1458ea4-dot-goff039302032323.rj.r.appspot.com$all
||878e1f3529847f4cdc43407202af3901-dot-goff039302032323.rj.r.appspot.com$all
Filter updated: Sat, 29 May 2021 00:06:23 UTC
2021-05-29 00:06:23 +00:00
||88444.ihostfull.com$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||88888.leissx8.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||8dw5g.codesandbox.io$all
||8hsfskj-alternate.app.link$all
Filter updated: Thu, 26 Nov 2020 12:06:43 UTC
2020-11-26 12:06:43 +00:00
||90a6903b-75ff-445e-893e-c69d2807dd96.htmlcomponentservice.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||90mins.co.za$all
Filter updated: Fri, 26 Feb 2021 12:08:06 UTC
2021-02-26 12:08:06 +00:00
||934354637282-343432.com$all
Filter updated: Fri, 13 Aug 2021 00:01:48 +0000
2021-08-13 00:01:48 +00:00
||96414154511454.hyperphp.com$all
Filter updated: Tue, 25 May 2021 12:06:34 UTC
2021-05-25 12:06:34 +00:00
||965823.ihostfull.com$all
Filter updated: Tue, 21 Sep 2021 00:01:40 +0000
2021-09-21 00:01:40 +00:00
||96968.hyperphp.com$all
Filter updated: Fri, 28 May 2021 00:06:28 UTC
2021-05-28 00:06:29 +00:00
||969896.ihostfull.com$all
Filter updated: Mon, 24 May 2021 12:06:37 UTC
2021-05-24 12:06:37 +00:00
||98635.ihostfull.com$all
Filter updated: Fri, 28 May 2021 00:06:28 UTC
2021-05-28 00:06:29 +00:00
||99000.ihostfull.com$all
Filter updated: Fri, 24 Sep 2021 00:01:50 +0000
2021-09-24 00:01:51 +00:00
||9a658b0e03b628a9c8dca6f0ac68117e-dot-goff039302032323.rj.r.appspot.com$all
||9bc8459f5401575658f78d584973748f-dot-goff039302032323.rj.r.appspot.com$all
Filter updated: Sat, 21 Aug 2021 00:01:53 +0000
2021-08-21 00:01:54 +00:00
||9c9855c9c198acd14ca8c88da20e8ad5-dot-goff039302032323.rj.r.appspot.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||9d62cfee-59b3-42a8-9542-4b3a32692792.htmlcomponentservice.com$all
||9khnh.app.link$all
Filter updated: Fri, 21 May 2021 12:06:31 UTC
2021-05-21 12:06:31 +00:00
||9xnog.csb.app$all
Filter updated: Thu, 29 Jul 2021 00:01:57 +0000
2021-07-29 00:01:57 +00:00
||a-25ghjud872.byethost13.com$all
Filter updated: Sat, 31 Jul 2021 00:01:51 +0000
2021-07-31 00:01:51 +00:00
||a-25ghjud89.byethost3.com$all
Filter updated: Sun, 18 Jul 2021 12:02:04 +0000
2021-07-18 12:02:04 +00:00
||a-q-f.com/openpc/directlogin.do$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||a-s-kontakt-9392f1.ingress-baronn.easywp.com$all
Filter updated: Tue, 21 Sep 2021 00:01:40 +0000
2021-09-21 00:01:40 +00:00
||a0581702.xsph.ru$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||a1d74631dd790d85287f100b44df0c9e6adbef31.000webhostapp.com$all
Filter updated: Sat, 21 Aug 2021 00:01:53 +0000
2021-08-21 00:01:54 +00:00
||a6f82af5baec4689a43fb46da5b682e7-dot-goff039302032323.rj.r.appspot.com$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||aabpjs.covidharsh.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||aadaedu-my.sharepoint.com/:o:/g/personal/sherring_aada_edu1/epxaaqphuzvnqoye4vgldzkbzmud1mij-ek8r72wltpdyq?e=szm5ky$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||aaekt.app.link$all
Filter updated: Wed, 25 Aug 2021 12:02:06 +0000
2021-08-25 12:02:07 +00:00
||aainacreation.co.in$all
Filter updated: Fri, 23 Jul 2021 00:03:07 +0000
2021-07-23 00:03:07 +00:00
||aaipsds.org$all
Filter updated: Mon, 15 Mar 2021 12:43:24 UTC
2021-03-15 12:43:24 +00:00
||aarogyamcafe.com$all
Filter updated: Sat, 10 Jul 2021 00:01:42 +0000
2021-07-10 00:01:42 +00:00
||abagency.rw$all
Filter updated: Sun, 11 Jul 2021 00:02:18 +0000
2021-07-11 00:02:18 +00:00
||abamazproduct.net$all
Filter updated: Wed, 22 Sep 2021 00:02:26 +0000
2021-09-22 00:02:26 +00:00
||abapplianceservicefl.com$all
Filter updated: Thu, 19 Aug 2021 00:01:47 +0000
2021-08-19 00:01:47 +00:00
||abcarmsk.ru$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||abdcenter.rhinosme-stagging.com$all
Filter updated: Mon, 20 Sep 2021 00:01:41 +0000
2021-09-20 00:01:41 +00:00
||abdernameanmoins.moonfruit.com$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||abjmjx.covidharsh.com$all
Filter updated: Wed, 08 Sep 2021 00:02:08 +0000
2021-09-08 00:02:08 +00:00
||abnmart.co.in/orne/$all
Filter updated: Sat, 24 Jul 2021 00:33:22 +0000
2021-07-24 00:33:22 +00:00
||absolute-insights.com$all
Filter updated: Wed, 16 Dec 2020 00:06:24 UTC
2020-12-16 00:06:24 +00:00
||absolutepleasure.com.my$all
Filter updated: Fri, 06 Aug 2021 12:01:57 +0000
2021-08-06 12:01:57 +00:00
||abszolutauto.hu$all
Filter updated: Mon, 05 Oct 2020 12:06:21 UTC
2020-10-05 12:06:21 +00:00
||abtekdoor.com$all
Filter updated: Fri, 21 May 2021 00:06:36 UTC
2021-05-21 00:06:36 +00:00
||academiamoviles.com$all
Filter updated: Wed, 01 Sep 2021 12:01:58 +0000
2021-09-01 12:01:58 +00:00
||acala.legal$all
Filter updated: Wed, 07 Jul 2021 00:01:56 +0000
2021-07-07 00:01:57 +00:00
||accesidca.zyrosite.com$all
Filter updated: Tue, 21 Sep 2021 12:02:11 +0000
2021-09-21 12:02:11 +00:00
||accestransfilboncoin.000webhostapp.com$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||account-validation.btcfuturos.com$all
Filter updated: Wed, 23 Jun 2021 12:06:29 +0000
2021-06-23 12:06:29 +00:00
||account.herephyshy.info$all
Filter updated: Sat, 03 Jul 2021 12:01:36 +0000
2021-07-03 12:01:37 +00:00
||account.signin.totally-tubular.net$all
Filter updated: Mon, 31 May 2021 00:06:34 UTC
2021-05-31 00:06:34 +00:00
||accountliveout.freecluster.eu$all
Filter updated: Sun, 30 May 2021 12:06:22 UTC
2021-05-30 12:06:22 +00:00
||accounts-autoscout24.de$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||accounts-google-com.gsuite.nfr38.skyfencenet.com/login$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||accounts.amazorr.co.jp.oneke-ai.com$all
Filter updated: Tue, 17 Aug 2021 00:02:45 +0000
2021-08-17 00:02:45 +00:00
||accounts.com.es$all
Filter updated: Fri, 27 Aug 2021 00:01:47 +0000
2021-08-27 00:01:47 +00:00
||accounts.google.com/servicelogin?passive=1209600&continue=https://sites.google.com/view/viewbill-bt-1/bt&followup=https://sites.google.com/view/viewbill-bt-1/bt$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||accounts.google.com/servicelogin?passive=1209600&osid=1&continue=https://plus.google.com/%26&followup=https://plus.google.com/%26$all
||accounts.google.com/servicelogin?service=cds&passive=1209600&continue=https://storage.cloud.google.com/staging.maintainancecomponeta.appspot.com/bsnnindex.html&followup=https://storage.cloud.google.com/staging.maintainancecomponeta.appspot.com/bsnnindex.html$all
Filter updated: Wed, 02 Jun 2021 00:06:23 UTC
2021-06-02 00:06:23 +00:00
||accounts.google.com/servicelogin?service=cds&passive=1209600&continue=https://storage.cloud.google.com/1lordman1man3/oscman2.html&followup=https://storage.cloud.google.com/1lordman1man3/oscman2.html$all
Filter updated: Wed, 07 Apr 2021 12:23:11 UTC
2021-04-07 12:23:12 +00:00
||accounts.google.com/servicelogin?service=cds&passive=1209600&continue=https://storage.cloud.google.com/appspotv450i7r8h9vf9y6yt8uiuft58f7uf5yye36u0jtyf78uuyfyy/index.html&followup=https://storage.cloud.google.com/appspotv450i7r8h9vf9y6yt8uiuft58f7uf5yye36u0jtyf78uuyfyy/index.html$all
Filter updated: Mon, 12 Apr 2021 00:06:48 UTC
2021-04-12 00:06:48 +00:00
||accounts.google.com/servicelogin?service=cds&passive=1209600&continue=https://storage.cloud.google.com/employt44to49cclrlolcrl94lnlxo.appspot.com/index.html&followup=https://storage.cloud.google.com/employt44to49cclrlolcrl94lnlxo.appspot.com/index.html$all
Filter updated: Wed, 02 Jun 2021 00:06:23 UTC
2021-06-02 00:06:23 +00:00
||accounts.google.com/servicelogin?service=cds&passive=1209600&continue=https://storage.cloud.google.com/maintainancecomponeta.appspot.com/mineindex.html&followup=https://storage.cloud.google.com/maintainancecomponeta.appspot.com/mineindex.html$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||accounts.google.com/servicelogin?service=cds&passive=1209600&continue=https://storage.cloud.google.com/officpcpspbcncuser.appspot.com/index.htm&followup=https://storage.cloud.google.com/officpcpspbcncuser.appspot.com/index.htm$all
||accounts.google.com/servicelogin?service=cds&passive=1209600&continue=https://storage.cloud.google.com/poopnoomprops-oo987700ok/newrbindex.html&followup=https://storage.cloud.google.com/poopnoomprops-oo987700ok/newrbindex.html$all
||accounts.google.com/servicelogin?service=cds&passive=1209600&continue=https://storage.cloud.google.com/staging.maintainancecomponeta.appspot.com/bsnnindex.html&followup=https://storage.cloud.google.com/staging.maintainancecomponeta.appspot.com/bsnnindex.html$all
||accounts.google.com/servicelogin?service=cds&passive=1209600&continue=https://storage.cloud.google.com/user517497679326978.appspot.com/index.html&followup=https://storage.cloud.google.com/user517497679326978.appspot.com/index.html$all
||accounts.google.com/servicelogin?service=cds&passive=1209600&continue=https://storage.cloud.google.com/user7773578ixh1092839.appspot.com/index.html&followup=https://storage.cloud.google.com/user7773578ixh1092839.appspot.com/index.html$all
||accounts.google.com/servicelogin?service=cds&passive=1209600&continue=https://storage.cloud.google.com/xzrdzcdruerp.appspot.com/index.html&followup=https://storage.cloud.google.com/xzrdzcdruerp.appspot.com/index.html$all
Filter updated: Wed, 04 Aug 2021 00:02:10 +0000
2021-08-04 00:02:10 +00:00
||accountverifisv.hostfree.pw$all
Filter updated: Wed, 21 Jul 2021 12:01:49 +0000
2021-07-21 12:01:49 +00:00
||accountverifisv1.hostfree.pw$all
Filter updated: Wed, 01 Sep 2021 00:02:20 +0000
2021-09-01 00:02:20 +00:00
||accts-validtion55akda.cf$all
Filter updated: Fri, 03 Sep 2021 12:01:48 +0000
2021-09-03 12:01:48 +00:00
||accurate-insight.com/wp-admin/pmg/office-new-rd85-modify-footer$all
Filter updated: Fri, 03 Sep 2021 00:01:54 +0000
2021-09-03 00:01:55 +00:00
||accurate-insight.com/wp-admin/pmg/office-new-rd85-modify-footer/$all
Filter updated: Tue, 21 Sep 2021 00:01:40 +0000
2021-09-21 00:01:40 +00:00
||aceon.cacrzurd.com$all
Filter updated: Thu, 22 Oct 2020 00:06:29 UTC
2020-10-22 00:06:29 +00:00
||acessobbauto.com$all
Filter updated: Fri, 26 Mar 2021 00:06:40 UTC
2021-03-26 00:06:40 +00:00
||acessobradesco.digital$all
Filter updated: Thu, 26 Aug 2021 00:02:01 +0000
2021-08-26 00:02:01 +00:00
||achalasiapedia.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||achieve.ddnsking.com$all
Filter updated: Mon, 20 Sep 2021 12:02:05 +0000
2021-09-20 12:02:05 +00:00
||achillestendonrupturepedia.com$all
Filter updated: Thu, 16 Sep 2021 00:01:52 +0000
2021-09-16 00:01:52 +00:00
||acortar.link/yxwyrl$all
Filter updated: Fri, 09 Jul 2021 00:01:59 +0000
2021-07-09 00:01:59 +00:00
||acount090387.ultimatefreehost.in$all
Filter updated: Sat, 14 Aug 2021 00:01:49 +0000
2021-08-14 00:01:49 +00:00
||act67.freecluster.eu$all
Filter updated: Tue, 17 Aug 2021 00:02:45 +0000
2021-08-17 00:02:45 +00:00
||actionnaireparis.zyrosite.com$all
Filter updated: Tue, 24 Aug 2021 12:02:00 +0000
2021-08-24 12:02:00 +00:00
||activartransferenciainternacional.com$all
Filter updated: Tue, 07 Sep 2021 00:01:46 +0000
2021-09-07 00:01:46 +00:00
||activate-hulu-com-activate.sitey.me$all
Filter updated: Tue, 23 Mar 2021 00:10:01 UTC
2021-03-23 00:10:01 +00:00
||active-page-term-dashboard-advanced.my.id$all
||active-page-term-dashboard-inc.my.id$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||active-secure-page.000webhostapp.com$all
Filter updated: Tue, 01 Jun 2021 12:06:34 UTC
2021-06-01 12:06:34 +00:00
||activicionrealy.byethost31.com$all
Filter updated: Wed, 15 Sep 2021 00:01:54 +0000
2021-09-15 00:01:55 +00:00
||actplan.eu$all
Filter updated: Thu, 15 Jul 2021 00:02:02 +0000
2021-07-15 00:02:03 +00:00
||acttivvar2909904.hostkda.com$all
Filter updated: Tue, 15 Jun 2021 00:06:35 UTC
2021-06-15 00:06:35 +00:00
||actualbanrservas.eshost.com.ar$all
Filter updated: Fri, 10 Sep 2021 12:02:02 +0000
2021-09-10 12:02:02 +00:00
||actualisation.ddns.net$all
Filter updated: Sat, 03 Jul 2021 00:01:56 +0000
2021-07-03 00:01:56 +00:00
||actualizaban0954.hostkda.com$all
Filter updated: Thu, 24 Jun 2021 00:06:35 +0000
2021-06-24 00:06:35 +00:00
||actualizaban4568.ultimatefreehost.in$all
Filter updated: Fri, 27 Aug 2021 12:01:40 +0000
2021-08-27 12:01:40 +00:00
||actualizaciondefirma.co$all
Filter updated: Fri, 27 Aug 2021 00:01:47 +0000
2021-08-27 00:01:47 +00:00
||actvsanteruy.ultimatefreehost.in$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||acuavalle.gov.co$all
Filter updated: Tue, 21 Sep 2021 00:01:40 +0000
2021-09-21 00:01:40 +00:00
||acune.cacrzurd.com$all
Filter updated: Sun, 14 Mar 2021 00:12:43 UTC
2021-03-14 00:12:43 +00:00
||adamfeber.com$all
Filter updated: Thu, 16 Sep 2021 12:02:15 +0000
2021-09-16 12:02:15 +00:00
||adcloudserver.com$all
Filter updated: Wed, 15 Sep 2021 00:01:54 +0000
2021-09-15 00:01:55 +00:00
||adilabadplanning.in$all
Filter updated: Sun, 19 Sep 2021 12:01:34 +0000
2021-09-19 12:01:35 +00:00
||adityaschooljabalpur.com$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||adlxkw.covidharsh.com$all
Filter updated: Thu, 09 Sep 2021 12:02:27 +0000
2021-09-09 12:02:27 +00:00
||admin-formserviceupdates.weeblysite.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||admin-hostpoint-ch-11770450.atsoclis.pt$all
||admin-hostpoint-ch-b7958ed7.atsoclis.pt$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||admin.baragor.se$all
Filter updated: Tue, 14 Sep 2021 00:01:48 +0000
2021-09-14 00:01:48 +00:00
||admin.dreamploy.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||admin.hostpoint.chronsmans.ch.scmbuarcos.com$all
Filter updated: Thu, 16 Sep 2021 00:01:52 +0000
2021-09-16 00:01:52 +00:00
||admin.indramayukab.go.id$all
Filter updated: Mon, 09 Nov 2020 00:06:10 UTC
2020-11-09 00:06:10 +00:00
||admin.ipaoo.fr$all
Filter updated: Thu, 08 Jul 2021 00:02:02 +0000
2021-07-08 00:02:02 +00:00
||admin.sitesumo.com$all
Filter updated: Wed, 07 Jul 2021 00:01:56 +0000
2021-07-07 00:01:57 +00:00
||adminpostalessl.zyrosite.com$all
Filter updated: Fri, 17 Sep 2021 00:01:45 +0000
2021-09-17 00:01:46 +00:00
||adornbit.com/en$all
Filter updated: Tue, 19 Jan 2021 00:06:28 UTC
2021-01-19 00:06:28 +00:00
||adpunemploymentclaims.sharefile.com$all
Filter updated: Wed, 11 Nov 2020 00:06:12 UTC
2020-11-11 00:06:12 +00:00
||ads-google-think.blogspot.com$all
Filter updated: Wed, 15 Sep 2021 00:01:54 +0000
2021-09-15 00:01:55 +00:00
||adsaccountbusinesscampaigncreditcoupon.com$all
Filter updated: Wed, 08 Sep 2021 00:02:08 +0000
2021-09-08 00:02:08 +00:00
||adsbusinesscouponcreditcampaign.com$all
Filter updated: Tue, 31 Aug 2021 12:01:54 +0000
2021-08-31 12:01:54 +00:00
||adscampaignbusinesscreditcoupon.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||adscouponsbusinessaccount.com$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||advenations.com$all
Filter updated: Sun, 23 May 2021 00:06:33 UTC
2021-05-23 00:06:33 +00:00
||advent.ist$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||advocaciagallo.com.br$all
Filter updated: Fri, 05 Mar 2021 00:09:33 UTC
2021-03-05 00:09:33 +00:00
||adx-exchancesegu2bn-gibcx.com$all
Filter updated: Fri, 30 Jul 2021 00:01:47 +0000
2021-07-30 00:01:47 +00:00
||aebksvvbiatxhxsykhucgpmtid-dot-gowa11111111.rj.r.appspot.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||aemnzas.000webhostapp.com$all
Filter updated: Thu, 03 Dec 2020 12:07:06 UTC
2020-12-03 12:07:06 +00:00
||aenth.com$all
Filter updated: Thu, 23 Sep 2021 00:02:18 +0000
2021-09-23 00:02:18 +00:00
||aeomencarndmsuocaroam.com$all
Filter updated: Mon, 20 Sep 2021 12:02:05 +0000
2021-09-20 12:02:05 +00:00
||aeon.cn.casrcd.com$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||aepwfh.covidharsh.com$all
Filter updated: Thu, 08 Jul 2021 00:02:02 +0000
2021-07-08 00:02:02 +00:00
||aerflofans.com$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||aeroclubmondovi.it$all
Filter updated: Thu, 17 Jun 2021 00:06:32 +0000
2021-06-17 00:06:32 +00:00
||aerorescate.co$all
Filter updated: Tue, 03 Aug 2021 00:01:58 +0000
2021-08-03 00:01:58 +00:00
||aestheticar.com.sg$all
Filter updated: Tue, 14 Sep 2021 00:01:48 +0000
2021-09-14 00:01:48 +00:00
||aeznus.allkaanet.com$all
Filter updated: Mon, 02 Aug 2021 00:02:18 +0000
2021-08-02 00:02:18 +00:00
||afdfji.tk$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||afterward-qa.digitaladditive.io$all
||afxdns.covidharsh.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||aggiornamento-sgdfwqas.000webhostapp.com$all
Filter updated: Fri, 29 Jan 2021 12:10:13 UTC
2021-01-29 12:10:13 +00:00
||agri72.fr$all
Filter updated: Fri, 30 Jul 2021 12:01:52 +0000
2021-07-30 12:01:52 +00:00
||agribisnis.faperta.ulm.ac.id$all
Filter updated: Wed, 04 Aug 2021 12:01:54 +0000
2021-08-04 12:01:54 +00:00
||agricola-avisosx.ultimatefreehost.in$all
Filter updated: Thu, 05 Aug 2021 12:01:57 +0000
2021-08-05 12:01:57 +00:00
||agricolabc.hostfree.pw$all
Filter updated: Wed, 04 Aug 2021 12:01:54 +0000
2021-08-04 12:01:54 +00:00
||agricolasvsub.ultimatefreehost.in$all
Filter updated: Sun, 15 Aug 2021 00:01:57 +0000
2021-08-15 00:01:57 +00:00
||agricolaweb.ultimatefreehost.in$all
Filter updated: Thu, 05 Aug 2021 12:01:57 +0000
2021-08-05 12:01:57 +00:00
||agricolbankofi.ultimatefreehost.in$all
Filter updated: Sun, 15 Aug 2021 00:01:57 +0000
2021-08-15 00:01:57 +00:00
||agricolieba800.ultimatefreehost.in$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||agrimetiersmartinique.fr$all
Filter updated: Tue, 16 Mar 2021 00:07:08 UTC
2021-03-16 00:07:09 +00:00
||ah.com.ge$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||ahaganrtewebb.byethost6.com$all
Filter updated: Tue, 24 Aug 2021 00:02:23 +0000
2021-08-24 00:02:24 +00:00
||ahartlawnscaping.com$all
Filter updated: Fri, 24 Sep 2021 00:01:50 +0000
2021-09-24 00:01:51 +00:00
||aid-validation-human.run-us-west2.goorm.io$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||aijcs.blogspot.com/2005/03/colourful-life-of-aij.html$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||ailzux.top$all
Filter updated: Wed, 01 Sep 2021 00:02:20 +0000
2021-09-01 00:02:20 +00:00
||aimocean.top$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||airbnb-70aba.firebaseapp.com$all
Filter updated: Mon, 30 Aug 2021 12:01:50 +0000
2021-08-30 12:01:51 +00:00
||airbrakes-my.sharepoint.com/:b:/g/personal/fran_airbrake_ie/eqc3jfpbonbnqnibgpaej70bhh4buhabliuakttnd6zeyq?e=szvft8$all
Filter updated: Tue, 31 Aug 2021 12:01:54 +0000
2021-08-31 12:01:54 +00:00
||ak-bars-lichnyj-kabinet.ru$all
Filter updated: Fri, 06 Aug 2021 12:01:57 +0000
2021-08-06 12:01:57 +00:00
||akanksha3012.github.io$all
Filter updated: Mon, 21 Jun 2021 00:06:20 +0000
2021-06-21 00:06:20 +00:00
||aki-totalmw.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||aktualizacja-platnosci.netafixs.life$all
Filter updated: Wed, 12 May 2021 00:06:26 UTC
2021-05-12 00:06:26 +00:00
||aktualizacja.jst.pl$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||alareentading-catalog.page.tl$all
||alaskanmalamute.us$all
||albel.intnet.mu$all
Filter updated: Thu, 26 Aug 2021 12:02:31 +0000
2021-08-26 12:02:31 +00:00
||aldana.in$all
Filter updated: Thu, 15 Jul 2021 12:01:53 +0000
2021-07-15 12:01:53 +00:00
||alerpro191.hostfree.pw$all
Filter updated: Mon, 20 Sep 2021 12:02:05 +0000
2021-09-20 12:02:05 +00:00
||alert-bankingonline.com$all
Filter updated: Thu, 23 Sep 2021 00:02:18 +0000
2021-09-23 00:02:18 +00:00
||alert-boi.net$all
Filter updated: Sun, 10 Jan 2021 00:06:52 UTC
2021-01-10 00:06:52 +00:00
||alerts-payee-new.com$all
Filter updated: Sat, 31 Jul 2021 00:01:51 +0000
2021-07-31 00:01:51 +00:00
||alertsnet.byethost7.com$all
Filter updated: Sat, 12 Jun 2021 00:25:37 UTC
2021-06-12 00:25:37 +00:00
||alfaauv.com$all
Filter updated: Sun, 19 Sep 2021 12:01:34 +0000
2021-09-19 12:01:35 +00:00
||alfacomputers.be$all
Filter updated: Wed, 24 Feb 2021 00:06:23 UTC
2021-02-24 00:06:23 +00:00
||alfaindustrials.co.uk$all
Filter updated: Fri, 30 Jul 2021 12:01:52 +0000
2021-07-30 12:01:52 +00:00
||alfasupport.ru$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||alfredtalkelogisticservices-my.sharepoint.com/:x:/r/personal/venus_gardose_talke_com/_layouts/15/wopiframe.aspx?guestaccesstoken=8extkunxrkqozifs2sycqmk4ox0ntao7cizsavm5mjc=&docid=1_14abcf62971634e6b8387df30ef7d978b&wdformid={83a6cfc0-5689-4aa4-ab13-96952b8999ba}&action=formsubmit$all
Filter updated: Tue, 05 Jan 2021 00:06:22 UTC
2021-01-05 00:06:22 +00:00
||algoass.co.za$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||algotextil.com.br$all
Filter updated: Sun, 27 Jun 2021 00:06:14 +0000
2021-06-27 00:06:14 +00:00
||aliah.ac.in/2n020/setmodule/$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||alias-secureservernet.200835.prohoster.biz$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||alibaba.vritta.in$all
Filter updated: Wed, 28 Apr 2021 00:06:29 UTC
2021-04-28 00:06:29 +00:00
||alicesecurity.ro$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||aliciabot.azurewebsites.net$all
Filter updated: Sat, 31 Jul 2021 12:01:55 +0000
2021-07-31 12:01:55 +00:00
||alienuniversal-earthassociation.org$all
Filter updated: Tue, 20 Jul 2021 12:01:48 +0000
2021-07-20 12:01:48 +00:00
||aliexpressi.cam$all
Filter updated: Sat, 18 Sep 2021 00:14:48 +0000
2021-09-18 00:14:48 +00:00
||aljrfu.cloudanation.com$all
Filter updated: Tue, 17 Aug 2021 00:02:45 +0000
2021-08-17 00:02:45 +00:00
||alkautsar.or.id$all
Filter updated: Fri, 23 Oct 2020 00:06:28 UTC
2020-10-23 00:06:29 +00:00
||alkawaterdiy.com$all
Filter updated: Fri, 17 Sep 2021 00:01:45 +0000
2021-09-17 00:01:46 +00:00
||alkhalilgraphics.com$all
Filter updated: Wed, 26 May 2021 12:06:39 UTC
2021-05-26 12:06:39 +00:00
||alkren.pinkmoonltd.com$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||allcaredentalcentre.in$all
Filter updated: Wed, 22 Sep 2021 12:01:56 +0000
2021-09-22 12:01:56 +00:00
||allegr0-order.pl-id08842906.xyz$all
||allegre-order.pl-id08842906.xyz$all
Filter updated: Fri, 24 Sep 2021 12:02:36 +0000
2021-09-24 12:02:36 +00:00
||allegro-order.pl-id06057206.xyz$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||allegro-order.pl-id08862333.xyz$all
Filter updated: Fri, 24 Sep 2021 12:02:36 +0000
2021-09-24 12:02:36 +00:00
||allegro-order.pl-id49214593.xyz$all
Filter updated: Mon, 20 Sep 2021 12:02:05 +0000
2021-09-20 12:02:05 +00:00
||allegro-order.pl-id60554791.xyz$all
Filter updated: Wed, 22 Sep 2021 12:01:56 +0000
2021-09-22 12:01:56 +00:00
||allegro-order.pl-id65592797.xyz$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||allegro-order.pl-id66845769.xyz$all
Filter updated: Thu, 23 Sep 2021 00:02:18 +0000
2021-09-23 00:02:18 +00:00
||allegro-order.pl-id74829541.xyz$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||allegro-order.pl-id97118124.xyz$all
Filter updated: Tue, 21 Sep 2021 12:02:11 +0000
2021-09-21 12:02:11 +00:00
||allegro.paym32.info$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||allegro.pl01.me$all
Filter updated: Tue, 03 Aug 2021 00:01:58 +0000
2021-08-03 00:01:58 +00:00
||allegro.qumucloud.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||allegrolokalnie-pl.id-48278.pw$all
Filter updated: Tue, 13 Apr 2021 12:07:03 UTC
2021-04-13 12:07:03 +00:00
||allianzbankmypostweb.datlas.it$all
Filter updated: Thu, 29 Jul 2021 00:01:57 +0000
2021-07-29 00:01:57 +00:00
||allnewhaircut.com/smi.cers/bmss.php$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||allusions.servebeer.com$all
Filter updated: Sat, 12 Jun 2021 00:25:37 UTC
2021-06-12 00:25:37 +00:00
||allweednedislove.byethost6.com$all
Filter updated: Tue, 03 Aug 2021 00:01:58 +0000
2021-08-03 00:01:58 +00:00
||alonazohar.co.il$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||alpha-mail-server2.ddns.info$all
||alquileres.com.py$all
Filter updated: Thu, 14 Jan 2021 12:06:32 UTC
2021-01-14 12:06:32 +00:00
||alquilervillora.net$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||alservic-tirmiles.blogspot.com$all
Filter updated: Sat, 31 Jul 2021 12:01:55 +0000
2021-07-31 12:01:55 +00:00
||alsofft.com$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||alsope.covidharsh.com$all
||altami.biz.ua$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||alternanetworks-my.sharepoint.com/:o:/g/personal/thomas_salemkour_open-xerox_com/eq5ps-07ovvnl5eo4rrthymb7a9euvzss3urntui3dvyyq?e=kqnstw$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||alumdecor.ru$all
Filter updated: Fri, 03 Sep 2021 00:01:54 +0000
2021-09-03 00:01:55 +00:00
||alumnimkn.ulm.ac.id$all
Filter updated: Tue, 14 Sep 2021 12:01:44 +0000
2021-09-14 12:01:44 +00:00
||am.mskms.top$all
Filter updated: Thu, 09 Sep 2021 00:01:56 +0000
2021-09-09 00:01:56 +00:00
||amaazoo.top$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||amacon.serviy-jp.cc$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||amaens.ortsdf3.top$all
Filter updated: Fri, 24 Sep 2021 12:02:36 +0000
2021-09-24 12:02:36 +00:00
||amaeous.qwrg7.top$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||amaeoz.rifgt3.xyz$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||amaeuo.tromfd3.xyz$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||amaicon-update.njbxss.ga$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||amanes.bmfjk2.top$all
Filter updated: Fri, 17 Sep 2021 00:01:45 +0000
2021-09-17 00:01:46 +00:00
||amanikibera.co.ke$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||amanue.opqwv5.top$all
Filter updated: Fri, 24 Sep 2021 12:02:36 +0000
2021-09-24 12:02:36 +00:00
||amanznon.co.zp.pnzshop.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||amanzon.co.ip.jpxkpfm.cn$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||amanzon.co.ip.lezhongtao.com.cn$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||amanzon.co.ip.liansainan.com.cn$all
||amaoue.dsajg5.top$all
Filter updated: Fri, 10 Sep 2021 00:02:17 +0000
2021-09-10 00:02:17 +00:00
||amarillovision.net$all
Filter updated: Thu, 01 Jul 2021 00:01:46 +0000
2021-07-01 00:01:46 +00:00
||amaterasu.de$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||amaueo.nerfgd6.xyz$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||amauser.memberupdata.top$all
Filter updated: Fri, 15 Jan 2021 00:06:14 UTC
2021-01-15 00:06:14 +00:00
||amaxcarrentals.com.au$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||amayzo.com$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||amaz0.jpj.wlxio.com.cn$all
Filter updated: Wed, 08 Sep 2021 12:01:51 +0000
2021-09-08 12:01:51 +00:00
||amazedelectrical.com.au$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||amazno.j.primyonline.net.cn$all
||amazno.jjp.ldexpo.com.cn$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||amaznon.co.ip.dfdshop.com$all
Filter updated: Fri, 24 Sep 2021 12:02:36 +0000
2021-09-24 12:02:36 +00:00
||amaznon.co.ip.qumshop.com$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||amaznon.co.ip.tgvshop.com$all
Filter updated: Fri, 24 Sep 2021 12:02:36 +0000
2021-09-24 12:02:36 +00:00
||amaznon.co.ip.yiy1hp.cn$all
Filter updated: Tue, 21 Sep 2021 00:01:40 +0000
2021-09-21 00:01:40 +00:00
||amazoe.soonn.xyz$all
Filter updated: Mon, 20 Sep 2021 00:01:41 +0000
2021-09-20 00:01:41 +00:00
||amazom.ahmengcheng.cn$all
Filter updated: Fri, 17 Sep 2021 12:01:51 +0000
2021-09-17 12:01:52 +00:00
||amazom.bophpj.shop$all
Filter updated: Sat, 18 Sep 2021 12:01:34 +0000
2021-09-18 12:01:34 +00:00
||amazom.gmhsyx.cn$all
Filter updated: Mon, 20 Sep 2021 00:01:41 +0000
2021-09-20 00:01:41 +00:00
||amazom.ideainternational.cn$all
Filter updated: Sat, 10 Apr 2021 00:06:30 UTC
2021-04-10 00:06:30 +00:00
||amazon-co-jp.wzq997.top$all
Filter updated: Sun, 18 Apr 2021 12:06:55 UTC
2021-04-18 12:06:55 +00:00
||amazon-co-jp.youtian8332.vip$all
||amazon-co-jp.youtian8351.vip$all
||amazon-co-jp.youtian8353.vip$all
Filter updated: Mon, 19 Apr 2021 00:06:54 UTC
2021-04-19 00:06:54 +00:00
||amazon-co-jp.youtian8356.vip$all
Filter updated: Sun, 19 Sep 2021 12:01:34 +0000
2021-09-19 12:01:35 +00:00
||amazon-co.1asrss.cn$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||amazon-co.5deij1.cn$all
Filter updated: Wed, 22 Sep 2021 12:01:56 +0000
2021-09-22 12:01:56 +00:00
||amazon-co.jgdcqc.cn$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||amazon-co.kk0nrs.cn$all
Filter updated: Wed, 15 Sep 2021 12:01:46 +0000
2021-09-15 12:01:46 +00:00
||amazon-co.p3nivl0.cn$all
Filter updated: Wed, 22 Sep 2021 12:01:56 +0000
2021-09-22 12:01:56 +00:00
||amazon-co.rgkcbf.cn$all
Filter updated: Fri, 24 Sep 2021 12:02:36 +0000
2021-09-24 12:02:36 +00:00
||amazon-co.vvckrz.cn$all
Filter updated: Wed, 22 Sep 2021 12:01:56 +0000
2021-09-22 12:01:56 +00:00
||amazon-co.xsyidna.cn$all
||amazon-co.ynrkzn.cn$all
||amazon-co.yxrszx.cn$all
Filter updated: Sat, 20 Mar 2021 00:06:31 UTC
2021-03-20 00:06:31 +00:00
||amazon-gcatech.com$all
Filter updated: Sat, 18 Sep 2021 00:14:48 +0000
2021-09-18 00:14:48 +00:00
||amazon-jp.nllk.shop$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||amazon-jpamazon.com$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||amazon-prime.a3bpk6.cn$all
Filter updated: Wed, 22 Sep 2021 12:01:56 +0000
2021-09-22 12:01:56 +00:00
||amazon-prime.aq03oh.cn$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||amazon.co.ip.pucoda.cn$all
Filter updated: Sat, 18 Sep 2021 12:01:34 +0000
2021-09-18 12:01:34 +00:00
||amazon.gbvazsz.cn$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||amazon.haowec.club$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||amazon404.redirectme.net$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||amazonfieuytqwsdjfg.xyz$all
Filter updated: Thu, 01 Oct 2020 00:14:14 UTC
2020-10-01 00:14:14 +00:00
||amazonlogistics-ap-northeast-1.amazonlogistics.jp$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||amazoo.jp.triumbest.net.cn$all
||amazpo.piojp.adminos.net.cn$all
Filter updated: Tue, 29 Jun 2021 00:01:48 +0000
2021-06-29 00:01:48 +00:00
||amber.com.ph$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||ambienteprotegido.foregon.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||ambrosecourt.com/our/ourtime/ourtime.html$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||amcgardiennage.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||amenainvest-my.sharepoint.com/personal/sebastiangerlach_amena-invest_de/_layouts/15/authenticate.aspx$all
Filter updated: Fri, 27 Aug 2021 12:01:40 +0000
2021-08-27 12:01:40 +00:00
||ameport.dattaweb.com$all
Filter updated: Tue, 12 Jan 2021 12:06:44 UTC
2021-01-12 12:06:44 +00:00
||ameport.org$all
Filter updated: Mon, 20 Sep 2021 12:02:05 +0000
2021-09-20 12:02:05 +00:00
||americanexpxzess.cn$all
Filter updated: Wed, 22 Sep 2021 12:01:56 +0000
2021-09-22 12:01:56 +00:00
||americatxexpress.cn$all
Filter updated: Tue, 21 Sep 2021 00:01:40 +0000
2021-09-21 00:01:40 +00:00
||americatxexpress.com$all
Filter updated: Wed, 01 Sep 2021 00:02:20 +0000
2021-09-01 00:02:20 +00:00
||americcovcare.com$all
Filter updated: Tue, 17 Aug 2021 00:02:45 +0000
2021-08-17 00:02:45 +00:00
||americcovrescue.com$all
Filter updated: Thu, 29 Jul 2021 00:01:57 +0000
2021-07-29 00:01:57 +00:00
||amerinie47.ultimatefreehost.in$all
Filter updated: Sun, 19 Sep 2021 00:02:16 +0000
2021-09-19 00:02:17 +00:00
||ameueaom.szrikoda.cn$all
||ameueaom.szvernejudith2.cn$all
||ameueaom.tiantiangxjs18.cn$all
||ameueaom.tongjun208.cn$all
||ameueaom.wd3v6v.cn$all
||ameueaom.xiwuehgn.cn$all
||ameueaom.yamatake123.cn$all
||ameueaom.yudingda123.cn$all
Filter updated: Thu, 15 Oct 2020 12:06:30 UTC
2020-10-15 12:06:30 +00:00
||amguevara.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||amidabuli.com$all
Filter updated: Sat, 26 Jun 2021 00:06:14 +0000
2021-06-26 00:06:14 +00:00
||amitydiamonds.com$all
Filter updated: Fri, 24 Sep 2021 12:02:36 +0000
2021-09-24 12:02:36 +00:00
||ammaz0m.co.jp.x5w5ne.cn$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||ammmaz0.jp.jiajiaxing.net.cn$all
||amous.servepics.com$all
Filter updated: Thu, 15 Oct 2020 00:06:34 UTC
2020-10-15 00:06:34 +00:00
||amozanm-rrbrb.cc$all
||amozanm-rrere.cc$all
Filter updated: Wed, 19 May 2021 00:06:43 UTC
2021-05-19 00:06:44 +00:00
||amprojanitorial.com$all
Filter updated: Sat, 17 Jul 2021 12:01:37 +0000
2021-07-17 12:01:37 +00:00
||ams-eg.com$all
Filter updated: Fri, 06 Aug 2021 00:01:52 +0000
2021-08-06 00:01:52 +00:00
||ams3.digitaloceanspaces.com/njk/25_40_24_5e_40_26_40_26_28_29_23_23_5e_23_24_26_5e_25_26_40_5e_28_23_26.html$all
Filter updated: Thu, 23 Sep 2021 00:02:18 +0000
2021-09-23 00:02:18 +00:00
||ams3.digitaloceanspaces.com/offonline2ret/index.html$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||ams3.digitaloceanspaces.com/onenotedrive2/index.html$all
Filter updated: Wed, 08 Sep 2021 12:01:51 +0000
2021-09-08 12:01:51 +00:00
||amtodnshi63.aonmthis.top$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||amybwt.covidharsh.com$all
Filter updated: Wed, 22 Sep 2021 00:02:26 +0000
2021-09-22 00:02:26 +00:00
||amznoa.china-schools.net.cn$all
Filter updated: Tue, 14 Sep 2021 00:01:48 +0000
2021-09-14 00:01:48 +00:00
||amzona.tal0la9.cn$all
Filter updated: Thu, 23 Sep 2021 00:02:18 +0000
2021-09-23 00:02:18 +00:00
||amzonweuysdgfsdjkfgh.xyz$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||amzoz.jp.3dstation.net.cn$all
||amzyio.jp.hk-mail.net.cn$all
Filter updated: Thu, 15 Jul 2021 12:01:53 +0000
2021-07-15 12:01:53 +00:00
||anabolic-online.com$all
Filter updated: Mon, 16 Aug 2021 12:01:42 +0000
2021-08-16 12:01:42 +00:00
||analyticsfantasticv1.azurewebsites.net$all
Filter updated: Tue, 14 Sep 2021 12:01:44 +0000
2021-09-14 12:01:44 +00:00
||anama.qwlju.cn$all
Filter updated: Sat, 22 May 2021 12:07:44 UTC
2021-05-22 12:07:44 +00:00
||anamoreno27041.vzpla.net$all
Filter updated: Wed, 15 Sep 2021 00:01:54 +0000
2021-09-15 00:01:55 +00:00
||anandsr-dev.github.io$all
Filter updated: Fri, 04 Dec 2020 00:06:15 UTC
2020-12-04 00:06:16 +00:00
||anarchitecturestudio.com$all
Filter updated: Thu, 29 Jul 2021 00:01:57 +0000
2021-07-29 00:01:57 +00:00
||anazno.co.ip.6.cn$all
Filter updated: Fri, 26 Mar 2021 00:06:40 UTC
2021-03-26 00:06:40 +00:00
||andersonstrategic.com.au$all
Filter updated: Tue, 17 Aug 2021 12:01:39 +0000
2021-08-17 12:01:39 +00:00
||andhraelec.com$all
Filter updated: Sat, 08 May 2021 12:06:36 UTC
2021-05-08 12:06:36 +00:00
||andishenegah.ir$all
Filter updated: Wed, 16 Jun 2021 00:06:45 +0000
2021-06-16 00:06:45 +00:00
||andre-leone.format.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||andromedamoto.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||anekaslot.com/jps/webmail_reset.htm$all
||angularjs-qgoay2.stackblitz.io$all
Filter updated: Tue, 21 Sep 2021 00:01:40 +0000
2021-09-21 00:01:40 +00:00
||anj-azakp.run.goorm.io$all
Filter updated: Sat, 19 Jun 2021 12:06:28 +0000
2021-06-19 12:06:28 +00:00
||anjalijha167.github.io$all
Filter updated: Sun, 05 Sep 2021 00:02:15 +0000
2021-09-05 00:02:15 +00:00
||anjuliveda.de$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||annarborhandsonmuseum-my.sharepoint.com/personal/jklute_aahom_org/_layouts/15/wopiframe.aspx?sourcedoc={32b08432-df6e-45ce-b9dd-bd06a2fd8ffc}&action=default&originalpath=ahr0chm6ly9hbm5hcmjvcmhhbmrzb25tdxnldw0tbxkuc2hhcmvwb2ludc5jb20vom86l2cvcgvyc29uywwvamtsdxrlx2fhag9tx29yzy9faktfc0rkdtm4nuz1zdi5qnfmowpfd0j2u3ewwjvxag1isnnittdkdvg4rdbrp3j0aw1lptnhmwxmtui0mtbn$all
||annarborhandsonmuseum-my.sharepoint.com/personal/jklute_aahom_org/_layouts/15/wopiframe2.aspx?sourcedoc={32b08432-df6e-45ce-b9dd-bd06a2fd8ffc}&action=default&originalpath=ahr0chm6ly9hbm5hcmjvcmhhbmrzb25tdxnldw0tbxkuc2hhcmvwb2ludc5jb20vom86l2cvcgvyc29uywwvamtsdxrlx2fhag9tx29yzy9faktfc0rkdtm4nuz1zdi5qnfmowpfd0j2u3ewwjvxag1isnnittdkdvg4rdbrp3j0aw1lptnhmwxmtui0mtbn$all
||anniewright-my.sharepoint.com/:x:/r/personal/mary_belisle_aw_org/_layouts/15/wopiframe.aspx?guestaccesstoken=rxpjqbfln4drfnv4sgfnnqwyldsjbnceldcpqdpe7hu%3d&docid=1_120e0a15e74f24c589d87788d99c1c667&wdformid=%7b493b5cd7%2d227e%2d4339%2d98b3%2da8644c8ce588%7d&action=formsubmit$all
Filter updated: Sat, 11 Sep 2021 00:34:15 +0000
2021-09-11 00:34:15 +00:00
||annmozan.co.jo.hmibi3q.cn$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||anpassungs-zentrum24.xyz$all
Filter updated: Wed, 22 Sep 2021 00:02:26 +0000
2021-09-22 00:02:26 +00:00
||anrazon.szzuosi.cn$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||antaresns.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||antifrode-sicurezza.000webhostapp.com$all
Filter updated: Wed, 09 Sep 2020 12:06:53 UTC
2020-09-09 12:06:53 +00:00
||antiguatabernaqueirolo.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||antrorse-searches.000webhostapp.com$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||anvpwy.covidharsh.com$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||anzhelika25genesh.com$all
Filter updated: Fri, 24 Sep 2021 00:01:50 +0000
2021-09-24 00:01:51 +00:00
||aocn.careord.com$all
Filter updated: Thu, 09 Sep 2021 12:02:27 +0000
2021-09-09 12:02:27 +00:00
||aoeecsmc.aovmeo.com$all
Filter updated: Thu, 09 Sep 2021 00:01:56 +0000
2021-09-09 00:01:56 +00:00
||aomces.aovmeo.com$all
Filter updated: Thu, 23 Sep 2021 00:02:18 +0000
2021-09-23 00:02:18 +00:00
||aomnzcz.000webhostapp.com$all
Filter updated: Thu, 09 Sep 2021 12:02:27 +0000
2021-09-09 12:02:27 +00:00
||aomsce.aovmeo.com$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||aonn-jp-addmazsdon.shop$all
Filter updated: Tue, 14 Sep 2021 12:01:44 +0000
2021-09-14 12:01:44 +00:00
||aoyeanm.yeovessn.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||ap-login.com$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||apbxkc.covidharsh.com$all
Filter updated: Fri, 17 Sep 2021 12:01:51 +0000
2021-09-17 12:01:52 +00:00
||api.addthis.com/oexchange/0.8/wrap/opengraph?url=ahr0chm6ly93zxetnmrlodiud2vilmfwcc8znzg1mje5lze1lziwmjfjdw5plmn6nto1nibbttu6ntygqu13zwjtyxn0zxi5lze1lziwmjeznzg1mjfjdw5plmn6nto1nibbttu6ntygqu13zwjtyxn0zxiznzg1mje5lze1lziwmjfjdw5plmn6nto1nibbttu6ntygqu0znzg1mjf3zwjtyxn0zxi5lze1lziwmjfjdw5plmn6nto1nibbttm3oduymtu6ntygqu13zwjtyxn0zxiznzg1mjejd2vibwfzdgvyqgn1bmkuy3o=$all
Filter updated: Sun, 05 Sep 2021 12:01:36 +0000
2021-09-05 12:01:37 +00:00
||api.addthis.com/oexchange/0.8/wrap/opengraph?url=ahr0chm6ly9ua3yuchvil3h5nt83oet4elzsag1mzndzjmfsdd1tzwrpysnav2x0wvhomfpvqnpkr2x1y0hkcgvtrxvim0puolbcy3ppmu4yzgrladg2ennfduhvdu02qxphujjmuhv5zw5ork5ecvu=$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||api.bdisl.com/redirect?s=857592&at=4&rt=api&o=37248906&s1=2d8a1db7066ae145-5e70fb7b763882480f1ffb01&s2=&s3=$all
||api.bdisl.com/redirect?s=857592&at=4&rt=api&o=96574574&s1=d2cb2653d154e850-5ea5960ca629f275326f9e81&s2=&s3=$all
||api.bdisl.com/redirect?s=857592&at=4&rt=api&o=96668170&s1=2b94eb26dd71a6e0-5ea5961f20937a71e917f602&s2=&s3=$all
Filter updated: Sat, 18 Sep 2021 00:14:48 +0000
2021-09-18 00:14:48 +00:00
||api.exqodus.com$all
Filter updated: Thu, 04 Feb 2021 00:06:18 UTC
2021-02-04 00:06:18 +00:00
||api.stasto.eu$all
Filter updated: Tue, 18 May 2021 12:06:47 UTC
2021-05-18 12:06:47 +00:00
||apicola.eu$all
Filter updated: Fri, 24 Sep 2021 00:01:50 +0000
2021-09-24 00:01:51 +00:00
||apidgornagenesh.com$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||apkandroid.ru/caja-de-herramientas/mx.com.vepormas.cajadeherramientas/downloading.html$all
Filter updated: Tue, 27 Jul 2021 00:02:10 +0000
2021-07-27 00:02:10 +00:00
||apkfun.com/reale-seguros.html$all
Filter updated: Wed, 28 Oct 2020 00:06:13 UTC
2020-10-28 00:06:13 +00:00
||apoga.net$all
Filter updated: Tue, 12 Jan 2021 00:06:08 UTC
2021-01-12 00:06:08 +00:00
||app-dec-access.com$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||app-metam.top$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||app-opensea.io$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||app.box.com/s/43l7nxncafyxdiaecwxblt0yo2hn7epz$all
||app.box.com/s/aju8uu3l7x4uusi7v53z09uk6rvwd161$all
||app.box.com/s/b9fu9axf9rcv7bhjp80fpcm8zna5wcwi$all
||app.box.com/s/bog5q0dw9nxw2zs7e01m5y6zw23oeszj$all
||app.box.com/s/x6agocx9zvj049azirk4aw3xrqdedqhl$all
||app.box.com/s/ymr0ltw3hmn8icxebz16gjhcyhqa49w4$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||app.data.box.voice.call.menshealthideas.com$all
Filter updated: Sat, 14 Aug 2021 12:02:02 +0000
2021-08-14 12:02:02 +00:00
||app.digitaledunet.com/bin/connect.api.bank.of.america.com.secure.auth.dashboard.auto.sign.in.user.info.webmai1.id/b0fa/4da68e36/$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||app.duel.network$all
||app.infomovil.digital$all
Filter updated: Wed, 23 Jun 2021 12:06:29 +0000
2021-06-23 12:06:29 +00:00
||app.n26.com.sicurezzadeldati.com$all
Filter updated: Fri, 02 Jul 2021 00:01:50 +0000
2021-07-02 00:01:51 +00:00
||app.n26.com.verificatoinformazioni.com$all
Filter updated: Tue, 16 Feb 2021 12:06:31 UTC
2021-02-16 12:06:31 +00:00
||app.pandadoc.com/p/96f48ddb9415f1307e22c50a18ad07c1785a5164?$all
Filter updated: Tue, 07 Sep 2021 12:01:49 +0000
2021-09-07 12:01:49 +00:00
||app.simplenote.com/p/22f3qw$all
||app.simplenote.com/p/cmxgsj$all
||app.simplenote.com/p/lhwhl9$all
||app.simplenote.com/publish/xhrdvc$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||app.stathisroussos.gr$all
Filter updated: Thu, 16 Sep 2021 12:02:15 +0000
2021-09-16 12:02:15 +00:00
||app.sugarsync.com$all
||app.surveymethods.com/enduser.aspx?aa8ee2fdabeef7fcaf$all
||app.surveymethods.com/enduser.aspx?dffb9788de948a8bdd$all
||app.surveymethods.com/enduser.aspx?f9ddb1aef8b2adacff$all
Filter updated: Fri, 24 Sep 2021 00:01:50 +0000
2021-09-24 00:01:51 +00:00
||app.yusraglobai.com$all
Filter updated: Thu, 18 Feb 2021 12:07:12 UTC
2021-02-18 12:07:12 +00:00
||app28.greenmail.co.in$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||app44666604777.blogspot.com$all
||app66560000.blogspot.com$all
Filter updated: Sun, 07 Feb 2021 00:06:51 UTC
2021-02-07 00:06:51 +00:00
||appatualizecef.com$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||appcaixaassinatura.com$all
Filter updated: Sat, 17 Jul 2021 12:01:37 +0000
2021-07-17 12:01:37 +00:00
||appcefseguros.me$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||appeal-page-unpublish1107276.web.app$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||appeal-page-unpublish182758.web.app$all
||appeal-page-unpublish1827586.web.app$all
Filter updated: Fri, 24 Sep 2021 00:01:50 +0000
2021-09-24 00:01:51 +00:00
||appeal-page-unpublish182759.web.app$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||appeal-page-unpublish1827890.web.app$all
||appeal-page-unpublish187-36ac4.web.app$all
Filter updated: Wed, 22 Sep 2021 12:01:56 +0000
2021-09-22 12:01:56 +00:00
||appeal-page-unpublish18769.web.app$all
Filter updated: Thu, 10 Sep 2020 12:06:46 UTC
2020-09-10 12:06:46 +00:00
||appieid.us.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||apple.com.services-and-support.com$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||applebankny.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||appleverificationalert.com$all
Filter updated: Mon, 07 Jun 2021 00:06:20 UTC
2021-06-07 00:06:20 +00:00
||appurl.io/2skowwypyb$all
Filter updated: Tue, 21 Sep 2021 00:01:40 +0000
2021-09-21 00:01:40 +00:00
||appurl.io/6dfhh1yrol$all
Filter updated: Fri, 13 Aug 2021 00:01:48 +0000
2021-08-13 00:01:48 +00:00
||appurl.io/fuppf4qa9u$all
Filter updated: Tue, 27 Jul 2021 00:02:10 +0000
2021-07-27 00:02:10 +00:00
||appurl.io/gwcwfaxmun$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||appurl.io/izmlfzanc-$all
Filter updated: Thu, 26 Aug 2021 00:02:01 +0000
2021-08-26 00:02:01 +00:00
||appurl.io/k8hy2cvo8x$all
Filter updated: Wed, 22 Sep 2021 00:02:26 +0000
2021-09-22 00:02:26 +00:00
||appurl.io/wywajnlbtl$all
Filter updated: Thu, 19 Aug 2021 12:02:33 +0000
2021-08-19 12:02:33 +00:00
||appurl.io/xiwmghfmg3$all
Filter updated: Thu, 23 Sep 2021 00:02:18 +0000
2021-09-23 00:02:18 +00:00
||aprilia69genesh.com$all
||apruiz09genesh.com$all
Filter updated: Wed, 11 Aug 2021 12:01:50 +0000
2021-08-11 12:01:50 +00:00
||aqse.in$all
Filter updated: Sat, 30 Jan 2021 00:06:43 UTC
2021-01-30 00:06:43 +00:00
||aqtv.tv$all
Filter updated: Sun, 01 Aug 2021 00:01:58 +0000
2021-08-01 00:01:59 +00:00
||aquapura-eg.com$all
Filter updated: Mon, 26 Jul 2021 00:02:16 +0000
2021-07-26 00:02:17 +00:00
||arafathrumman.github.io$all
Filter updated: Wed, 15 Sep 2021 00:01:54 +0000
2021-09-15 00:01:55 +00:00
||arawan45.com$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||arcacg.com$all
Filter updated: Tue, 22 Jun 2021 12:06:51 +0000
2021-06-22 12:06:51 +00:00
||archive.behappyevent.com/dnes_9s?tdx_br=a4fwlnblbgkcla6mwjyyaiz1ykkkwkzfamcaqhy0j2ljagriypuu/margareta.nordstrand%40er.lu.se$all
Filter updated: Fri, 25 Jun 2021 12:06:17 +0000
2021-06-25 12:06:17 +00:00
||archive.behappyevent.com/tvok_6r?kha_dn=a4fwlnfrbgkclyv1wm5paicjykcdomzjb4crpx9xkwpfbgkjy31yjmpkaigd/norzaihan.norhashim@qsrbrands.com.my$all
Filter updated: Wed, 02 Jun 2021 00:06:23 UTC
2021-06-02 00:06:23 +00:00
||archivio-supporto.sitoper.it$all
Filter updated: Sun, 06 Sep 2020 12:06:39 UTC
2020-09-06 12:06:39 +00:00
||arcomindia.com$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||areacliente-verificar-tarjeta-caixabank.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||areueaom.64c6ac9.cn$all
Filter updated: Tue, 21 Sep 2021 12:02:11 +0000
2021-09-21 12:02:11 +00:00
||areueaom.dnoq3t.cn$all
||areueaom.mmn3xl.cn$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||areyourobotornot.blogspot.com$all
Filter updated: Tue, 09 Feb 2021 12:06:34 UTC
2021-02-09 12:06:34 +00:00
||argenahomebanqbe.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||argus-garage-doors-repair.com$all
Filter updated: Wed, 15 Sep 2021 00:01:54 +0000
2021-09-15 00:01:55 +00:00
||arihantpharmacy.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||arisebuildscom-my.sharepoint.com/:o:/g/personal/gene_arisebuilds_com/eggkjirnlknoh4k8dkclnxcbpfg-oj1ihz4vpywlomnezw?e=gqgvfz$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||arislm.com$all
Filter updated: Wed, 28 Apr 2021 12:07:34 UTC
2021-04-28 12:07:34 +00:00
||armatheatre.org$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||armyeitaas.sharepoint-mil.us$all
||arnaozn.lilml.com$all
Filter updated: Sat, 18 Sep 2021 00:14:48 +0000
2021-09-18 00:14:48 +00:00
||arnczom.co.jp.s9qh7ud.cn$all
Filter updated: Fri, 24 Sep 2021 12:02:36 +0000
2021-09-24 12:02:36 +00:00
||arnzn-co.y3e7pq2.cn$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||arnzsikpln.club$all
||arnzsiktln.club$all
||arnzsilyln.club$all
||arnzsilzln.club$all
Filter updated: Wed, 25 Aug 2021 12:02:06 +0000
2021-08-25 12:02:07 +00:00
||aro365539014-my.sharepoint.com/:b:/g/personal/brittany_rivertownfinance_com/ebd7xlmfefbajikalhwkrw4bj9qm2y55sehnafmgtfcdvg?e=4*3ariqguh&at=9$all
Filter updated: Sat, 20 Mar 2021 12:06:17 UTC
2021-03-20 12:06:17 +00:00
||aromatic.webenliven.in$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||aronwebsolutions.com$all
Filter updated: Thu, 09 Sep 2021 00:01:56 +0000
2021-09-09 00:01:56 +00:00
||aroueaom.hcchzd.cn$all
Filter updated: Tue, 31 Aug 2021 12:01:54 +0000
2021-08-31 12:01:54 +00:00
||arquimbau.clinicaspresidental.com$all
Filter updated: Thu, 05 Aug 2021 00:02:05 +0000
2021-08-05 00:02:05 +00:00
||arris.surveysparrow.com$all
Filter updated: Tue, 24 Aug 2021 00:02:23 +0000
2021-08-24 00:02:24 +00:00
||arrizonaa.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||arrow.kvalitne.cz$all
Filter updated: Thu, 03 Sep 2020 12:06:37 UTC
2020-09-03 12:06:37 +00:00
||arrowcase.com$all
Filter updated: Sat, 18 Sep 2021 00:14:48 +0000
2021-09-18 00:14:48 +00:00
||arsnzam.000webhostapp.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||artekcamp.tumblr.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||artemisbetguncel.blogspot.com$all
||artemissbet.blogspot.com$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||artesimpresas.com$all
Filter updated: Thu, 31 Dec 2020 12:06:18 UTC
2020-12-31 12:06:18 +00:00
||articles.investing-fund.com$all
Filter updated: Thu, 02 Sep 2021 12:02:02 +0000
2021-09-02 12:02:02 +00:00
||artificial-connect.de$all
Filter updated: Wed, 18 Aug 2021 00:01:50 +0000
2021-08-18 00:01:50 +00:00
||artificialconnect.com/s/anmeldung.php$all
Filter updated: Thu, 16 Sep 2021 00:01:52 +0000
2021-09-16 00:01:52 +00:00
||artificialconnect.com/s/anmeldung.php?starten=4geqwfau8kaypmmfbcrv0zhhxbrd7q&shuffluri?=csmdd37bht6zgxq2ijem$all
Filter updated: Tue, 17 Aug 2021 00:02:45 +0000
2021-08-17 00:02:45 +00:00
||artificialconnect.de$all
Filter updated: Tue, 27 Jul 2021 00:02:10 +0000
2021-07-27 00:02:10 +00:00
||artogesres.byethost7.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||aruba-iv.blogspot.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||aruba-iv.blogspot.com/?m=1$all
Filter updated: Fri, 20 Aug 2021 12:01:48 +0000
2021-08-20 12:01:48 +00:00
||ascensoresyaireacondicionado.com$all
Filter updated: Wed, 11 Nov 2020 12:06:45 UTC
2020-11-11 12:06:45 +00:00
||ascent-scaffolding.co.uk$all
Filter updated: Fri, 09 Jul 2021 00:01:59 +0000
2021-07-09 00:01:59 +00:00
||asdkjalasjdkhfad.byethost33.com$all
Filter updated: Thu, 19 Aug 2021 00:01:47 +0000
2021-08-19 00:01:47 +00:00
||asesoriaforonda.com$all
Filter updated: Wed, 15 Sep 2021 12:01:46 +0000
2021-09-15 12:01:46 +00:00
||asf.mfvhnrt17z.workers.dev$all
Filter updated: Tue, 21 Sep 2021 00:01:40 +0000
2021-09-21 00:01:40 +00:00
||asgard-ampqy.run-us-west2.goorm.io$all
Filter updated: Mon, 11 Jan 2021 12:06:44 UTC
2021-01-11 12:06:44 +00:00
||ash14213.mfs.gg$all
Filter updated: Sun, 20 Jun 2021 00:06:25 +0000
2021-06-20 00:06:25 +00:00
||ashleygracebridal.com$all
Filter updated: Wed, 16 Sep 2020 00:06:28 UTC
2020-09-16 00:06:29 +00:00
||asiadiscoversolutions.azureedge.net$all
Filter updated: Fri, 24 Sep 2021 12:02:36 +0000
2021-09-24 12:02:36 +00:00
||asiandrama.ge$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||asiastarchsolutions.com$all
Filter updated: Sun, 14 Mar 2021 00:12:43 UTC
2021-03-14 00:12:43 +00:00
||asiiadinova.goosecreektradingpost.com/dropbx$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||asiiadinova.goosecreektradingpost.com/dropbx/mrrivfqsx0w56yjs2n12ktqjai9rntduscz8tuksuljc9aqnx1hcetketfhhcuobuyrx1tde7ar$all
||asiiadinova.goosecreektradingpost.com/dropbx/mrrivfqsx0w56yjs2n12ktqjai9rntduscz8tuksuljc9aqnx1hcetketfhhcuobuyrx1tde7ar/$all
||asiiadinova.goosecreektradingpost.com/dropbx/zydqa2rp1pbhn5jfl8pcnq7rcox3i2ombnku03sbwoybgnquohbtmjtpe8mspvambxifeafwhez$all
||asiiadinova.goosecreektradingpost.com/dropbx/zydqa2rp1pbhn5jfl8pcnq7rcox3i2ombnku03sbwoybgnquohbtmjtpe8mspvambxifeafwhez/$all
Filter updated: Sun, 19 Sep 2021 00:02:16 +0000
2021-09-19 00:02:17 +00:00
||asistente6645.sytes.net$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||asistentevirtual.byethost22.com$all
Filter updated: Wed, 31 Mar 2021 12:06:47 UTC
2021-03-31 12:06:47 +00:00
||askarmotorluaraclar.com$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||asmfol.covidharsh.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||asociacionvalleitata.cl/mua/179.33.163.252999/sucursalpersonas.transaccionesbancolombia.com/mua/index.html$all
||asociacionvalleitata.cl/mua/181.50.102.866735/sucursalpersonas.transaccionesbancolombia.com/mua$all
||asociacionvalleitata.cl/mua/181.50.102.866735/sucursalpersonas.transaccionesbancolombia.com/mua/$all
||asociacionvalleitata.cl/wp-content/plugins/qillktqudx/access/wells-fargo-new-rd396$all
Filter updated: Fri, 15 Jan 2021 00:06:14 UTC
2021-01-15 00:06:14 +00:00
||asorange.fr$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||asp403r.paperless.com.pe$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||assetbarcodetags.com$all
Filter updated: Thu, 10 Sep 2020 12:06:46 UTC
2020-09-10 12:06:46 +00:00
||assets.cdnxz.com$all
Filter updated: Mon, 02 Aug 2021 12:01:44 +0000
2021-08-02 12:01:44 +00:00
||assistance-paiement-securise-leboncoin.com$all
Filter updated: Fri, 16 Oct 2020 00:06:22 UTC
2020-10-16 00:06:22 +00:00
||assistenzaintesaonline.com$all
Filter updated: Fri, 11 Sep 2020 00:06:45 UTC
2020-09-11 00:06:45 +00:00
||assoalhosmadeiras.blogspot.com/?m=1$all
Filter updated: Thu, 16 Sep 2021 12:02:15 +0000
2021-09-16 12:02:15 +00:00
||astorehub.com$all
Filter updated: Tue, 21 Sep 2021 00:01:40 +0000
2021-09-21 00:01:40 +00:00
||astrohemalath.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||asyabahisgiris1.blogspot.com$all
Filter updated: Thu, 18 Feb 2021 12:07:12 UTC
2021-02-18 12:07:12 +00:00
||atagucsea.com/wp-content/themes/twentyfifteen/cloud9/gucemail$all
Filter updated: Sun, 13 Sep 2020 00:07:18 UTC
2020-09-13 00:07:18 +00:00
||atagucsea.com/wp-content/themes/twentyfifteen/cloud9/gucemail/$all
||atagucsea.com/wp-content/themes/twentyfifteen/guce.advertising/8736443$all
||atagucsea.com/wp-content/themes/twentyfifteen/guce.advertising/8736443/$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||atefnet.com/js/calendar/login/customer_center/customer-idpp00c699/$all
||atefnet.com/js/calendar/login/customer_center/customer-idpp00c699/myaccount/signin/?country.x=us&locale.x=en_us$all
Filter updated: Mon, 26 Jul 2021 12:02:00 +0000
2021-07-26 12:02:00 +00:00
||atendentedaycoval.no.comunidades.net$all
Filter updated: Thu, 23 Sep 2021 00:02:18 +0000
2021-09-23 00:02:18 +00:00
||atendimento-aocliente.com$all
Filter updated: Thu, 22 Apr 2021 00:06:42 UTC
2021-04-22 00:06:42 +00:00
||atendimento-digital.ga$all
Filter updated: Mon, 22 Feb 2021 00:09:17 UTC
2021-02-22 00:09:17 +00:00
||atendimentoltau24hrs.com$all
Filter updated: Sat, 06 Feb 2021 00:06:52 UTC
2021-02-06 00:06:53 +00:00
||ativacao-online73681.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||atmostechnology-my.sharepoint.com/personal/amalia_atmostechnology_co_uk/_layouts/15/wopiframe.aspx?guestaccesstoken=uiyaiqprc2ikxq0mezirqthais%2fdp9mp1hyqhjkscj0%3d&docid=1_1cbd4797f2749435a8f30af1a3f2d36b5&wdformid=%7b890161c9%2deb6d%2d44fc%2d9a59%2d0e4400a27203%7d&action=formsubmit$all
||atriumlandscape-my.sharepoint.com/:x:/r/personal/sue_atriumlandscape_com/_layouts/15/wopiframe.aspx?guestaccesstoken=f77ihhc%2fxkig6gfhqiddogtmjqoxm0%2fq%2bb2euyif%2bri%3d&docid=1_1c9c826e0945c4aae87a3cf1547b535ab&wdformid=%7b3565fd77%2dd37d%2d4ccf%2db660%2d25cb35a12799%7d&action=formsubmit$all
||atriumlandscape-my.sharepoint.com/:x:/r/personal/sue_atriumlandscape_com/_layouts/15/wopiframe.aspx?guestaccesstoken=nrg8nkxnkyji2axm9efekdi62u6cuvrsxcypzfz9jay=&docid=1_10932d3dd2ac2478f833ee56388ecb767&wdformid={faebec1d-bc38-42bf-be94-47ebb62d7501}&action=formsubmit$all
||atriumlandscape-my.sharepoint.com/personal/sue_atriumlandscape_com/_layouts/15/wopiframe.aspx?guestaccesstoken=f77ihhc%2fxkig6gfhqiddogtmjqoxm0%2fq%2bb2euyif%2bri%3d&docid=1_1c9c826e0945c4aae87a3cf1547b535ab&wdformid=%7b3565fd77%2dd37d%2d4ccf%2db660%2d25cb35a12799%7d&action=formsubmit&cid=f76562aa-9283-40ef-8ac9-15e5e7722d9b$all
||atriumlandscape-my.sharepoint.com/personal/sue_atriumlandscape_com/_layouts/15/wopiframe.aspx?guestaccesstoken=nrg8nkxnkyji2axm9efekdi62u6cuvrsxcypzfz9jay%3d&docid=1_10932d3dd2ac2478f833ee56388ecb767&wdformid=%7bfaebec1d%2dbc38%2d42bf%2dbe94%2d47ebb62d7501%7d&action=formsubmit&cid=06548627-9647-42de-a0c7-75a424aaacde$all
||atriumlandscape-my.sharepoint.com/personal/sue_atriumlandscape_com/_layouts/15/wopiframe.aspx?guestaccesstoken=nrg8nkxnkyji2axm9efekdi62u6cuvrsxcypzfz9jay=&docid=1_10932d3dd2ac2478f833ee56388ecb767&wdformid={faebec1d-bc38-42bf-be94-47ebb62d7501}&action=formsubmit&cid=06548627-9647-42de-a0c7-75a424aaacde$all
Filter updated: Tue, 21 Sep 2021 00:01:40 +0000
2021-09-21 00:01:40 +00:00
||atsportsclub.com$all
||att.usersupport.net$all
Filter updated: Wed, 08 Sep 2021 12:01:51 +0000
2021-09-08 12:01:51 +00:00
||attached-file.gq$all
Filter updated: Tue, 03 Aug 2021 00:01:58 +0000
2021-08-03 00:01:58 +00:00
||attcom-prod06a.adobecqms.net$all
Filter updated: Fri, 24 Sep 2021 00:01:50 +0000
2021-09-24 00:01:51 +00:00
||attdomainsservices.weebly.com$all
Filter updated: Sun, 19 Sep 2021 12:01:34 +0000
2021-09-19 12:01:35 +00:00
||attemplate.com/nam/login?id=cgfezmnpamevsljgc2dnovfpdguyu2izmwh4ek5kvvv0s09vvwhkt0qragt3zlc5clqrnlbtvu12mctnzujvqnjuk0dvbkhpnfrxber1mwqys3rpnmewzm1haedrl2fytxlzcjfnuzfhqlgzcxjsvws3z3plclpdotlnndbzvi9ry1jwunj0whhnuwhivzbymtjqewlkqu5rtg1mm0ftu0izdwzhbzvfzwhzdty3c2c3mhnsm0j6actoctrxu3jqbza2aw1st0tll05oofbnbmrumeq3tthsrlrisjlttnfuntbiqnn0d0hjvdm4r0jnzmjhruxpqxrvnhg1mtnkdgrxk2c5dkc2tc9la0y5tufcovrybjjvdna1ngjvsu1ik1ditlvcewfkajnvafawu05yzni3zunsy1vuawqxz1g$all
Filter updated: Thu, 04 Mar 2021 00:06:31 UTC
2021-03-04 00:06:31 +00:00
||attemptdetectedpayment.com/lloydsbank$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||atthffkjfkjfff.weebly.com$all
Filter updated: Thu, 08 Jul 2021 00:02:02 +0000
2021-07-08 00:02:02 +00:00
||attnet.hyperphp.com$all
Filter updated: Sat, 17 Oct 2020 00:06:56 UTC
2020-10-17 00:06:56 +00:00
||attnet4.aidaform.com$all
Filter updated: Tue, 14 Sep 2021 12:01:44 +0000
2021-09-14 12:01:44 +00:00
||attservicesgs.heteml.net$all
Filter updated: Tue, 21 Sep 2021 12:02:11 +0000
2021-09-21 12:02:11 +00:00
||attverificationlinkserver.weebly.com$all
Filter updated: Sat, 20 Feb 2021 00:06:47 UTC
2021-02-20 00:06:47 +00:00
||atualizacao-online547864.com$all
Filter updated: Wed, 10 Feb 2021 00:06:29 UTC
2021-02-10 00:06:29 +00:00
||atualizaonline2533.com$all
Filter updated: Sun, 05 Sep 2021 00:02:15 +0000
2021-09-05 00:02:15 +00:00
||atualizarcartaoltaujulho.com$all
Filter updated: Sun, 22 Aug 2021 00:01:52 +0000
2021-08-22 00:01:52 +00:00
||au.rei-npo.org$all
Filter updated: Tue, 26 Jan 2021 12:06:26 UTC
2021-01-26 12:06:26 +00:00
||aubootlegger.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||auduboninstitute-my.sharepoint.com/:o:/g/personal/kramsey_auduboninstitute_org/evesqu6pzsxojjljb-ygjewbwb6dv_wn9ebmuzghm1jkbw?e=bcysta$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||aulavirtualecuador.com$all
Filter updated: Thu, 23 Sep 2021 00:02:18 +0000
2021-09-23 00:02:18 +00:00
||aupay.auone.jp.gemiterf.gq$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||aupay.conectauone.top$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||aupay.walleauoneauto.shop$all
||aupay.wallet.adminauto.shop$all
Filter updated: Sat, 31 Jul 2021 00:01:51 +0000
2021-07-31 00:01:51 +00:00
||aushotel.es$all
Filter updated: Fri, 10 Sep 2021 00:02:17 +0000
2021-09-10 00:02:17 +00:00
||auth-doc-prohealthpartners.ml$all
Filter updated: Thu, 23 Sep 2021 00:02:18 +0000
2021-09-23 00:02:18 +00:00
||auth-entication-required-pay-pal-services.000webhostapp.com$all
Filter updated: Tue, 21 Sep 2021 12:02:11 +0000
2021-09-21 12:02:11 +00:00
||auth-webmailakeonetcom.yolasite.com$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||authenbp.temp.swtest.ru$all
Filter updated: Thu, 10 Jun 2021 00:06:48 UTC
2021-06-10 00:06:48 +00:00
||authenticationteam.creatorlink.net$all
Filter updated: Tue, 12 Jan 2021 12:06:44 UTC
2021-01-12 12:06:44 +00:00
||authorisemytransfer.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||authorsationsetting-lloydsmanagement.com/login.php$all
Filter updated: Wed, 26 May 2021 12:06:39 UTC
2021-05-26 12:06:39 +00:00
||authuxeehmutconjxmailssocl.web.app$all
Filter updated: Fri, 25 Sep 2020 00:06:14 UTC
2020-09-25 00:06:14 +00:00
||auto24.email$all
Filter updated: Mon, 01 Feb 2021 12:08:15 UTC
2021-02-01 12:08:15 +00:00
||autoatendimento.caixaresidencial.com.br$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||autodiscover.gre.ac.uk$all
||autodiscover.ryder-dutton.co.uk$all
||autodiscover.sandrsecurity.com$all
Filter updated: Wed, 22 Sep 2021 12:01:56 +0000
2021-09-22 12:01:56 +00:00
||autoexprs.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||autolikesfree.net$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||autominsercive.shop$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||autorizador5.com.br$all
||autoscurt24.de$all
||autosrobadoschile.com$all
||avadvertising.in$all
Filter updated: Mon, 13 Sep 2021 12:01:52 +0000
2021-09-13 12:01:52 +00:00
||avashya.com$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||ave.ddnsking.com$all
||ave.servehalflife.com$all
Filter updated: Tue, 20 Oct 2020 00:06:21 UTC
2020-10-20 00:06:21 +00:00
||avioni.ru$all
Filter updated: Fri, 20 Aug 2021 00:01:56 +0000
2021-08-20 00:01:56 +00:00
||avishar.ir$all
Filter updated: Tue, 15 Jun 2021 00:06:35 UTC
2021-06-15 00:06:35 +00:00
||avispichinchwe.byethost18.com$all
Filter updated: Wed, 22 Sep 2021 12:01:56 +0000
2021-09-22 12:01:56 +00:00
||avito247onlinepayment.ru$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||avoid.servepics.com$all
Filter updated: Sun, 05 Sep 2021 12:01:36 +0000
2021-09-05 12:01:37 +00:00
||avotresante.ca$all
Filter updated: Fri, 10 Sep 2021 00:02:17 +0000
2021-09-10 00:02:17 +00:00
||awakcm.oozingcloud.com$all
Filter updated: Thu, 07 Jan 2021 00:06:17 UTC
2021-01-07 00:06:17 +00:00
||awdescargas.com/peliculas$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||awgxwv.covidharsh.com$all
Filter updated: Thu, 17 Sep 2020 00:06:18 UTC
2020-09-17 00:06:18 +00:00
||awptdh.webwave.dev$all
Filter updated: Fri, 13 Aug 2021 00:01:48 +0000
2021-08-13 00:01:48 +00:00
||aws-ppnet.net$all
Filter updated: Thu, 05 Aug 2021 00:02:05 +0000
2021-08-05 00:02:05 +00:00
||axe.su$all
Filter updated: Tue, 21 Sep 2021 00:01:40 +0000
2021-09-21 00:01:40 +00:00
||axieinfinity.su$all
Filter updated: Mon, 20 Sep 2021 12:02:05 +0000
2021-09-20 12:02:05 +00:00
||axonicaxonic.info$all
Filter updated: Mon, 12 Jul 2021 00:01:55 +0000
2021-07-12 00:01:55 +00:00
||axxcticionesco30.ultimatefreehost.in$all
Filter updated: Tue, 22 Jun 2021 12:06:51 +0000
2021-06-22 12:06:51 +00:00
||ayazmasud.buet.ac.bd$all
Filter updated: Sat, 18 Sep 2021 00:14:48 +0000
2021-09-18 00:14:48 +00:00
||aywalo.cloudanation.com$all
Filter updated: Thu, 16 Sep 2021 00:01:52 +0000
2021-09-16 00:01:52 +00:00
||azaharpanama.com$all
Filter updated: Sun, 11 Apr 2021 12:06:35 UTC
2021-04-11 12:06:35 +00:00
||azb3s.cf$all
Filter updated: Mon, 13 Sep 2021 12:01:52 +0000
2021-09-13 12:01:52 +00:00
||aziziproperties.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||azosimoveis.com$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||b-jy0.online$all
Filter updated: Thu, 09 Sep 2021 00:01:56 +0000
2021-09-09 00:01:56 +00:00
||b059c86968a6427389952025bcee9886.svc.dynamics.com$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||b1144fd15e2f46c05260572855a89a8d-dot-goff039302032323.rj.r.appspot.com$all
Filter updated: Thu, 10 Jun 2021 12:06:40 UTC
2021-06-10 12:06:40 +00:00
||b1uipxjwz8d.typeform.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||b2bchdistribution.app.link$all
Filter updated: Fri, 24 Sep 2021 00:01:50 +0000
2021-09-24 00:01:51 +00:00
||b339769d305817ab6ebae32a17c720aa-dot-goff039302032323.rj.r.appspot.com$all
Filter updated: Fri, 17 Sep 2021 12:01:51 +0000
2021-09-17 12:01:52 +00:00
||b4e921f0.sso-mailsrvr-4344e5teed.pages.dev$all
Filter updated: Sat, 11 Sep 2021 12:01:27 +0000
2021-09-11 12:01:27 +00:00
||b96f7f93.sibforms.com$all
Filter updated: Fri, 24 Sep 2021 12:02:36 +0000
2021-09-24 12:02:36 +00:00
||b97bca39.srvr-cloudmail-srvr6754e5rte.pages.dev$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||babyinch.app$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||baccredomatic.crowdicity.com$all
Filter updated: Tue, 21 Sep 2021 12:02:11 +0000
2021-09-21 12:02:11 +00:00
||backendlessappcontent.com/aa6f11c5-da73-fdc9-ff17-2ab002e32400/07dfc344-2601-41f8-92c7-a79a9ae5af0f/files/web/index.html$all
Filter updated: Sun, 22 Aug 2021 00:01:52 +0000
2021-08-22 00:01:52 +00:00
||backupemnuvem.com.br$all
Filter updated: Mon, 24 May 2021 12:06:37 UTC
2021-05-24 12:06:37 +00:00
||backyardkilimani.com$all
Filter updated: Sat, 17 Jul 2021 00:01:47 +0000
2021-07-17 00:01:47 +00:00
||bacsituvan24h.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||badge-centers.ga$all
Filter updated: Wed, 01 Sep 2021 00:02:20 +0000
2021-09-01 00:02:20 +00:00
||badgeentry.top$all
Filter updated: Sun, 16 May 2021 12:06:24 UTC
2021-05-16 12:06:24 +00:00
||bag-macben.eu$all
Filter updated: Wed, 04 Aug 2021 00:02:10 +0000
2021-08-04 00:02:10 +00:00
||bail-services.i.ng$all
Filter updated: Mon, 01 Feb 2021 12:08:15 UTC
2021-02-01 12:08:15 +00:00
||bakerrecklaw.com$all
Filter updated: Wed, 22 Sep 2021 00:02:26 +0000
2021-09-22 00:02:26 +00:00
||baliayurveda.thatsend.dev$all
Filter updated: Tue, 16 Feb 2021 00:06:20 UTC
2021-02-16 00:06:20 +00:00
||balloonexperienceholland.eu$all
Filter updated: Fri, 02 Jul 2021 12:01:53 +0000
2021-07-02 12:01:53 +00:00
||ballost.org/barbara_palvinic_breakingnews/?a=barbara_palvin&p=bitcoin_prime&cep=qra0tipfgaboldz77_jbsy_ezw3obpceykaqvhypvbzx7xzkctmjl0begcfdvwvcxytsr6voipvtjqtcmvyqhqj-m1fziqmka5jed0jfi4yld_pks1-s4hv7nmw3-chwol7szgua0lpcfcwkjbrktdpcvmtnqrzc2lpkupgrhk-voxqdxv5ihshklxa8kggze-pgbjahdbpwgter8zynuvlcxtjh8uaburxdgcnajygihskbucpqxlamo_qzrmcei8xl4jd3sy4lmwyphk4vwl63-ftji72xhoq0pj5iwxpgc7gdwdyznauhtxf-iyhp0s9yxrnlzsl4v4anyu89q-j8zlx0mfj_8na1q2mjqtjfyxiu8bvg0exrhzo-3gy6-vdhage13eudintavhvlfontd-qbjywx5nhik-6xm4u-yvtfvpmd_jnkkvf515r05pd1loyc_themttltp0dznp3wpgwfq6-lzhhvy9jwboql8avkg6d1wrw1pahkfif_n36hviyjvmlfivfstiqcepp65cbnti6kqhiysjuwieb72zcxnftjjocm3egaeiw&lptoken=16f22589212161c89401&keyword=job+search+&geo=hu&campaignname=hu+dp+desktop+asap&device=desktop&os=windows+10&browser=firefox+89&carrier=unknown&source=434214235&bid=0.0065&clickid=86368833580$all
Filter updated: Sat, 22 May 2021 00:06:19 UTC
2021-05-22 00:06:19 +00:00
||bamboobypanda.com/r$all
||bamboobypanda.com/r/$all
Filter updated: Wed, 01 Sep 2021 12:01:58 +0000
2021-09-01 12:01:58 +00:00
||bambootrial.top$all
Filter updated: Tue, 24 Aug 2021 00:02:23 +0000
2021-08-24 00:02:24 +00:00
||banca-en-lnterbank.aprobada-app.xyz$all
Filter updated: Tue, 21 Sep 2021 00:01:40 +0000
2021-09-21 00:01:40 +00:00
||bancainterbankpeweb.callingbell.com.bd$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||bancainternet-lnterbancape.com$all
Filter updated: Thu, 23 Sep 2021 00:02:18 +0000
2021-09-23 00:02:18 +00:00
||bancalnternet-interbank.pe-h.com$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||bancalnternet-lnterbank.pe-lh.com$all
Filter updated: Thu, 26 Aug 2021 12:02:31 +0000
2021-08-26 12:02:31 +00:00
||bancapichiflowwd.byethost31.com$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||bancapichincha.hostkda.com$all
Filter updated: Fri, 23 Jul 2021 00:03:07 +0000
2021-07-23 00:03:07 +00:00
||bancapichionliw.byethost4.com$all
Filter updated: Fri, 17 Sep 2021 00:01:45 +0000
2021-09-17 00:01:46 +00:00
||bancaporinternet-interbank.pe-logn.com$all
Filter updated: Tue, 16 Mar 2021 00:07:08 UTC
2021-03-16 00:07:09 +00:00
||bancaporinternet-netinterbankpe11.com$all
Filter updated: Wed, 15 Sep 2021 00:01:54 +0000
2021-09-15 00:01:55 +00:00
||bancaporinternet.interbrnpe.com$all
Filter updated: Wed, 18 Aug 2021 00:01:50 +0000
2021-08-18 00:01:50 +00:00
||bancaporinternet.lnterbank-grupo.lntorkal.com$all
||bancaporinternet.lnterbank.grupodigital.bnxoperu.com$all
Filter updated: Tue, 21 Sep 2021 00:01:40 +0000
2021-09-21 00:01:40 +00:00
||bancaporlnternet-interbank.pe-gg.com$all
Filter updated: Wed, 22 Sep 2021 00:02:26 +0000
2021-09-22 00:02:26 +00:00
||bancaporlnternet-interbank.pe-pl.com$all
Filter updated: Fri, 03 Sep 2021 00:01:54 +0000
2021-09-03 00:01:55 +00:00
||bancaporlnternet.lnterbank.banceninternet.com$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||bancaporlnternet.smovil.digital$all
Filter updated: Sun, 19 Sep 2021 12:01:34 +0000
2021-09-19 12:01:35 +00:00
||bancaprinternet-interbank.pe-ids.com$all
Filter updated: Wed, 23 Jun 2021 00:06:32 +0000
2021-06-23 00:06:32 +00:00
||bancevirtual.hostkda.com$all
Filter updated: Sat, 14 Aug 2021 00:01:49 +0000
2021-08-14 00:01:49 +00:00
||banco-proamerica.2host.me$all
Filter updated: Thu, 22 Jul 2021 00:01:54 +0000
2021-07-22 00:01:54 +00:00
||bancogalicia.byethost6.com$all
Filter updated: Tue, 16 Feb 2021 00:06:20 UTC
2021-02-16 00:06:20 +00:00
||bancoiing.site44.com$all
Filter updated: Tue, 09 Feb 2021 12:06:34 UTC
2021-02-09 12:06:34 +00:00
||bancoiinng.site44.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||bancomercantil-org.haxsecurity.org$all
Filter updated: Sat, 18 Sep 2021 00:14:48 +0000
2021-09-18 00:14:48 +00:00
||banconacional22.sytes.net$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||banconacional8721.medianewsonline.com$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||banconacionalbinc.webnode.com.co$all
||banconacionaldecostaricabx.webnode.com.co$all
Filter updated: Thu, 22 Jul 2021 00:01:54 +0000
2021-07-22 00:01:54 +00:00
||bancoonline.2host.me$all
Filter updated: Fri, 09 Jul 2021 00:01:59 +0000
2021-07-09 00:01:59 +00:00
||bancopichinchae9.byethost9.com$all
Filter updated: Sun, 18 Jul 2021 00:02:04 +0000
2021-07-18 00:02:04 +00:00
||bancopromerica00.byethost4.com$all
Filter updated: Wed, 21 Jul 2021 00:01:57 +0000
2021-07-21 00:01:57 +00:00
||bancopromericac0.byethost7.com$all
Filter updated: Wed, 14 Jul 2021 00:03:28 +0000
2021-07-14 00:03:28 +00:00
||bancopromericaon.byethost33.com$all
Filter updated: Sat, 17 Jul 2021 12:01:37 +0000
2021-07-17 12:01:37 +00:00
||bancopromericass.byethost7.com$all
Filter updated: Tue, 13 Jul 2021 00:02:30 +0000
2021-07-13 00:02:30 +00:00
||bancwebpichi.byethost8.com$all
Filter updated: Fri, 27 Aug 2021 00:01:47 +0000
2021-08-27 00:01:47 +00:00
||bangladesh-association.com$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||bangpromex1.webcindario.com$all
Filter updated: Mon, 23 Aug 2021 12:02:18 +0000
2021-08-23 12:02:19 +00:00
||bangrove-ad.com$all
Filter updated: Mon, 19 Apr 2021 00:06:54 UTC
2021-04-19 00:06:54 +00:00
||banhywkaie.com$all
Filter updated: Tue, 03 Aug 2021 00:01:58 +0000
2021-08-03 00:01:58 +00:00
||banistmo.byethost18.com$all
Filter updated: Thu, 03 Sep 2020 12:06:37 UTC
2020-09-03 12:06:37 +00:00
||bank-of-america-secure00.dns05.com$all
Filter updated: Wed, 12 May 2021 00:06:26 UTC
2021-05-12 00:06:26 +00:00
||bankapolska.com$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||bankaribe01.byethost4.com$all
Filter updated: Thu, 10 Sep 2020 12:06:46 UTC
2020-09-10 12:06:46 +00:00
||bankcheckingsavings.com/citibank-bonuses$all
Filter updated: Wed, 25 Nov 2020 12:06:48 UTC
2020-11-25 12:06:48 +00:00
||bankcheckingsavings.com/citibank-bonuses/$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||bankia-933966.ingress-earth.easywp.com$all
Filter updated: Fri, 28 May 2021 12:06:27 UTC
2021-05-28 12:06:27 +00:00
||bankiigalicia.ihostfull.com$all
Filter updated: Tue, 03 Aug 2021 12:01:54 +0000
2021-08-03 12:01:54 +00:00
||banking.n26.com.verificaanagrafici.com$all
Filter updated: Fri, 28 May 2021 00:06:28 UTC
2021-05-28 00:06:29 +00:00
||bankingalicias.ihostfull.com$all
Filter updated: Fri, 28 May 2021 12:06:27 UTC
2021-05-28 12:06:27 +00:00
||bankngaliciaa.ihostfull.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||bankofamericanas.com$all
Filter updated: Wed, 01 Sep 2021 12:01:58 +0000
2021-09-01 12:01:58 +00:00
||bankpromer1ca.ultimatefreehost.in$all
Filter updated: Thu, 09 Sep 2021 00:01:56 +0000
2021-09-09 00:01:56 +00:00
||bannerchampnyc.com$all
Filter updated: Fri, 02 Jul 2021 12:01:53 +0000
2021-07-02 12:01:53 +00:00
||banpichinchaweba.byethost11.com$all
Filter updated: Thu, 01 Jul 2021 00:01:46 +0000
2021-07-01 00:01:46 +00:00
||banpichinchweban.byethost17.com$all
Filter updated: Thu, 26 Aug 2021 12:02:31 +0000
2021-08-26 12:02:31 +00:00
||banprome.byethost7.com$all
Filter updated: Sun, 18 Jul 2021 12:02:04 +0000
2021-07-18 12:02:04 +00:00
||banpromeca12.byethost18.com$all
Filter updated: Sun, 20 Jun 2021 00:06:25 +0000
2021-06-20 00:06:25 +00:00
||banreservard2021.ultimatefreehost.in$all
Filter updated: Wed, 03 Mar 2021 00:08:05 UTC
2021-03-03 00:08:05 +00:00
||banreservasdigital.com$all
Filter updated: Sun, 07 Mar 2021 00:06:38 UTC
2021-03-07 00:06:38 +00:00
||baovesusonglcxt.com/wp-includes/index.html$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||baradua.it$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||barbarajtedesco.com$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||barberoutlet.com/wp-includes/app/wave/wave/index.html?#misa.ani@yandex.ru$all
Filter updated: Wed, 15 Sep 2021 00:01:54 +0000
2021-09-15 00:01:55 +00:00
||barberoutlet.com/wp-includes/vcv/wave/wave/index.html?#user@calstatela.edu$all
Filter updated: Sat, 19 Jun 2021 12:06:28 +0000
2021-06-19 12:06:28 +00:00
||bardaiconnect.com/app/listeners/ae/n-nv6588123/ae/ae/verify/sms.php$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||barocheck.kr$all
Filter updated: Mon, 13 Sep 2021 12:01:52 +0000
2021-09-13 12:01:52 +00:00
||barziz.com$all
Filter updated: Sun, 06 Jun 2021 12:06:15 UTC
2021-06-06 12:06:16 +00:00
||bas9casc3.qwe-dasd-asd.workers.dev$all
Filter updated: Fri, 24 Sep 2021 00:01:50 +0000
2021-09-24 00:01:51 +00:00
||basic-connect.ch$all
Filter updated: Thu, 23 Sep 2021 00:02:18 +0000
2021-09-23 00:02:18 +00:00
||basicxacs.cyou$all
Filter updated: Fri, 30 Jul 2021 00:01:47 +0000
2021-07-30 00:01:47 +00:00
||basopkingsantge.ultimatefreehost.in$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||batelstore.com$all
Filter updated: Mon, 20 Sep 2021 00:01:41 +0000
2021-09-20 00:01:41 +00:00
||batonrougecargo3830849217.grupokampu.com.pe$all
Filter updated: Fri, 03 Sep 2021 12:01:48 +0000
2021-09-03 12:01:48 +00:00
||bay81.com$all
Filter updated: Sun, 18 Jul 2021 12:02:04 +0000
2021-07-18 12:02:04 +00:00
||bay81studios.com$all
Filter updated: Sat, 05 Dec 2020 12:06:47 UTC
2020-12-05 12:06:47 +00:00
||bbcartoes.net$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||bbfunding-my.sharepoint.com/personal/accounting_bluebridgefunding_com/_layouts/15/doc.aspx?sourcedoc={f0763374-6329-450f-94a4-11512ab3e2fe}&action=default&slrid=1cf04e9f-706e-0000-469d-3c7942c5beb8&originalpath=ahr0chm6ly9iymz1bmrpbmctbxkuc2hhcmvwb2ludc5jb20vom86l2cvcgvyc29uywwvywnjb3vudgluz19ibhvlynjpzgdlznvuzgluz19jb20vrw5remr2qxbzdzlgbetrulvtcxo0djrcttnvrxnuvhjrm1fjae9qemetamxrqt9ydgltzt1ozy1mtmjqdjewzw&cid=81889f02-24c2-4efa-9e1e-1ccac075a22c$all
||bbfunding-my.sharepoint.com/personal/accounting_bluebridgefunding_com/_layouts/15/doc.aspx?sourcedoc={f0763374-6329-450f-94a4-11512ab3e2fe}&action=default&slrid=3d693f9f-20ed-0000-3f04-fe0e8f6dfa87&originalpath=ahr0chm6ly9iymz1bmrpbmctbxkuc2hhcmvwb2ludc5jb20vom86l2cvcgvyc29uywwvywnjb3vudgluz19ibhvlynjpzgdlznvuzgluz19jb20vrw5remr2qxbzdzlgbetrulvtcxo0djrcttnvrxnuvhjrm1fjae$all
||bbfunding-my.sharepoint.com/personal/accounting_bluebridgefunding_com/_layouts/15/doc.aspx?sourcedoc={f0763374-6329-450f-94a4-11512ab3e2fe}&action=default&slrid=5961409f-c08a-0000-3fa1-75b979fb3192&originalpath=ahr0chm6ly9iymz1bmrpbmctbxkuc2hhcmvwb2ludc5jb20vom86l2cvcgvyc29uywwvywnjb3vudgluz19ibhvlynjpzgdlznvuzgluz19jb20vrw5remr2qxbzdzlgbetrulvtcxo0djrcttnvrxnuvhjrm1fjae9qemetamxrqt9ydgltzt1yac0ycxkzttewzw&cid=c5f1ae7f-ac1c-4323-a07c-260e95800ab9$all
||bbfunding-my.sharepoint.com/personal/accounting_bluebridgefunding_com/_layouts/15/doc.aspx?sourcedoc={f0763374-6329-450f-94a4-11512ab3e2fe}&action=default&slrid=59d2529f-d007-0000-3f10-e11b5cf398b3&originalpath=ahr0chm6ly9iymz1bmrpbmctbxkuc2hhcmvwb2ludc5jb20vom86l2cvcgvyc29uywwvywnjb3vudgluz19ibhvlynjpzgdlznvuzgluz19jb20vrw5remr2qxbzdzlgbetrulvtcxo0djrcttnvrxnuvhjrm1fjae9qemetamxrqt9ydgltzt0zdnbfaxpqntewzw&cid=57281b4c-f8f3-415a-b048-b94ef5111d89$all
||bbfunding-my.sharepoint.com/personal/accounting_bluebridgefunding_com/_layouts/15/doc.aspx?sourcedoc={f0763374-6329-450f-94a4-11512ab3e2fe}&action=default&slrid=62d2529f-7028-0000-3f04-f6b0a072a22a&originalpath=ahr0chm6ly9iymz1bmrpbmctbxkuc2hhcmvwb2ludc5jb20vom86l2cvcgvyc29uywwvywnjb3vudgluz19ibhvlynjpzgdlznvuzgluz19jb20vrw5remr2qxbzdzlgbetrulvtcxo0djrcttnvrxnuvhjrm1fjae9qemetamxrqt9ydgltzt1jx3ktb1rqntewzw&cid=619fb8f1-b627-419b-80b1-cfd7e7cfa29b$all
||bbfunding-my.sharepoint.com/personal/accounting_bluebridgefunding_com/_layouts/15/doc.aspx?sourcedoc={f0763374-6329-450f-94a4-11512ab3e2fe}&action=default&slrid=7927489f-2081-0000-4704-eb1a7ea7761d&originalpath=ahr0chm6ly9iymz1bmrpbmctbxkuc2hhcmvwb2ludc5jb20vom86l2cvcgvyc29uywwvywnjb3vudgluz19ibhvlynjpzgdlznvuzgluz19jb20vrw5remr2qxbzdzlgbetrulvtcxo0djrcttnvrxnuvhjrm1fjae9qemetamxrqt9ydgltzt0zeg04whlqzjewzw&cid=69a9adbf-9a76-4925-abca-a25903c1383e$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||bbncrr.webcindario.com$all
Filter updated: Fri, 01 Jan 2021 12:06:08 UTC
2021-01-01 12:06:08 +00:00
||bbsuporteacesso24horas.com$all
Filter updated: Wed, 22 Sep 2021 00:02:26 +0000
2021-09-22 00:02:26 +00:00
||bc.lbclbcpaiement.com$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||bc.lebcpaiementlbc.com$all
Filter updated: Wed, 17 Mar 2021 00:06:16 UTC
2021-03-17 00:06:16 +00:00
||bc1.paiementervice.com$all
Filter updated: Mon, 10 May 2021 12:06:32 UTC
2021-05-10 12:06:32 +00:00
||bc3.lbcvirementlbc.com$all
Filter updated: Mon, 06 Sep 2021 00:01:54 +0000
2021-09-06 00:01:54 +00:00
||bccminevglobal.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||bcp.futbolfinanciero.com.pe$all
Filter updated: Tue, 14 Sep 2021 00:01:48 +0000
2021-09-14 00:01:48 +00:00
||bcpbetazonasegurabetaviabcp.com$all
Filter updated: Thu, 23 Sep 2021 00:02:18 +0000
2021-09-23 00:02:18 +00:00
||bcpclientesinfobetasegvra.online$all
Filter updated: Wed, 22 Sep 2021 00:02:26 +0000
2021-09-22 00:02:26 +00:00
||bcpjobs.com$all
Filter updated: Fri, 27 Aug 2021 00:01:47 +0000
2021-08-27 00:01:47 +00:00
||bcpzonasegurabetaspe.com$all
Filter updated: Fri, 20 Aug 2021 00:01:56 +0000
2021-08-20 00:01:56 +00:00
||bcpzonaseguro.viabpc.com$all
Filter updated: Wed, 14 Jul 2021 12:02:08 +0000
2021-07-14 12:02:08 +00:00
||bcpzonsegurabeta-vlabcp-com.dtuofus.com$all
Filter updated: Wed, 09 Jun 2021 00:06:30 UTC
2021-06-09 00:06:31 +00:00
||bcpzonsegurabeta-vlabcp-com.gurldiro.com$all
Filter updated: Fri, 13 Aug 2021 00:01:48 +0000
2021-08-13 00:01:48 +00:00
||bcvsalvador2021.hostfree.pw$all
Filter updated: Tue, 21 Sep 2021 00:01:40 +0000
2021-09-21 00:01:40 +00:00
||bdkclientes.com$all
Filter updated: Fri, 24 Sep 2021 12:02:36 +0000
2021-09-24 12:02:36 +00:00
||bdnmmp.top$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||bdsfa.sharepoint.com/_layouts/15/wopiframe.aspx?guestaccesstoken=pbswcmyerrbau9nv%209vcodtblni2sahsdqci9c/qyr4=&docid=1_11dad9ed160d14dafa586323403d7fef8&wdformid={62e5338c-c4ba-43fd-ab98-d884748022e2}&action=formsubmit$all
||bdsfa.sharepoint.com/_layouts/15/wopiframe.aspx?guestaccesstoken=pbswcmyerrbau9nv%2b9vcodtblni2sahsdqci9c%2fqyr4%3d&docid=1_11dad9ed160d14dafa586323403d7fef8&wdformid=%7b62e5338c%2dc4ba%2d43fd%2dab98%2dd884748022e2%7d%2f&action=formsubmit$all
||bdsfa.sharepoint.com/_layouts/15/wopiframe.aspx?guestaccesstoken=pbswcmyerrbau9nv%2b9vcodtblni2sahsdqci9c%2fqyr4%3d&docid=1_11dad9ed160d14dafa586323403d7fef8&wdformid=%7b62e5338c%2dc4ba%2d43fd%2dab98%2dd884748022e2%7d&action=formsubmit$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||bdxxmg.top$all
Filter updated: Tue, 07 Sep 2021 00:01:46 +0000
2021-09-07 00:01:46 +00:00
||beansbulletsbandagesandyou.com/bullets/wp-admin/user/algr/16668/?authorization_uri=https:%2f%2fallegro.pl%2fauth%2foauth%2fauthorize%3fclient_id%3dtb5sff3crxeyspdn%26redirect_uri%3dhttps:%2f%2fallegro.pl%2flogin%2fauth%26response_type%3dcode%26state%3dbxmolp&oauth=true$all
||beansbulletsbandagesandyou.com/bullets/wp-admin/user/algr/5e7f0/?authorization_uri=https:%2f%2fallegro.pl%2fauth%2foauth%2fauthorize%3fclient_id%3dtb5sff3crxeyspdn%26redirect_uri%3dhttps:%2f%2fallegro.pl%2flogin%2fauth%26response_type%3dcode%26state%3dbxmolp&oauth=true$all
||beansbulletsbandagesandyou.com/bullets/wp-admin/user/algr/?266331554-rynqlwcrvfz$all
||beansbulletsbandagesandyou.com/bullets/wp-admin/user/algr/?333295712-opnmttsvxxp$all
||beansbulletsbandagesandyou.com/bullets/wp-admin/user/algr/?465525269-wlsarsvqpvp$all
Filter updated: Mon, 20 Sep 2021 12:02:05 +0000
2021-09-20 12:02:05 +00:00
||beast-win.ru$all
Filter updated: Tue, 21 Sep 2021 00:01:40 +0000
2021-09-21 00:01:40 +00:00
||beautiful-villani.192-210-132-118.plesk.page$all
Filter updated: Wed, 09 Jun 2021 00:06:30 UTC
2021-06-09 00:06:31 +00:00
||bebe1age.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||becktrod.ga$all
Filter updated: Tue, 07 Sep 2021 00:01:46 +0000
2021-09-07 00:01:46 +00:00
||bedah-investasi.muaraenimkab.go.id$all
Filter updated: Fri, 13 Aug 2021 00:01:48 +0000
2021-08-13 00:01:48 +00:00
||beetriyadh.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||beklear.net$all
Filter updated: Sat, 15 May 2021 00:06:31 UTC
2021-05-15 00:06:32 +00:00
||beloanvi333.byethost7.com$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||bemardistribuidora.com.ar$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||benamejicityofbaseball.com$all
Filter updated: Tue, 14 Sep 2021 12:01:44 +0000
2021-09-14 12:01:44 +00:00
||bendigobank.com.au.review-security.info$all
Filter updated: Thu, 16 Sep 2021 00:01:52 +0000
2021-09-16 00:01:52 +00:00
||benjasdsdhsdhsdjsdjs.my-board.org$all
Filter updated: Mon, 15 Mar 2021 12:43:24 UTC
2021-03-15 12:43:24 +00:00
||benjim.com$all
Filter updated: Thu, 22 Jul 2021 00:01:54 +0000
2021-07-22 00:01:54 +00:00
||benotea.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||benrefamdksi.blogspot.com$all
Filter updated: Tue, 29 Jun 2021 12:02:07 +0000
2021-06-29 12:02:07 +00:00
||bequeenspoons.com$all
Filter updated: Thu, 21 Jan 2021 00:06:19 UTC
2021-01-21 00:06:19 +00:00
||ber-vel.com$all
Filter updated: Wed, 05 May 2021 00:06:44 UTC
2021-05-05 00:06:44 +00:00
||bergenfamiilycenter.org$all
Filter updated: Wed, 28 Jul 2021 00:02:03 +0000
2021-07-28 00:02:03 +00:00
||berketurizm.com$all
Filter updated: Sun, 25 Jul 2021 12:01:49 +0000
2021-07-25 12:01:49 +00:00
||bestbenefitsnow.life$all
Filter updated: Thu, 19 Aug 2021 00:01:47 +0000
2021-08-19 00:01:47 +00:00
||bestbuyturizm.com.tr$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||bestfive.main.jp$all
Filter updated: Fri, 05 Feb 2021 12:06:59 UTC
2021-02-05 12:06:59 +00:00
||bestofdance.com$all
Filter updated: Tue, 31 Aug 2021 00:01:55 +0000
2021-08-31 00:01:55 +00:00
||besttest.synergize.co$all
Filter updated: Wed, 20 Jan 2021 00:06:08 UTC
2021-01-20 00:06:08 +00:00
||bet.travel$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||betaic-bf.com$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||betaildragon-mon-site-web-cheetah-1.cheetah.builderall.com$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||betasus.club$all
Filter updated: Sun, 29 Aug 2021 00:01:50 +0000
2021-08-29 00:01:51 +00:00
||betasus.me$all
Filter updated: Fri, 19 Feb 2021 00:06:27 UTC
2021-02-19 00:06:28 +00:00
||betasus020.blogspot.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||betasus021.blogspot.com$all
Filter updated: Fri, 19 Feb 2021 00:06:27 UTC
2021-02-19 00:06:28 +00:00
||betasus022.blogspot.com//$all
||betasus09.blogspot.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||betasus111.blogspot.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||betasus199.blogspot.com$all
||betasus2020.blogspot.com$all
Filter updated: Fri, 19 Feb 2021 00:06:27 UTC
2021-02-19 00:06:28 +00:00
||betasus2021.blogspot.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||betasus20211.blogspot.com$all
||betasus20213.blogspot.com$all
||betasus223.blogspot.com$all
||betasus224.blogspot.com$all
||betasus23.blogspot.com$all
||betasus30.blogspot.com$all
||betasus31.blogspot.com$all
||betasus311.blogspot.com$all
||betasus312.blogspot.com$all
||betasus33.blogspot.com$all
||betasus331.blogspot.com$all
||betasus332.blogspot.com$all
||betasus57.blogspot.com$all
||betasus777.blogspot.com$all
||betasuscom.blogspot.com$all
||betasusgirdi.blogspot.com$all
||betasusgiri.blogspot.com$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||betasusgiris.club$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||betasusgiris11.blogspot.com$all
||betasusgirisadresi.blogspot.com$all
||betasusgirisadresimiz.blogspot.com$all
||betasusgirisburasi.blogspot.com$all
||betasusgirisburasi3.blogspot.com$all
||betasusgirisburasi4.blogspot.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||betasusgirisimiz1.blogspot.com$all
||betasusgirmek.blogspot.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||betasusgirmek1.blogspot.com$all
||betasusgirmekicin.blogspot.com$all
||betasusgirsenesende.blogspot.com$all
||betasusguncelgirisimiz4.blogspot.com$all
||betasuslink1.blogspot.com$all
||betasuslinkgir.blogspot.com$all
||betasuslinkgiris.blogspot.com$all
||betasusorjinal1.blogspot.com$all
||betasusorjinals.blogspot.com$all
||betasussgir.blogspot.com$all
||betasussgiris.blogspot.com$all
||betasusss.blogspot.com$all
||betasusturkeygiris.blogspot.com$all
||betasusturkiye.blogspot.com$all
||betasusturkiyee.blogspot.com$all
||betasusum1.blogspot.com$all
Filter updated: Tue, 14 Sep 2021 00:01:48 +0000
2021-09-14 00:01:48 +00:00
||betasusuyelik.com$all
Filter updated: Wed, 22 Sep 2021 00:02:26 +0000
2021-09-22 00:02:26 +00:00
||betasviiabcp.site$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||betcupgiris1.blogspot.com$all
||betcupgiris2.blogspot.com$all
||betcupgirisadresimiz.blogspot.com$all
||betcupgirisadresimiz1.blogspot.com$all
||betcupgiriss1.blogspot.com$all
||betcupum.blogspot.com$all
||betebet122.blogspot.com$all
||betebetgirisim.blogspot.com$all
||betebetgirisimiz.blogspot.com$all
||betpergir4.blogspot.com$all
||betpergiris3.blogspot.com$all
||betpergirisadresimiz.blogspot.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||betqiuqiu.com$all
Filter updated: Tue, 14 Sep 2021 00:01:48 +0000
2021-09-14 00:01:48 +00:00
||betterbodynet.acemlnc.com$all
Filter updated: Wed, 14 Apr 2021 12:07:09 UTC
2021-04-14 12:07:09 +00:00
||betvoysitesi.com$all
Filter updated: Mon, 05 Oct 2020 12:06:21 UTC
2020-10-05 12:06:21 +00:00
||bexwebmailupdate.web.app$all
Filter updated: Fri, 21 May 2021 00:06:36 UTC
2021-05-21 00:06:36 +00:00
||beyondoutdoor.com.au$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||bezperervno.in.net$all
Filter updated: Wed, 28 Apr 2021 12:07:34 UTC
2021-04-28 12:07:34 +00:00
||bfnotion.ru$all
Filter updated: Wed, 07 Jul 2021 00:01:56 +0000
2021-07-07 00:01:57 +00:00
||bg5t.gratishosting.cl$all
Filter updated: Sat, 05 Jun 2021 00:27:49 UTC
2021-06-05 00:27:49 +00:00
||bg5t.rf.gd$all
Filter updated: Wed, 28 Jul 2021 12:01:46 +0000
2021-07-28 12:01:46 +00:00
||bgmddjczwgtrlwxjhyfahvfuku-dot-goff039302032323.rj.r.appspot.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||bgms.cit.net$all
Filter updated: Wed, 21 Jul 2021 12:01:49 +0000
2021-07-21 12:01:49 +00:00
||bgt1.byethost15.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||bh068.app.link$all
Filter updated: Mon, 06 Sep 2021 00:01:54 +0000
2021-09-06 00:01:54 +00:00
||bharathi1809.github.io$all
Filter updated: Thu, 03 Jun 2021 00:06:28 UTC
2021-06-03 00:06:28 +00:00
||bharatlaboratory.com$all
Filter updated: Thu, 29 Jul 2021 00:01:57 +0000
2021-07-29 00:01:57 +00:00
||bharattank.me$all
Filter updated: Mon, 09 Aug 2021 00:02:27 +0000
2021-08-09 00:02:27 +00:00
||bhavin0077.github.io$all
Filter updated: Thu, 03 Jun 2021 12:06:59 UTC
2021-06-03 12:07:00 +00:00
||bhd-leon-do.eshost.com.ar/?i=1$all
Filter updated: Wed, 02 Jun 2021 12:06:27 UTC
2021-06-02 12:06:28 +00:00
||bhfurniture.com.vn$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||bibirbajurijuri1.ga$all
Filter updated: Fri, 24 Sep 2021 00:01:50 +0000
2021-09-24 00:01:51 +00:00
||bibirpetualang3.ml$all
||bibirpetualang4.ml$all
||bibirpetualang5.ml$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||bibirpetualang8.ml$all
Filter updated: Thu, 01 Oct 2020 00:14:14 UTC
2020-10-01 00:14:14 +00:00
||biblio-emi.md$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||bibwebshop.com$all
||bicicentroslezama.com$all
Filter updated: Fri, 03 Sep 2021 00:01:54 +0000
2021-09-03 00:01:55 +00:00
||bienlinea.com$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||bigboxevents.com$all
Filter updated: Mon, 20 Sep 2021 12:02:05 +0000
2021-09-20 12:02:05 +00:00
||bigskinscsgodota.net.ru$all
Filter updated: Wed, 15 Sep 2021 12:01:46 +0000
2021-09-15 12:01:46 +00:00
||bik-alert.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||bikefactory-hamburg.de$all
Filter updated: Sun, 15 Aug 2021 12:01:40 +0000
2021-08-15 12:01:40 +00:00
||bilgincam.com.tr$all
Filter updated: Sat, 06 Feb 2021 12:06:42 UTC
2021-02-06 12:06:42 +00:00
||billing-errorhelp.com$all
Filter updated: Mon, 08 Mar 2021 12:06:34 UTC
2021-03-08 12:06:34 +00:00
||billingfailure-o2.com$all
Filter updated: Sun, 05 Sep 2021 00:02:15 +0000
2021-09-05 00:02:15 +00:00
||bimoitua.byethost6.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||binarybenliveload.com$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||binggegeit.com/wp-content/plugins/masterx/americanexpress-com.login.ent.3443n44u43/amex/amex/home$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||binggegeit.com/wp-content/plugins/masterx/americanexpress-com.login.ent.3443n44u43/amex/amex/home/$all
Filter updated: Sun, 19 Sep 2021 12:01:34 +0000
2021-09-19 12:01:35 +00:00
||binomo-registration.com$all
Filter updated: Thu, 29 Jul 2021 00:01:57 +0000
2021-07-29 00:01:57 +00:00
||binoroas.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||biolinky.co/exodusmobile$all
Filter updated: Tue, 22 Dec 2020 12:06:42 UTC
2020-12-22 12:06:42 +00:00
||biquyetcongai.com$all
Filter updated: Fri, 07 May 2021 12:12:56 UTC
2021-05-07 12:12:56 +00:00
||biswasgroceryandcafe.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||bit.do/fgday$all
||bit.do/fjxoo$all
||bit.do/fl4ss$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||bit.do/fq8j7$all
Filter updated: Tue, 22 Jun 2021 12:06:51 +0000
2021-06-22 12:06:51 +00:00
||bit.do/fq8ka$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||bit.do/fr3wr$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||bit.do/fr3xl$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||bit.do/fr3xm$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||bit.do/fr3xt$all
||bit.do/fr3xv$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||bit.do/fr3xw$all
Filter updated: Tue, 17 Aug 2021 00:02:45 +0000
2021-08-17 00:02:45 +00:00
||bit.do/frbmx$all
Filter updated: Thu, 19 Aug 2021 00:01:47 +0000
2021-08-19 00:01:47 +00:00
||bit.do/frcsy$all
Filter updated: Sat, 21 Aug 2021 00:01:53 +0000
2021-08-21 00:01:54 +00:00
||bit.do/frdxo$all
Filter updated: Thu, 26 Aug 2021 00:02:01 +0000
2021-08-26 00:02:01 +00:00
||bit.do/frgpu$all
Filter updated: Fri, 03 Sep 2021 12:01:48 +0000
2021-09-03 12:01:48 +00:00
||bit.do/frme6$all
Filter updated: Tue, 24 Aug 2021 00:02:23 +0000
2021-08-24 00:02:24 +00:00
||bit.do/frn5x$all
Filter updated: Fri, 17 Sep 2021 00:01:45 +0000
2021-09-17 00:01:46 +00:00
||bit.do/froaf$all
Filter updated: Thu, 09 Sep 2021 00:01:56 +0000
2021-09-09 00:01:56 +00:00
||bit.do/frp2n$all
Filter updated: Tue, 07 Sep 2021 00:01:46 +0000
2021-09-07 00:01:46 +00:00
||bit.do/frpqv$all
Filter updated: Mon, 13 Sep 2021 00:02:04 +0000
2021-09-13 00:02:04 +00:00
||bit.do/frs5v$all
Filter updated: Mon, 13 Sep 2021 12:01:52 +0000
2021-09-13 12:01:52 +00:00
||bit.do/frsfc$all
Filter updated: Sun, 12 Sep 2021 12:01:35 +0000
2021-09-12 12:01:35 +00:00
||bit.do/frstw$all
Filter updated: Tue, 14 Sep 2021 00:01:48 +0000
2021-09-14 00:01:48 +00:00
||bit.do/frtqa$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||bit.do/frx8b$all
Filter updated: Tue, 21 Sep 2021 12:02:11 +0000
2021-09-21 12:02:11 +00:00
||bit.do/frxsz$all
||bit.do/frxwh$all
Filter updated: Tue, 21 Sep 2021 00:01:40 +0000
2021-09-21 00:01:40 +00:00
||bit.do/frygn$all
||bit.do/frygp$all
||bit.do/frygr$all
||bit.do/fryhj$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||bit.do/frzet$all
Filter updated: Wed, 30 Jun 2021 00:01:58 +0000
2021-06-30 00:01:58 +00:00
||bit.do/sona994$all
Filter updated: Tue, 25 May 2021 00:06:25 UTC
2021-05-25 00:06:25 +00:00
||bit.do/tup994$all
Filter updated: Thu, 02 Sep 2021 00:01:59 +0000
2021-09-02 00:01:59 +00:00
||bit.ly./3ijwsm2$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||bit.ly/2iz03nf$all
||bit.ly/2kduy2u$all
||bit.ly/2nog4ow?facebook_update$all
||bit.ly/2nwrbgj$all
||bit.ly/2oq6dhz$all
Filter updated: Wed, 24 Mar 2021 00:06:36 UTC
2021-03-24 00:06:36 +00:00
||bit.ly/2p28z0h$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||bit.ly/2q7fcpg$all
Filter updated: Wed, 01 Sep 2021 00:02:20 +0000
2021-09-01 00:02:20 +00:00
||bit.ly/2spto3d$all
Filter updated: Fri, 20 Aug 2021 12:01:48 +0000
2021-08-20 12:01:48 +00:00
||bit.ly/2uwvcnh$all
||bit.ly/2vuwbzk$all
Filter updated: Thu, 23 Sep 2021 00:02:18 +0000
2021-09-23 00:02:18 +00:00
||bit.ly/2w0s7rv?confirmación$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||bit.ly/2w8ueyh$all
Filter updated: Wed, 01 Sep 2021 00:02:20 +0000
2021-09-01 00:02:20 +00:00
||bit.ly/2wctuwh?/identityconfirmation$all
||bit.ly/2we8ivg?facebook_update$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||bit.ly/2wqlrea$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||bit.ly/2x14cy1$all
Filter updated: Fri, 10 Sep 2021 12:02:02 +0000
2021-09-10 12:02:02 +00:00
||bit.ly/2x531wu$all
Filter updated: Fri, 24 Sep 2021 12:02:36 +0000
2021-09-24 12:02:36 +00:00
||bit.ly/2xaai2s$all
Filter updated: Thu, 09 Sep 2021 12:02:27 +0000
2021-09-09 12:02:27 +00:00
||bit.ly/2xai0zf$all
Filter updated: Thu, 23 Sep 2021 00:02:18 +0000
2021-09-23 00:02:18 +00:00
||bit.ly/2xnybd3?confirmación$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||bit.ly/2xpsdtz?confirmation$all
||bit.ly/2xq7m0v?confirmation$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||bit.ly/2xvvy8e?confirmation$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||bit.ly/2xzvuon?confirmation$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||bit.ly/2yxmsxe$all
||bit.ly/2zaee65$all
||bit.ly/2zejaht$all
Filter updated: Fri, 24 Sep 2021 00:01:50 +0000
2021-09-24 00:01:51 +00:00
||bit.ly/2zfk4ls?confirmación$all
Filter updated: Thu, 23 Sep 2021 00:02:18 +0000
2021-09-23 00:02:18 +00:00
||bit.ly/2zlhdas?confirmación$all
Filter updated: Thu, 25 Mar 2021 00:06:37 UTC
2021-03-25 00:06:37 +00:00
||bit.ly/31cwtqd?facebook_update$all
Filter updated: Fri, 02 Apr 2021 12:06:43 UTC
2021-04-02 12:06:43 +00:00
||bit.ly/31d3mp6?facebook_service$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||bit.ly/33ipjf7$all
||bit.ly/34mhgdg$all
Filter updated: Fri, 20 Aug 2021 12:01:48 +0000
2021-08-20 12:01:48 +00:00
||bit.ly/35qrdnc$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||bit.ly/37r8zo3$all
Filter updated: Fri, 03 Sep 2021 00:01:54 +0000
2021-09-03 00:01:55 +00:00
||bit.ly/38nxf58$all
Filter updated: Thu, 09 Sep 2021 00:01:56 +0000
2021-09-09 00:01:56 +00:00
||bit.ly/38q2wtj?facebook_update$all
Filter updated: Mon, 13 Sep 2021 12:01:52 +0000
2021-09-13 12:01:52 +00:00
||bit.ly/38rclcg$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||bit.ly/38xmo4d$all
Filter updated: Wed, 24 Mar 2021 12:06:42 UTC
2021-03-24 12:06:42 +00:00
||bit.ly/392hszz$all
Filter updated: Thu, 16 Sep 2021 00:01:52 +0000
2021-09-16 00:01:52 +00:00
||bit.ly/398jtig?confirmation$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||bit.ly/39j7mbh?confirmation$all
Filter updated: Fri, 24 Sep 2021 00:01:50 +0000
2021-09-24 00:01:51 +00:00
||bit.ly/39u27x9?confirmation$all
||bit.ly/3ae7min?confirmación$all
Filter updated: Fri, 27 Aug 2021 00:01:47 +0000
2021-08-27 00:01:47 +00:00
||bit.ly/3aetm80$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||bit.ly/3afo6kx$all
Filter updated: Thu, 23 Sep 2021 00:02:18 +0000
2021-09-23 00:02:18 +00:00
||bit.ly/3albz6d?confirmación$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||bit.ly/3an4lcn$all
||bit.ly/3aqvwmn$all
Filter updated: Thu, 23 Sep 2021 00:02:18 +0000
2021-09-23 00:02:18 +00:00
||bit.ly/3ax4xgx?confirmación$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||bit.ly/3bpmex0$all
Filter updated: Thu, 08 Apr 2021 00:06:59 UTC
2021-04-08 00:06:59 +00:00
||bit.ly/3bsgkin$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||bit.ly/3cievup?confirmation$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||bit.ly/3cmif4b?confirmación$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||bit.ly/3cvl6ir$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||bit.ly/3cwifq4$all
Filter updated: Thu, 25 Mar 2021 00:06:37 UTC
2021-03-25 00:06:37 +00:00
||bit.ly/3d7ezub?facebook_update$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||bit.ly/3dj0r1p$all
Filter updated: Fri, 10 Sep 2021 12:02:02 +0000
2021-09-10 12:02:02 +00:00
||bit.ly/3dvbup4$all
Filter updated: Thu, 23 Sep 2021 00:02:18 +0000
2021-09-23 00:02:18 +00:00
||bit.ly/3ef7ukt?confirmación$all
Filter updated: Wed, 22 Sep 2021 12:01:56 +0000
2021-09-22 12:01:56 +00:00
||bit.ly/3egyfvw?confirmaci%c3%b3n$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||bit.ly/3ejwrgv$all
||bit.ly/3ekdpzc$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||bit.ly/3errulu?confirmation$all
Filter updated: Sun, 11 Apr 2021 12:06:35 UTC
2021-04-11 12:06:35 +00:00
||bit.ly/3fxffba$all
Filter updated: Mon, 23 Aug 2021 00:01:47 +0000
2021-08-23 00:01:47 +00:00
||bit.ly/3gornz8$all
Filter updated: Fri, 24 Sep 2021 00:01:50 +0000
2021-09-24 00:01:51 +00:00
||bit.ly/3gqja9w$all
Filter updated: Wed, 22 Sep 2021 12:01:56 +0000
2021-09-22 12:01:56 +00:00
||bit.ly/3ht1hrj?confirmación$all
Filter updated: Thu, 23 Sep 2021 00:02:18 +0000
2021-09-23 00:02:18 +00:00
||bit.ly/3hyp5kr?confirmación$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||bit.ly/3i4eekh?confirmación$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||bit.ly/3i8tjul$all
Filter updated: Sat, 14 Aug 2021 00:01:49 +0000
2021-08-14 00:01:49 +00:00
||bit.ly/3icv8om$all
Filter updated: Sun, 05 Sep 2021 00:02:15 +0000
2021-09-05 00:02:15 +00:00
||bit.ly/3jkyzak$all
Filter updated: Mon, 30 Aug 2021 12:01:50 +0000
2021-08-30 12:01:51 +00:00
||bit.ly/3jqenzp?facebook_update$all
Filter updated: Wed, 15 Sep 2021 00:01:54 +0000
2021-09-15 00:01:55 +00:00
||bit.ly/3k5tmzj?confirmation$all
Filter updated: Sun, 22 Aug 2021 00:01:52 +0000
2021-08-22 00:01:52 +00:00
||bit.ly/3ka6u52$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||bit.ly/3kfzx1l?confirmation$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||bit.ly/3kueruz$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||bit.ly/3kv786c$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||bit.ly/3kxfgbu$all
Filter updated: Thu, 09 Sep 2021 00:01:56 +0000
2021-09-09 00:01:56 +00:00
||bit.ly/3kyg53s?facebook_update$all
Filter updated: Fri, 24 Sep 2021 00:01:50 +0000
2021-09-24 00:01:51 +00:00
||bit.ly/3kyua9h?confirmación$all
Filter updated: Mon, 30 Aug 2021 12:01:50 +0000
2021-08-30 12:01:51 +00:00
||bit.ly/3kyxj2w?facebook_update$all
Filter updated: Fri, 24 Sep 2021 00:01:50 +0000
2021-09-24 00:01:51 +00:00
||bit.ly/3kztwgi?confirmación$all
Filter updated: Fri, 10 Sep 2021 12:02:02 +0000
2021-09-10 12:02:02 +00:00
||bit.ly/3l6t5od$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||bit.ly/3ldovbh$all
||bit.ly/3lgmoqh$all
Filter updated: Wed, 22 Sep 2021 12:01:56 +0000
2021-09-22 12:01:56 +00:00
||bit.ly/3lmnuiy?confirmación$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||bit.ly/3ltqm8c?confirmation$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||bit.ly/3lxl5qf?confirmation$all
Filter updated: Fri, 27 Aug 2021 00:01:47 +0000
2021-08-27 00:01:47 +00:00
||bit.ly/3mgpwv2$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||bit.ly/3mkihc9$all
||bit.ly/3mryk6q$all
Filter updated: Fri, 03 Sep 2021 00:01:54 +0000
2021-09-03 00:01:55 +00:00
||bit.ly/3mvat1h?confirmation$all
Filter updated: Mon, 20 Sep 2021 12:02:05 +0000
2021-09-20 12:02:05 +00:00
||bit.ly/3n7qnga$all
Filter updated: Tue, 14 Sep 2021 00:01:48 +0000
2021-09-14 00:01:48 +00:00
||bit.ly/3netxu3$all
Filter updated: Thu, 09 Sep 2021 00:01:56 +0000
2021-09-09 00:01:56 +00:00
||bit.ly/3nfg5nc?facebook_update$all
Filter updated: Wed, 22 Sep 2021 12:01:56 +0000
2021-09-22 12:01:56 +00:00
||bit.ly/3nuzof0?confirmación$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||bit.ly/3nvr2mn$all
Filter updated: Fri, 24 Sep 2021 00:01:50 +0000
2021-09-24 00:01:51 +00:00
||bit.ly/3o0udu6?confirmación$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||bit.ly/3o2oag3?confirmation$all
Filter updated: Thu, 25 Mar 2021 00:06:37 UTC
2021-03-25 00:06:37 +00:00
||bit.ly/3reovvv$all
Filter updated: Sat, 27 Mar 2021 00:06:27 UTC
2021-03-27 00:06:27 +00:00
||bit.ly/3swpxho$all
Filter updated: Tue, 31 Aug 2021 12:01:54 +0000
2021-08-31 12:01:54 +00:00
||bit.ly/3t7mybo?/identityconfirmation$all
Filter updated: Thu, 16 Sep 2021 00:01:52 +0000
2021-09-16 00:01:52 +00:00
||bit.ly/3thyw0m?confirmaci%c3%b3n$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||bit.ly/3tks2um$all
||bit.ly/3tzc89x$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||bit.ly/3ud55bx?confirmation$all
Filter updated: Thu, 27 May 2021 00:06:23 UTC
2021-05-27 00:06:23 +00:00
||bit.ly/3vtbyq5$all
Filter updated: Mon, 29 Mar 2021 12:06:44 UTC
2021-03-29 12:06:44 +00:00
||bit.ly/3wb6m3i$all
Filter updated: Sun, 11 Jul 2021 00:02:18 +0000
2021-07-11 00:02:18 +00:00
||bit.ly/3witpuj$all
Filter updated: Wed, 01 Sep 2021 00:02:20 +0000
2021-09-01 00:02:20 +00:00
||bit.ly/3yrfuty?facebook_update$all
Filter updated: Tue, 21 Sep 2021 12:02:11 +0000
2021-09-21 12:02:11 +00:00
||bit.ly/3yzj1hc$all
Filter updated: Tue, 27 Jul 2021 00:02:10 +0000
2021-07-27 00:02:10 +00:00
||bit.ly/3zbo8qj$all
Filter updated: Fri, 27 Aug 2021 00:01:47 +0000
2021-08-27 00:01:47 +00:00
||bit.ly/3zc21yf$all
Filter updated: Fri, 24 Sep 2021 00:01:50 +0000
2021-09-24 00:01:51 +00:00
||bit.ly/3zdxjzk?confirmación$all
Filter updated: Sun, 05 Sep 2021 12:01:36 +0000
2021-09-05 12:01:37 +00:00
||bit.ly/3zpmzsc$all
Filter updated: Thu, 09 Sep 2021 00:01:56 +0000
2021-09-09 00:01:56 +00:00
||bit.ly/3zuxalv?facebook_update$all
Filter updated: Wed, 22 Sep 2021 12:01:56 +0000
2021-09-22 12:01:56 +00:00
||bit.ly/3zvmnc2?confirmación$all
||bit.ly/3zzcsqi?confirmación$all
Filter updated: Tue, 14 Sep 2021 00:01:48 +0000
2021-09-14 00:01:48 +00:00
||bit.ly/coinspot-claim-bonus$all
||bit.ly/conection923781$all
Filter updated: Wed, 25 Aug 2021 00:01:57 +0000
2021-08-25 00:01:57 +00:00
||bit.ly/digitalbankingmps$all
Filter updated: Fri, 10 Sep 2021 00:02:17 +0000
2021-09-10 00:02:17 +00:00
||bit.ly/disconosci-subito$all
Filter updated: Fri, 26 Mar 2021 00:06:40 UTC
2021-03-26 00:06:40 +00:00
||bit.ly/edoardopolaccoufficiale$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||bit.ly/mr-pin$all
Filter updated: Wed, 18 Aug 2021 00:01:50 +0000
2021-08-18 00:01:50 +00:00
||bit.ly/pandemicreliefpackage$all
Filter updated: Wed, 31 Mar 2021 12:06:47 UTC
2021-03-31 12:06:47 +00:00
||bit.ly/portale-mps-attivazione$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||bit.ly/smartwebmobil$all
Filter updated: Tue, 27 Jul 2021 00:02:10 +0000
2021-07-27 00:02:10 +00:00
||bit.ly/temp-disable$all
Filter updated: Mon, 06 Sep 2021 12:01:50 +0000
2021-09-06 12:01:50 +00:00
||bit.ly/vbmghlyuo67cvbcmfglyuivbndf$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||bit.ly/verifica-modulo-mps$all
Filter updated: Sun, 18 Jul 2021 12:02:04 +0000
2021-07-18 12:02:04 +00:00
||bit.ly/verifikasiakunfacebookanda2021$all
Filter updated: Thu, 08 Apr 2021 00:06:59 UTC
2021-04-08 00:06:59 +00:00
||bit.ly/verifikasipemblokiran_id$all
Filter updated: Fri, 20 Aug 2021 00:01:56 +0000
2021-08-20 00:01:56 +00:00
||bit.ly/vub-sk00$all
Filter updated: Thu, 23 Sep 2021 00:02:18 +0000
2021-09-23 00:02:18 +00:00
||bit.orlen-btk.xyz$all
Filter updated: Wed, 16 Jun 2021 00:06:45 +0000
2021-06-16 00:06:45 +00:00
||bitalchile.cl$all
Filter updated: Thu, 08 Jul 2021 00:02:02 +0000
2021-07-08 00:02:02 +00:00
||bitbaink.web.app$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||bitferronort.blogspot.com$all
Filter updated: Sun, 02 May 2021 00:06:30 UTC
2021-05-02 00:06:30 +00:00
||bithunnb.web.app$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||bitly.com/2ne0epo$all
Filter updated: Fri, 26 Mar 2021 12:07:44 UTC
2021-03-26 12:07:45 +00:00
||bitly.com/2p3bbbs$all
Filter updated: Wed, 12 May 2021 00:06:26 UTC
2021-05-12 00:06:26 +00:00
||bitly.com/2sfygwy$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||bitly.com/369t78f$all
||bitly.com/3aolo2y$all
Filter updated: Wed, 18 Aug 2021 00:01:50 +0000
2021-08-18 00:01:50 +00:00
||bitly.com/3g1epw3$all
Filter updated: Tue, 20 Jul 2021 00:01:58 +0000
2021-07-20 00:01:58 +00:00
||bitly.com/3jrtmmu$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||bitly.com/3koilft$all
||bitly.com/3prjhpk$all
Filter updated: Sun, 06 Jun 2021 00:06:22 UTC
2021-06-06 00:06:22 +00:00
||bitly.com/3vufm8l$all
Filter updated: Wed, 18 Aug 2021 00:01:50 +0000
2021-08-18 00:01:50 +00:00
||bitly.com/3xmjxs4$all
Filter updated: Thu, 20 May 2021 12:06:36 UTC
2021-05-20 12:06:36 +00:00
||bitpecta.com$all
Filter updated: Thu, 26 Aug 2021 12:02:31 +0000
2021-08-26 12:02:31 +00:00
||bitstarz-kasino.com$all
Filter updated: Sat, 11 Sep 2021 00:34:15 +0000
2021-09-11 00:34:15 +00:00
||bitzclusive.com$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||bixbet.org$all
Filter updated: Sun, 04 Jul 2021 12:01:42 +0000
2021-07-04 12:01:42 +00:00
||bixlerdesignbuild.com$all
Filter updated: Tue, 10 Aug 2021 00:01:49 +0000
2021-08-10 00:01:49 +00:00
||bizlinktek.com$all
Filter updated: Thu, 09 Sep 2021 00:01:56 +0000
2021-09-09 00:01:56 +00:00
||bizzcityinfo.com$all
Filter updated: Wed, 12 May 2021 12:06:30 UTC
2021-05-12 12:06:30 +00:00
||bk.fkip.ulm.ac.id$all
Filter updated: Thu, 09 Sep 2021 00:01:56 +0000
2021-09-09 00:01:56 +00:00
||black-base.ru$all
Filter updated: Mon, 20 Sep 2021 12:02:05 +0000
2021-09-20 12:02:05 +00:00
||black-queen-d446.mylogindhlupdate.workers.dev$all
Filter updated: Fri, 06 Aug 2021 00:01:52 +0000
2021-08-06 00:01:52 +00:00
||blanchevetements.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||blauwbloem.net$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||bliiss.shop$all
Filter updated: Sat, 19 Dec 2020 00:06:42 UTC
2020-12-19 00:06:42 +00:00
||blocks.rn86.ru$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||blog.cicil.co.id$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||blog.cotiabank.paypal-login.us$all
Filter updated: Fri, 07 May 2021 12:12:56 UTC
2021-05-07 12:12:56 +00:00
||blog.fatimaesportes.com.br$all
Filter updated: Thu, 16 Sep 2021 12:02:15 +0000
2021-09-16 12:02:15 +00:00
||blog.olx.pl.fastpayments.biz$all
Filter updated: Sat, 13 Mar 2021 12:07:44 UTC
2021-03-13 12:07:44 +00:00
||blog.powerlexis.ru$all
Filter updated: Sun, 13 Dec 2020 12:06:42 UTC
2020-12-13 12:06:42 +00:00
||blog.premiershop.com.br$all
Filter updated: Fri, 25 Jun 2021 00:06:14 +0000
2021-06-25 00:06:14 +00:00
||blog.tienghanthaybeo.com$all
Filter updated: Tue, 14 Sep 2021 12:01:44 +0000
2021-09-14 12:01:44 +00:00
||blog.visionconsulting.ro$all
Filter updated: Tue, 01 Dec 2020 12:06:48 UTC
2020-12-01 12:06:48 +00:00
||blog.weiwanjia.com$all
Filter updated: Mon, 03 May 2021 12:06:30 UTC
2021-05-03 12:06:31 +00:00
||blogdoaltivo.com.br$all
Filter updated: Tue, 27 Jul 2021 00:02:10 +0000
2021-07-27 00:02:10 +00:00
||bloomay.co$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||blubrown.com$all
Filter updated: Wed, 15 Sep 2021 00:01:54 +0000
2021-09-15 00:01:55 +00:00
||bluntlogsdhls.b-cdn.net$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||blusyne.lt$all
Filter updated: Sat, 18 Sep 2021 00:14:48 +0000
2021-09-18 00:14:48 +00:00
||bmartfurniture.com$all
Filter updated: Wed, 28 Jul 2021 12:01:46 +0000
2021-07-28 12:01:46 +00:00
||bmcfprqnatxlygnsttecjixltl-dot-gowa11111111.rj.r.appspot.com$all
Filter updated: Sat, 19 Jun 2021 00:06:27 +0000
2021-06-19 00:06:27 +00:00
||bnacion.byethost7.com$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||bnconacional.odoo.com$all
Filter updated: Fri, 24 Sep 2021 00:01:50 +0000
2021-09-24 00:01:51 +00:00
||bndigitalpersonas.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||bnznetguard.pythonanywhere.com$all
Filter updated: Tue, 21 Sep 2021 00:01:40 +0000
2021-09-21 00:01:40 +00:00
||boaswp.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||bodegalatinacorp-my.sharepoint.com/:x:/r/personal/012dsd_fiestamart_com/_layouts/15/wopiframe.aspx?guestaccesstoken=t3v5ldmmhrtlw5cyiohlp9z4yo7ufnrop9j1plyfdkm%3d&docid=1_1d89d259f7e704301aca26ac4dbabaa8d&wdformid=%7bfeb771e5%2d93ee%2d4015%2d8e87%2dd1c30d0f406a%7d&action=formsubmit&cid=f609fe16-56c4-4e2b-a964-75e250d31c99$all
Filter updated: Wed, 15 Sep 2021 12:01:46 +0000
2021-09-15 12:01:46 +00:00
||bodysuited.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||boersmustdie.co.za$all
Filter updated: Thu, 29 Jul 2021 00:01:57 +0000
2021-07-29 00:01:57 +00:00
||bofa.com-onlinebanking.com/xvezwsfzwwkhhm3b6zezgdfzeahvksep0ulvwu1nvvldosfpvv20xc1phzdnkruzuzfrstfnxwxdhme01vm5gt1n6zexlwfzvuvc5b1kzsjnrv0ywvm10sljuqjrzetk2vfvwrlvtafpovkeyujaxwgjuqmhnrtvzvdfkyvpsrljzbtb3tlv4yvjvsm9wwepzyznvefmymhdubuphyudob1pwbhlkm0jpverkevdytlbiamhcvdbjmvlxehlxazqxzws5su1uzg1rblpavkhsdvf5ohdua1pytjnvcmfwvmpvwfpgufmwdfzwvjvusfzoym0xu1rsum9arxblvku1cmjxc3jkeja5ls1iodg4n2zmyjnmymfhntzlymi4ntqymjy4yjdlyzjjyjc1owmwy2yx$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||bogdonovlerer.com$all
Filter updated: Tue, 05 Jan 2021 12:06:21 UTC
2021-01-05 12:06:22 +00:00
||boiclub.com$all
Filter updated: Wed, 22 Sep 2021 12:01:56 +0000
2021-09-22 12:01:56 +00:00
||boipelohlatshwayo.com$all
Filter updated: Thu, 03 Sep 2020 12:06:37 UTC
2020-09-03 12:06:37 +00:00
||bokep-xnxx7.jkub.com$all
Filter updated: Mon, 21 Sep 2020 00:06:20 UTC
2020-09-21 00:06:20 +00:00
||bokepress2020.dns2.us$all
Filter updated: Fri, 20 Aug 2021 00:01:56 +0000
2021-08-20 00:01:56 +00:00
||boliviaayudaa.blogspot.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||bolong3d.com$all
Filter updated: Sat, 03 Apr 2021 00:13:25 UTC
2021-04-03 00:13:25 +00:00
||bom.to/nlozan9lgoapq$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||boma-ren.firebaseapp.com$all
||bombogadget.com/public/-/areaclient/$all
Filter updated: Sun, 17 Jan 2021 00:06:45 UTC
2021-01-17 00:06:45 +00:00
||bonds-oldschools-runescapes.com$all
Filter updated: Tue, 21 Sep 2021 00:01:40 +0000
2021-09-21 00:01:40 +00:00
||bono-lnterbankpe.com$all
Filter updated: Tue, 13 Oct 2020 00:06:24 UTC
2020-10-13 00:06:24 +00:00
||bonomequedoencasa.blogspot.com/?aplicar$all
Filter updated: Mon, 20 Sep 2021 12:02:05 +0000
2021-09-20 12:02:05 +00:00
||boogeyedindignantly.info$all
Filter updated: Sat, 31 Jul 2021 00:01:51 +0000
2021-07-31 00:01:51 +00:00
||book.uz$all
Filter updated: Mon, 15 Mar 2021 12:43:24 UTC
2021-03-15 12:43:24 +00:00
||bookersbridge.com$all
Filter updated: Tue, 23 Mar 2021 12:16:28 UTC
2021-03-23 12:16:28 +00:00
||bookfbs.evangsamuelministries.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||booking-order.pl-id97118124.xyz$all
Filter updated: Mon, 20 Sep 2021 12:02:05 +0000
2021-09-20 12:02:05 +00:00
||booking.abqarie.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||booking.autoordered.xyz$all
||booking.pl-id08862333.xyz$all
||booking.pl-id29458764.xyz$all
Filter updated: Fri, 24 Sep 2021 12:02:36 +0000
2021-09-24 12:02:36 +00:00
||booking.pl-id32513080.xyz$all
Filter updated: Wed, 22 Sep 2021 12:01:56 +0000
2021-09-22 12:01:56 +00:00
||booking.pl-id65592797.xyz$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||booking.pl-id67594295.xyz$all
||booking.pl-id97118124.xyz$all
||booking.pl-id98463553.xyz$all
Filter updated: Tue, 14 Sep 2021 12:01:44 +0000
2021-09-14 12:01:44 +00:00
||booswk.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||bornxsuit.com$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||bosameri.onlinebusiness.sg$all
Filter updated: Thu, 28 Jan 2021 12:06:44 UTC
2021-01-28 12:06:44 +00:00
||bosnewpaye.com$all
Filter updated: Tue, 15 Jun 2021 00:06:35 UTC
2021-06-15 00:06:35 +00:00
||bosquechispazos.com$all
Filter updated: Thu, 19 Aug 2021 00:01:47 +0000
2021-08-19 00:01:47 +00:00
||bosspandemicgrant.com$all
Filter updated: Sun, 29 Aug 2021 00:01:50 +0000
2021-08-29 00:01:51 +00:00
||bottesdoc.my-free.website$all
Filter updated: Tue, 17 Aug 2021 00:02:45 +0000
2021-08-17 00:02:45 +00:00
||bovicor.pl$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||bowmanconsultinggroup-my.sharepoint.com/personal/rbennett_bowmanconsulting_com/_layouts/15/onedrive.aspx?id=/personal/rbennett_bowmanconsulting_com/documents/attachments/3/parcel209_fundsrequisition(rev).pdf&parent=/personal/rbennett_bowmanconsulting_com/documents/attachments/3&cid=3cd8dcbb-0e98-40c4-803e-02e9139b0130$all
||bowmanconsultinggroup-my.sharepoint.com/personal/rbennett_bowmanconsulting_com/_layouts/15/onedrive.aspx?id=/personal/rbennett_bowmanconsulting_com/documents/attachments/3/parcel209_fundsrequisition(rev).pdf&parent=/personal/rbennett_bowmanconsulting_com/documents/attachments/3&cid=821bbc7d-47b9-43c4-b158-eb4f8a6a6eb2$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||bowmanconsultinggroup-my.sharepoint.com/personal/rbennett_bowmanconsulting_com/_layouts/15/onedrive.aspx?id=/personal/rbennett_bowmanconsulting_com/documents/attachments/3/parcel209_fundsrequisition(rev).pdf&parent=/personal/rbennett_bowmanconsulting_com/documents/attachments/3&originalpath=ahr0chm6ly9ib3dtyw5jb25zdwx0aw5nz3jvdxatbxkuc2hhcmvwb2ludc5jb20vomi6l2cvcgvyc29uywwvcmjlbm5ldhrfym93bwfuy29uc3vsdgluz19jb20vrvzuzhrfsdfjvtfmb3l5qlpkdi0wbffcuxrowec5rgu3rkhnu01cmfv0bzv2dz9ydgltzt1qve9itvhevtewzw$all
||bowmanconsultinggroup-my.sharepoint.com/personal/rbennett_bowmanconsulting_com/_layouts/15/onedrive.aspx?id=/personal/rbennett_bowmanconsulting_com/documents/attachments/3/parcel209_fundsrequisition(rev).pdf&parent=/personal/rbennett_bowmanconsulting_com/documents/attachments/3&originalpath=ahr0chm6ly9ib3dtyw5jb25zdwx0aw5nz3jvdxatbxkuc2hhcmvwb2ludc5jb20vomi6l2cvcgvyc29uywwvcmjlbm5ldhrfym93bwfuy29uc3vsdgluz19jb20vrvzuzhrfsdfjvtfmb3l5qlpkdi0wbffcuxrowec5rgu3rkhnu01cmfv0bzv2dz9ydgltzt1ub3u1mfuwtjjfzw$all
Filter updated: Sat, 11 Sep 2021 00:34:15 +0000
2021-09-11 00:34:15 +00:00
||boxes.com.py$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||bpd4893.7r6q.mcgarth.com.au$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||bpl.kr$all
Filter updated: Tue, 06 Jul 2021 12:02:08 +0000
2021-07-06 12:02:09 +00:00
||br194.teste.website$all
Filter updated: Fri, 30 Jul 2021 00:01:47 +0000
2021-07-30 00:01:47 +00:00
||br4.in$all
Filter updated: Wed, 04 Nov 2020 00:06:25 UTC
2020-11-04 00:06:25 +00:00
||br622.teste.website$all
Filter updated: Sun, 05 Sep 2021 12:01:36 +0000
2021-09-05 12:01:37 +00:00
||braccwe.com$all
Filter updated: Fri, 27 Aug 2021 00:01:47 +0000
2021-08-27 00:01:47 +00:00
||bracows.com$all
Filter updated: Tue, 14 Sep 2021 00:01:48 +0000
2021-09-14 00:01:48 +00:00
||bradescobonusaqui.io$all
Filter updated: Wed, 08 Sep 2021 12:01:51 +0000
2021-09-08 12:01:51 +00:00
||branic.eu$all
Filter updated: Sat, 31 Jul 2021 12:01:55 +0000
2021-07-31 12:01:55 +00:00
||brannellyoutdoor.com.au$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||brassunnysolar.blogspot.com$all
||bravobeveiliging-my.sharepoint.com/:o:/g/personal/r_bouman_bravobeveiliging_nl/eiafjbddqltcmdxxrdbajdsbhfr37kusmucacmgoxitraa?e=drnrdm$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||bravobeveiliging-my.sharepoint.com/personal/r_bouman_bravobeveiliging_nl/_layouts/15/doc.aspx?sourcedoc={b08d0520-a8dd-42bb-9835-d7443040243b}&action=default&slrid=1bef3f9f-6078-2000-b22e-969d6b1087ac&originalpath=ahr0chm6ly9icmf2b2jldmvpbglnaw5nlw15lnnoyxjlcg9pbnquy29tlzpvoi9nl3blcnnvbmfsl3jfym91bwfux2jyyxzvymv2zwlsawdpbmdfbmwvrwlbrmpirgrxthrdburywfjeqkfkrhncagzsmzdlvxnnvunhy01nt3hjvfjhqt9ydgltzt02wvjzd2hitdewzw&cid=fa76d1ab-0178-4af6-9277-2f7cec72f87f$all
||bravobeveiliging-my.sharepoint.com/personal/r_bouman_bravobeveiliging_nl/_layouts/15/doc.aspx?sourcedoc={b08d0520-a8dd-42bb-9835-d7443040243b}&action=default&slrid=8cda429f-002e-2000-286c-d631557a1a52&originalpath=ahr0chm6ly9icmf2b2jldmvpbglnaw5nlw15lnnoyxjlcg9pbnquy29tlzpvoi9nl3blcnnvbmfsl3jfym91bwfux2jyyxzvymv2zwlsawdpbmdfbmwvrwlbrmpirgrxthrdburywfjeqkfkrhncagzsmzdlvxnnvunhy01nt3hjvfjhqt9ydgltzt0tckpwa0rmuzewzw&cid=23ce5c18-dd3c-4739-8673-ca39efd1bbee$all
Filter updated: Thu, 02 Sep 2021 12:02:02 +0000
2021-09-02 12:02:02 +00:00
||bravofoodskitchen.co.za$all
Filter updated: Tue, 17 Aug 2021 00:02:45 +0000
2021-08-17 00:02:45 +00:00
||brawcws.com$all
Filter updated: Sat, 28 Aug 2021 00:33:51 +0000
2021-08-28 00:33:51 +00:00
||brawrds.com$all
Filter updated: Tue, 01 Dec 2020 00:06:31 UTC
2020-12-01 00:06:31 +00:00
||breakevents.de$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||breakingthelimits.com$all
Filter updated: Wed, 11 Aug 2021 00:01:55 +0000
2021-08-11 00:01:55 +00:00
||bridgewatereh.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||bridgewaterma-my.sharepoint.com/:x:/r/personal/mkhunt_bridgewaterma_org/_layouts/15/wopiframe.aspx?guestaccesstoken=qhrrwxcv%2fa2j8c%2fukg2hcmebzjijcu25gjll3su0xl0%3d&docid=1_16e44d08a60144801bbfe65418a14c35f&wdformid=%7b40dfd724%2db9a0%2d4f06%2d934b%2d85e6c322e875%7d&action=formsubmit$all
||bridgewaterma-my.sharepoint.com/personal/mkhunt_bridgewaterma_org/_layouts/15/wopiframe.aspx?guestaccesstoken=/xnniui8cbcaalna0dt7bvzueqrakfgntkhwho5/z2k=&docid=1_16402b4f119204432b5a25eea9ef2a029&wdformid={154f97ef-3518-47f6-97a6-e96e783894e8}&action=formsubmit&cid=7e4a2819-73c1-4fca-9921-c9b62a19bd37$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||brief-demonstration-already-automation.trycloudflare.com$all
Filter updated: Wed, 20 Jan 2021 12:06:49 UTC
2021-01-20 12:06:49 +00:00
||brigida_cossette.gitlab.io$all
Filter updated: Mon, 22 Mar 2021 12:06:55 UTC
2021-03-22 12:06:55 +00:00
||britainwestmotorsport.com/wp-content/plugins/login.globalsources.com/sso/generalmanager.php$all
Filter updated: Tue, 14 Sep 2021 12:01:44 +0000
2021-09-14 12:01:44 +00:00
||broacfe.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||brodcast6002.blogspot.com$all
Filter updated: Tue, 14 Sep 2021 12:01:44 +0000
2021-09-14 12:01:44 +00:00
||broeaw.com$all
Filter updated: Fri, 24 Sep 2021 00:01:50 +0000
2021-09-24 00:01:51 +00:00
||brooksbrasil.com$all
Filter updated: Wed, 25 Aug 2021 00:01:57 +0000
2021-08-25 00:01:57 +00:00
||brookssalenz.com$all
Filter updated: Wed, 18 Aug 2021 00:01:50 +0000
2021-08-18 00:01:50 +00:00
||brooksshoessingapore.com$all
Filter updated: Fri, 24 Sep 2021 00:01:50 +0000
2021-09-24 00:01:51 +00:00
||brookssoldes.fr$all
Filter updated: Thu, 08 Jul 2021 00:02:02 +0000
2021-07-08 00:02:02 +00:00
||broowdea.com$all
Filter updated: Fri, 10 Sep 2021 00:02:17 +0000
2021-09-10 00:02:17 +00:00
||brouhk.com$all
Filter updated: Sun, 06 Jun 2021 12:06:15 UTC
2021-06-06 12:06:16 +00:00
||browdfse.com$all
Filter updated: Sat, 11 Sep 2021 00:34:15 +0000
2021-09-11 00:34:15 +00:00
||brownstone-wealth.com$all
Filter updated: Tue, 07 Sep 2021 00:01:46 +0000
2021-09-07 00:01:46 +00:00
||bruno-genthial.mykajabi.com$all
Filter updated: Fri, 04 Jun 2021 12:07:04 UTC
2021-06-04 12:07:04 +00:00
||brwfeai.com$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||bt-105198.square.site$all
||bt-admin.webflow.io$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||bt-openreach.4747-update.com$all
Filter updated: Thu, 16 Sep 2021 12:02:15 +0000
2021-09-16 12:02:15 +00:00
||bt-telecommunication-102883.square.site$all
Filter updated: Thu, 16 Sep 2021 00:01:52 +0000
2021-09-16 00:01:52 +00:00
||bt-verifybilling.com$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||bt-world.webflow.io$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||bt101t.weebly.com$all
Filter updated: Wed, 07 Jul 2021 00:01:56 +0000
2021-07-07 00:01:57 +00:00
||btbusinessbilling.wordpress.com$all
Filter updated: Mon, 28 Jun 2021 12:06:20 +0000
2021-06-28 12:06:20 +00:00
||btconnectdacsdesrf.yolasite.com$all
Filter updated: Fri, 27 Aug 2021 00:01:47 +0000
2021-08-27 00:01:47 +00:00
||btconnectfilesecurebthomelogindropboxinkupdatetdropboxpdf-logss.yolasite.com$all
Filter updated: Fri, 27 Aug 2021 12:01:40 +0000
2021-08-27 12:01:40 +00:00
||btconnectfilesecurebthomelogindropboxinupdatetdropboxpdf-logss.yolasite.com$all
||btconnectfilesecurebthomelogindropboxlinkupdatetdropboxpdf-logs.yolasite.com$all
Filter updated: Fri, 27 Aug 2021 00:01:47 +0000
2021-08-27 00:01:47 +00:00
||btconnectfilesecurebthomeloginpdropboxupdatepdf-logsssss-websit.yolasite.com$all
||btconnectfilesecurebthomesloginpdropboxupdatepdf-logsssss-websi.yolasite.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||btconnectmailer.shop$all
Filter updated: Thu, 23 Sep 2021 00:02:18 +0000
2021-09-23 00:02:18 +00:00
||bthelphub.weebly.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||btsernmanets.weebly.com$all
Filter updated: Tue, 14 Sep 2021 12:01:44 +0000
2021-09-14 12:01:44 +00:00
||budgetbuys.co.za$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||buildingtradesnetwork.com$all
Filter updated: Tue, 14 Sep 2021 12:01:44 +0000
2021-09-14 12:01:44 +00:00
||buildium.com.au$all
Filter updated: Tue, 16 Mar 2021 00:07:08 UTC
2021-03-16 00:07:09 +00:00
||bujikena.web.app$all
Filter updated: Sun, 11 Apr 2021 12:06:35 UTC
2021-04-11 12:06:35 +00:00
||businessemailss.biz$all
Filter updated: Tue, 27 Oct 2020 00:06:10 UTC
2020-10-27 00:06:11 +00:00
||buyelectronicsnyc.com$all
Filter updated: Tue, 21 Sep 2021 00:01:40 +0000
2021-09-21 00:01:40 +00:00
||bw-bank.de.account-next.com$all
Filter updated: Sat, 03 Jul 2021 00:01:56 +0000
2021-07-03 00:01:56 +00:00
||bwithive.com$all
Filter updated: Tue, 31 Aug 2021 12:01:54 +0000
2021-08-31 12:01:54 +00:00
||byentinfoterra.byethost7.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||byoko.co.kr$all
Filter updated: Mon, 20 Sep 2021 12:02:05 +0000
2021-09-20 12:02:05 +00:00
||byyebaoblnpbwldxefedhkodpr-dot-goff039302032323.rj.r.appspot.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||byygw.csb.app$all
||bzrider.com$all
Filter updated: Thu, 29 Jul 2021 00:01:57 +0000
2021-07-29 00:01:57 +00:00
||bzrsuliflygaflfsleorrpbeqv-dot-goff039302032323.rj.r.appspot.com$all
Filter updated: Fri, 24 Sep 2021 00:01:50 +0000
2021-09-24 00:01:51 +00:00
||c.curiousmorty.be$all
Filter updated: Sun, 19 Sep 2021 12:01:34 +0000
2021-09-19 12:01:35 +00:00
||c.jardindemiedo.es$all
Filter updated: Fri, 24 Sep 2021 00:01:50 +0000
2021-09-24 00:01:51 +00:00
||c.loveawaits.be$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||c.mail.com$all
Filter updated: Thu, 09 Sep 2021 00:01:56 +0000
2021-09-09 00:01:56 +00:00
||c.na70.prod.dfg152.ru$all
Filter updated: Sun, 19 Sep 2021 12:01:34 +0000
2021-09-19 12:01:35 +00:00
||c.trofeominero.es$all
Filter updated: Tue, 23 Mar 2021 00:10:01 UTC
2021-03-23 00:10:01 +00:00
||c00.us$all
Filter updated: Wed, 01 Sep 2021 12:01:58 +0000
2021-09-01 12:01:58 +00:00
||c0d2e1cc795cbf7fc42ca6c427f3e66f.mtmba.ru$all
Filter updated: Tue, 14 Sep 2021 00:01:48 +0000
2021-09-14 00:01:48 +00:00
||c0hbz754.caspio.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||c0p3r0l4-videos-01.jimdofree.com$all
Filter updated: Sun, 11 Jul 2021 00:02:18 +0000
2021-07-11 00:02:18 +00:00
||c11.kr/q72e$all
Filter updated: Mon, 09 Aug 2021 00:02:27 +0000
2021-08-09 00:02:27 +00:00
||c11.kr/qiq3$all
Filter updated: Mon, 03 May 2021 12:06:30 UTC
2021-05-03 12:06:31 +00:00
||c1970424.ferozo.com$all
Filter updated: Sun, 06 Jun 2021 12:06:15 UTC
2021-06-06 12:06:16 +00:00
||c3cd5ac5.sibforms.com$all
Filter updated: Wed, 11 Nov 2020 12:06:45 UTC
2020-11-11 12:06:45 +00:00
||c5lws.app.link$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||c6ebl792.caspio.com$all
||c6ebv708.caspio.com$all
Filter updated: Sat, 21 Aug 2021 00:01:53 +0000
2021-08-21 00:01:54 +00:00
||c7118bbaa21d429462a378145a66fb9c-dot-goff039302032323.rj.r.appspot.com$all
Filter updated: Sat, 10 Jul 2021 00:01:42 +0000
2021-07-10 00:01:42 +00:00
||c7811.wv2.masterbase.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||c982-2401-4900-4ac3-92b2-2bad-3d1f-1692-6858.ngrok.io$all
Filter updated: Fri, 10 Sep 2021 00:02:17 +0000
2021-09-10 00:02:17 +00:00
||ca45645fggfi88.gb.net$all
Filter updated: Fri, 09 Jul 2021 00:01:59 +0000
2021-07-09 00:01:59 +00:00
||cabconnect.com.au/images/wet/2020dhl_topscript/dhl_topscript/cmd-login=1594971c7415418b0ac0a21c58af3912$all
Filter updated: Tue, 06 Jul 2021 00:01:42 +0000
2021-07-06 00:01:42 +00:00
||cabconnect.com.au/images/wet/2020dhl_topscript/dhl_topscript/cmd-login=1594971c7415418b0ac0a21c58af3912/?email=&loginpage=&reff=nwm2zgjjoge5ztziyzaznwzin2yynjnlmdjindljm2e=$all
||cabconnect.com.au/images/wet/2020dhl_topscript/dhl_topscript/cmd-login=1594971c7415418b0ac0a21c58af3912?email=&loginpage=&reff=nwm2zgjjoge5ztziyzaznwzin2yynjnlmdjindljm2e=$all
Filter updated: Tue, 20 Jul 2021 12:01:48 +0000
2021-07-20 12:01:48 +00:00
||cableresellerdeals.com$all
Filter updated: Thu, 13 May 2021 12:06:27 UTC
2021-05-13 12:06:28 +00:00
||cache.nebula.phx3.secureserver.net$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||cadacosaalseulloc.cresidusvo.info$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||cafejipretona.com$all
Filter updated: Mon, 20 Sep 2021 12:02:05 +0000
2021-09-20 12:02:05 +00:00
||cairoscan.com.eg$all
Filter updated: Sat, 21 Aug 2021 00:01:53 +0000
2021-08-21 00:01:54 +00:00
||caixa-app.comb1.sg-host.com/sac/seguro/$all
||caixa-app.comb1.sg-host.com/sac/seguro/home.html$all
Filter updated: Tue, 29 Jun 2021 12:02:07 +0000
2021-06-29 12:02:07 +00:00
||caixa-gov.com$all
Filter updated: Fri, 21 May 2021 00:06:36 UTC
2021-05-21 00:06:36 +00:00
||cajuecastanha.art.br$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||cakedigital.com.br$all
Filter updated: Wed, 09 Dec 2020 12:06:49 UTC
2020-12-09 12:06:49 +00:00
||cakesbyannemotha.com$all
Filter updated: Thu, 22 Jul 2021 00:01:54 +0000
2021-07-22 00:01:54 +00:00
||calm-bay-082938110.azurestaticapps.net$all
Filter updated: Wed, 01 Sep 2021 00:02:20 +0000
2021-09-01 00:02:20 +00:00
||calstatela.latefa-ahrrare.com$all
||calvinkleinindia.co.in$all
Filter updated: Thu, 02 Sep 2021 12:02:02 +0000
2021-09-02 12:02:02 +00:00
||calvinkleinsouthafrica.co.za$all
Filter updated: Fri, 04 Sep 2020 12:06:38 UTC
2020-09-04 12:06:38 +00:00
||calzadosiris.com$all
Filter updated: Tue, 21 Sep 2021 12:02:11 +0000
2021-09-21 12:02:11 +00:00
||camaieufr.commander1.com/c3/?tcs=3206&chn=email&src=fid&cmp=fr_fid_s21_20200518_relance%201_fashion_ticket_tropical_bonusp_actives&uid=7086818&user_num_personne=7086818&e5=24c4eb200e71b3eb38cd32a42a5f2cc5&s6=81f1690cc2f5589790304e5e3f98360bd48350cd09ff6e39cc8cd0a6e00d5ff2&med=email_fid&url=https%3a%2f%2feyheremendy.com%2fno$all
Filter updated: Wed, 19 May 2021 00:06:43 UTC
2021-05-19 00:06:44 +00:00
||camarapiracicaba.zyrosite.com$all
Filter updated: Wed, 02 Jun 2021 00:06:23 UTC
2021-06-02 00:06:23 +00:00
||cambodiatraining.com$all
Filter updated: Tue, 03 Aug 2021 00:01:58 +0000
2021-08-03 00:01:58 +00:00
||camkayamernsgzenmfhfhahikao.com$all
Filter updated: Thu, 16 Sep 2021 00:01:52 +0000
2021-09-16 00:01:52 +00:00
||canaldenegociosb2b.com.br$all
Filter updated: Sun, 25 Oct 2020 12:06:32 UTC
2020-10-25 12:06:32 +00:00
||cannellandcoflooring.co.uk$all
Filter updated: Thu, 23 Sep 2021 00:02:18 +0000
2021-09-23 00:02:18 +00:00
||cantonstreetsocialmedia.com$all
Filter updated: Tue, 21 Sep 2021 00:01:40 +0000
2021-09-21 00:01:40 +00:00
||cantonsurgery.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||capacitaciongratisbo.com$all
Filter updated: Sun, 05 Sep 2021 00:02:15 +0000
2021-09-05 00:02:15 +00:00
||capeverderealtors.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||capholeful1978.blogspot.be$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||cappa.com.mx$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||capservice.online$all
||caracasmateriais.blogspot.com$all
Filter updated: Tue, 14 Sep 2021 12:01:44 +0000
2021-09-14 12:01:44 +00:00
||caraopweveyo.com$all
Filter updated: Thu, 24 Jun 2021 00:06:35 +0000
2021-06-24 00:06:35 +00:00
||card-entry-trackid-access-denied.codeanyapp.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||carnegieproperty-my.sharepoint.com/personal/helen_carnegieproperty_com/_layouts/15/wopiframe.aspx?guestaccesstoken=i93ri6e azsglandv8xwijahnamcfopa87otqqw4lly=&docid=1_18f09536ac24d4b6c9bd785b3d27746bc&wdformid={59ac2fc4-0767-42b6-a127-cc529a92b57e}&action=formsubmit$all
||carnegieproperty-my.sharepoint.com/personal/helen_carnegieproperty_com/_layouts/15/wopiframe.aspx?guestaccesstoken=i93ri6e+azsglandv8xwijahnamcfopa87otqqw4lly=&docid=1_18f09536ac24d4b6c9bd785b3d27746bc&wdformid={59ac2fc4-0767-42b6-a127-cc529a92b57e}&action=formsubmit$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||carolahart.com/guy%20alan%20riedy/mazon/amazon$all
Filter updated: Fri, 10 Sep 2021 00:02:17 +0000
2021-09-10 00:02:17 +00:00
||cartao.bradesclub.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||carwash.tv$all
Filter updated: Fri, 27 Aug 2021 12:01:40 +0000
2021-08-27 12:01:40 +00:00
||casaapisoseacabamentos.com.br$all
Filter updated: Thu, 11 Feb 2021 12:07:21 UTC
2021-02-11 12:07:21 +00:00
||casaverdeatelie.com$all
Filter updated: Thu, 08 Jul 2021 12:02:13 +0000
2021-07-08 12:02:14 +00:00
||cashbox.com.bd$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||cashflowfxonline.com$all
Filter updated: Thu, 22 Jul 2021 00:01:54 +0000
2021-07-22 00:01:54 +00:00
||casoamarillox949.byethost14.com$all
Filter updated: Sat, 12 Sep 2020 12:06:46 UTC
2020-09-12 12:06:46 +00:00
||casosapple.com-verificacionapple.com$all
Filter updated: Sun, 30 May 2021 12:06:22 UTC
2021-05-30 12:06:22 +00:00
||castcome.berlinmode.com$all
Filter updated: Wed, 08 Sep 2021 12:01:51 +0000
2021-09-08 12:01:51 +00:00
||casteels-my.sharepoint.com/personal/c_flemal_casteels_fr/_layouts/15/doc.aspx?sourcedoc=%7bac01bb45-c705-4f5f-8e7b-f57fd9daf685%7d&action=default&slrid=5693e09f-10cf-c000-546d-77ec6ca5a846&originalpath=ahr0chm6ly9jyxn0zwvscy1tes5zagfyzxbvaw50lmnvbs86bzovzy9wzxjzb25hbc9jx2zszw1hbf9jyxn0zwvsc19mci9fa1c3qwf3rngxovbqbnyxzjluytlvvuiyakvlb0xnwgdyvudizvpqshvgvevrp3j0aw1lputpuup0mgrumlvn&cid=5a243ddd-6725-481f-a04f-2a70203b7ad9$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||castennisacademy.be$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||castillohousing-my.sharepoint.com/personal/acastillo_castillohousing_com/_layouts/15/wopiframe.aspx$all
Filter updated: Wed, 15 Sep 2021 12:01:46 +0000
2021-09-15 12:01:46 +00:00
||castlemarne.com$all
Filter updated: Tue, 07 Sep 2021 00:01:46 +0000
2021-09-07 00:01:46 +00:00
||catalogue-orange.com$all
Filter updated: Fri, 16 Jul 2021 12:01:57 +0000
2021-07-16 12:01:57 +00:00
||cater456harys.gb.net$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||caterin9302.byethost6.com$all
Filter updated: Thu, 29 Jul 2021 00:01:57 +0000
2021-07-29 00:01:57 +00:00
||cateringfoodanddrinksupplies777.business.site$all
Filter updated: Wed, 08 Sep 2021 12:01:51 +0000
2021-09-08 12:01:51 +00:00
||catherinehennig.com$all
Filter updated: Tue, 14 Sep 2021 12:01:44 +0000
2021-09-14 12:01:44 +00:00
||caycos.beispielseite-wmka.de$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||cayecaulkercasita.com/krsettlindad/home.php$all
Filter updated: Tue, 21 Sep 2021 00:01:40 +0000
2021-09-21 00:01:40 +00:00
||cb64150.tmweb.ru$all
Filter updated: Wed, 28 Jul 2021 12:01:46 +0000
2021-07-28 12:01:46 +00:00
||cbdbyrxjessokcpamoitllthky-dot-gowa11111111.rj.r.appspot.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||cbic.org.br/cbic/wp-content/uploads/wpallimport/logs/7bbea5ce9b2c639903ba92174b2eb446/sfr/2.html$all
Filter updated: Tue, 15 Jun 2021 12:29:08 UTC
2021-06-15 12:29:08 +00:00
||cbic.org.br/wp-content/uploads/wpallimport/logs/7bbea5ce9b2c639903ba92174b2eb446/sfr/2.html$all
Filter updated: Mon, 13 Sep 2021 12:01:52 +0000
2021-09-13 12:01:52 +00:00
||cbkcares.org$all
Filter updated: Tue, 29 Jun 2021 12:02:07 +0000
2021-06-29 12:02:07 +00:00
||cbl57.csb.app$all
Filter updated: Fri, 24 Sep 2021 12:02:36 +0000
2021-09-24 12:02:36 +00:00
||cbtpg.com$all
Filter updated: Fri, 10 Sep 2021 00:02:17 +0000
2021-09-10 00:02:17 +00:00
||cc.bingj.com/cache.aspx?q=1and1%20webmail&d=4934591237720511&mkt=fr-fr&setlang=en-us&w=zwlbvlrpoedd_lvvki3ozinleekk_izq$all
Filter updated: Fri, 27 Aug 2021 12:01:40 +0000
2021-08-27 12:01:40 +00:00
||cc.bingj.com/cache.aspx?q=1and1+webmail&d=4934591237720511&mkt=fr-fr&setlang=en-us&w=zwlbvlrpoedd_lvvki3ozinleekk_izq$all
Filter updated: Fri, 10 Sep 2021 00:02:17 +0000
2021-09-10 00:02:17 +00:00
||cc.bingj.com/cache.aspx?q=https://navidmedshop.com/shop/page/1/?per_page=9&d=4934591237720511&mkt=en-us&setlang=en-us&w=cgljurrpoedd_lvvki3ozinleekk_izq$all
Filter updated: Fri, 05 Feb 2021 12:06:59 UTC
2021-02-05 12:06:59 +00:00
||ccjrlaw.com$all
Filter updated: Wed, 15 Sep 2021 00:01:54 +0000
2021-09-15 00:01:55 +00:00
||cd97574.tmweb.ru$all
Filter updated: Sun, 19 Sep 2021 00:02:16 +0000
2021-09-19 00:02:17 +00:00
||cdc.ulm.ac.id$all
Filter updated: Thu, 11 Mar 2021 12:07:41 UTC
2021-03-11 12:07:41 +00:00
||cdn.shopify.com/s/files/1/0533/5367/6992/t/3/assets/home.html$all
Filter updated: Wed, 02 Jun 2021 12:06:27 UTC
2021-06-02 12:06:28 +00:00
||cdn.via.com$all
Filter updated: Wed, 08 Sep 2021 00:02:08 +0000
2021-09-08 00:02:08 +00:00
||ce04337.tmweb.ru$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||cea42u7sa1l.typeform.com$all
Filter updated: Thu, 03 Sep 2020 12:06:37 UTC
2020-09-03 12:06:37 +00:00
||cebuphonly.jrzoutsourcingservices.com$all
Filter updated: Fri, 22 Jan 2021 00:06:31 UTC
2021-01-22 00:06:31 +00:00
||cedarcp.cl$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||cellidplus.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||celtabet2.blogspot.com$all
||celtabet88.blogspot.com$all
||celtabets.blogspot.com$all
||celtabets2020.blogspot.com$all
Filter updated: Sun, 07 Mar 2021 00:06:38 UTC
2021-03-07 00:06:38 +00:00
||cema-fossano.it$all
Filter updated: Wed, 08 Sep 2021 00:02:08 +0000
2021-09-08 00:02:08 +00:00
||cemalelektronik.com.tr$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||censor.be$all
Filter updated: Wed, 18 Aug 2021 12:02:35 +0000
2021-08-18 12:02:36 +00:00
||centec-am.com.br$all
Filter updated: Tue, 21 Sep 2021 12:02:11 +0000
2021-09-21 12:02:11 +00:00
||center-exodus.com$all
Filter updated: Tue, 17 Aug 2021 00:02:45 +0000
2021-08-17 00:02:45 +00:00
||center-kosher.rol.co.il$all
Filter updated: Sat, 21 Aug 2021 00:01:53 +0000
2021-08-21 00:01:54 +00:00
||center-ucmidasbuy.net$all
Filter updated: Tue, 13 Oct 2020 12:06:53 UTC
2020-10-13 12:06:53 +00:00
||centericmailinwebs.wapka.website$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||centerstlending-my.sharepoint.com/personal/rnewcomer_centerstreetlending_com/_layouts/15/wopiframe.aspx?guestaccesstoken=j%2f9wodhj7u8077urui6lxbx%2b9vwlzr11ry0pztfyrwq%3d&docid=1_1fabe326fc77a4441995d0cc407c8c49c&wdformid=%7b56d05c68%2d7055%2d4573%2db79b%2df286b64f5853%7d&action=formsubmit$all
Filter updated: Thu, 18 Feb 2021 00:06:34 UTC
2021-02-18 00:06:34 +00:00
||centralconsulta.link$all
Filter updated: Thu, 29 Jul 2021 00:01:57 +0000
2021-07-29 00:01:57 +00:00
||centralsuporteavc.comunidades.net$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||centre1.bubbleapps.io$all
Filter updated: Tue, 19 Jan 2021 12:07:14 UTC
2021-01-19 12:07:14 +00:00
||centriccenteradmin.wapka.website$all
Filter updated: Wed, 16 Sep 2020 12:06:34 UTC
2020-09-16 12:06:34 +00:00
||centruldepiele.ro$all
Filter updated: Tue, 12 Jan 2021 12:06:44 UTC
2021-01-12 12:06:44 +00:00
||certifica-montepaschii.com$all
Filter updated: Mon, 31 May 2021 12:06:30 UTC
2021-05-31 12:06:30 +00:00
||cete-lem-fatura.net$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||cew.safewallet.replayattack.us$all
||cf50l.csb.app$all
Filter updated: Wed, 25 Nov 2020 12:06:48 UTC
2020-11-25 12:06:48 +00:00
||cg-oe.snprobbx.pbz.r.de.a2ip.ru$all
Filter updated: Tue, 09 Feb 2021 12:06:34 UTC
2021-02-09 12:06:34 +00:00
||cg00737-wordpress-2.tw1.ru$all
Filter updated: Fri, 24 Sep 2021 12:02:36 +0000
2021-09-24 12:02:36 +00:00
||ch-my-mtb.com$all
Filter updated: Thu, 22 Jul 2021 00:01:54 +0000
2021-07-22 00:01:54 +00:00
||ch.kontoportal.com$all
Filter updated: Mon, 08 Feb 2021 12:09:02 UTC
2021-02-08 12:09:02 +00:00
||ch.marketing-gentleman.io$all
Filter updated: Thu, 03 Sep 2020 12:06:37 UTC
2020-09-03 12:06:37 +00:00
||ch.net2care.com$all
||ch.tcorner.fr$all
Filter updated: Sat, 12 Jun 2021 00:25:37 UTC
2021-06-12 00:25:37 +00:00
||ch.v-update.com$all
Filter updated: Sat, 06 Feb 2021 00:06:52 UTC
2021-02-06 00:06:53 +00:00
||chaisalert.com/basic.php?k=4fa9db0267dbfa61c8978ff8809f6b071f02c997&viewed=1$all
Filter updated: Wed, 28 Apr 2021 00:06:29 UTC
2021-04-28 00:06:29 +00:00
||chaishaica.com$all
Filter updated: Tue, 23 Feb 2021 12:07:09 UTC
2021-02-23 12:07:09 +00:00
||charperimagedesign.com$all
Filter updated: Tue, 17 Aug 2021 12:01:39 +0000
2021-08-17 12:01:39 +00:00
||chase.ictprosupport.com/en/?63686173652e69637470726f737570706f72742e636f6d$all
Filter updated: Tue, 17 Aug 2021 00:02:45 +0000
2021-08-17 00:02:45 +00:00
||chase.ictprosupport.com/en/?7777772e63686173652e69637470726f737570706f72742e636f6d$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||chat-watsap-ynd87proxxd573fren86cbg65inc.duckdns.org$all
Filter updated: Tue, 06 Jul 2021 12:02:08 +0000
2021-07-06 12:02:09 +00:00
||chat-whatasapp.com$all
Filter updated: Sat, 15 May 2021 12:06:44 UTC
2021-05-15 12:06:44 +00:00
||chat-whatasqp.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||chat-whatsapp-kmamye4ffnmjetoiqmcxy4.duckdns.org$all
||chat-whatsapp-nailaa.duckdns.org$all
Filter updated: Wed, 16 Jun 2021 00:06:45 +0000
2021-06-16 00:06:45 +00:00
||chat-whatsapp.doctorhaddadpediatriayflores.cl$all
Filter updated: Thu, 03 Sep 2020 12:06:37 UTC
2020-09-03 12:06:37 +00:00
||chat-whatsapp.vizvaz.com$all
Filter updated: Mon, 20 Sep 2021 00:01:41 +0000
2021-09-20 00:01:41 +00:00
||chat-whatsapp0.se.ke$all
Filter updated: Sun, 13 Sep 2020 00:07:18 UTC
2020-09-13 00:07:18 +00:00
||chat-whatsappgrupjoinbokepweb.zzux.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||chatwhatsappgroups11.otzo.com$all
Filter updated: Thu, 14 Jan 2021 00:06:20 UTC
2021-01-14 00:06:20 +00:00
||check-newpayee-halfax.com$all
Filter updated: Sat, 22 May 2021 12:07:44 UTC
2021-05-22 12:07:44 +00:00
||checkpayroll.creatorlink.net$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||chef-shehata.us$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||chefrachel.co.uk$all
Filter updated: Sun, 25 Jul 2021 00:01:57 +0000
2021-07-25 00:01:58 +00:00
||cherellll.fr$all
Filter updated: Fri, 27 Aug 2021 00:01:47 +0000
2021-08-27 00:01:47 +00:00
||chickenempty.top$all
Filter updated: Wed, 01 Sep 2021 12:01:58 +0000
2021-09-01 12:01:58 +00:00
||chikkuthomas.github.io$all
Filter updated: Wed, 23 Sep 2020 12:06:42 UTC
2020-09-23 12:06:42 +00:00
||chileanylgroup.cl$all
Filter updated: Fri, 20 Aug 2021 00:01:56 +0000
2021-08-20 00:01:56 +00:00
||chileflorerias.com$all
Filter updated: Tue, 01 Jun 2021 12:06:34 UTC
2021-06-01 12:06:34 +00:00
||chintamanibeachhouse.com$all
Filter updated: Mon, 09 Nov 2020 00:06:10 UTC
2020-11-09 00:06:10 +00:00
||chirurgie-estetica.md$all
Filter updated: Sat, 26 Jun 2021 12:06:10 +0000
2021-06-26 12:06:10 +00:00
||choosefrombazar.com$all
Filter updated: Sat, 04 Sep 2021 12:01:40 +0000
2021-09-04 12:01:40 +00:00
||christwepreach.org$all
Filter updated: Thu, 18 Feb 2021 00:06:34 UTC
2021-02-18 00:06:34 +00:00
||chronopostvalidation.blogspot.com/2021/02/blog-post_12.html$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||chuyennghiep.vn$all
Filter updated: Wed, 02 Jun 2021 00:06:23 UTC
2021-06-02 00:06:23 +00:00
||chvers1.cloudns.cl$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||ci64540.tmweb.ru$all
Filter updated: Fri, 27 Aug 2021 00:01:47 +0000
2021-08-27 00:01:47 +00:00
||ci69056.tmweb.ru$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||cicoef.top$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||ciet-itac.ca$all
Filter updated: Tue, 13 Jul 2021 00:02:30 +0000
2021-07-13 00:02:30 +00:00
||cilerakinakdeniz.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||cimslp-my.sharepoint.com/:x:/r/personal/eric_cimsltd_com/_layouts/15/wopiframe.aspx?guestaccesstoken=wnhqsp58ikn1qzzozpe2oiw%2fmizdr53wegdbyscml7y%3d&docid=1_1207bcf2f71094b5cb97dcb5bea3e1a3a&wdformid=%7bd98de46a%2d2777%2d417f%2dbbcf%2d5f08c8244727%7d&action=formsubmit$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||cinamamavara.ir$all
||cinamamavara.ir/wp-content/app/bbt.com.update.new.secure/bbt2021/$all
Filter updated: Thu, 11 Feb 2021 12:07:21 UTC
2021-02-11 12:07:21 +00:00
||cincinnatl-test.ebpages.com$all
Filter updated: Fri, 20 Aug 2021 12:01:48 +0000
2021-08-20 12:01:48 +00:00
||cingular-oac.qpass.com/oac/html/signin.do$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||cipmconference.org$all
Filter updated: Sat, 27 Feb 2021 00:09:37 UTC
2021-02-27 00:09:37 +00:00
||citaenlineacr.co$all
Filter updated: Thu, 29 Jul 2021 00:01:57 +0000
2021-07-29 00:01:57 +00:00
||citibankonliine.com$all
Filter updated: Thu, 12 Aug 2021 00:01:53 +0000
2021-08-12 00:01:54 +00:00
||citsnet.org$all
Filter updated: Sun, 14 Mar 2021 00:12:43 UTC
2021-03-14 00:12:43 +00:00
||city-of-jazz.de$all
Filter updated: Tue, 09 Feb 2021 12:06:34 UTC
2021-02-09 12:06:34 +00:00
||citycouncil-refund.com$all
Filter updated: Sun, 27 Jun 2021 12:06:19 +0000
2021-06-27 12:06:19 +00:00
||cityoutlet.es$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||cityschools2013-my.sharepoint.com/personal/mkphenicie_bcps_k12_md_us/_layouts/15/wopiframe.aspx?guestaccesstoken=8mqz0pbaequkjg%2bwcpnqtgwrswdh4azr%2bsinor8cw8m%3d&docid=1_1058175d7d73f4b39bb114b0dd340d168&wdformid=%7b1fd2a3e2%2d7ce8%2d4700%2db944%2d171b6be0cea6%7d&action=formsubmit$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||civdiff.com/us/us_launcc/?uclick=pm16ftqn8n&uclickhash=pm16ftqn8n-pm16ftqn8n-5ma9-0-xsntvr-xrej6o-xrtlbl-1e84c6&n=unknown$all
Filter updated: Tue, 14 Sep 2021 12:01:44 +0000
2021-09-14 12:01:44 +00:00
||ck33675.tmweb.ru$all
Filter updated: Sun, 15 Aug 2021 00:01:57 +0000
2021-08-15 00:01:57 +00:00
||ckmadae.com$all
Filter updated: Wed, 14 Apr 2021 12:07:09 UTC
2021-04-14 12:07:09 +00:00
||ckwgruppe.service-now.com$all
Filter updated: Tue, 17 Nov 2020 00:06:23 UTC
2020-11-17 00:06:23 +00:00
||cla2020gov.com$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||claim.redirect.tax2refunds.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||claimdiamondff.se.ke$all
Filter updated: Sun, 19 Sep 2021 12:01:34 +0000
2021-09-19 12:01:35 +00:00
||claimmzmlbbz3.tk$all
||claimmzmlbbz5.tk$all
||claimmzmlbbz8.gq$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||claimnow-mlbbfree.gdsv.cf$all
Filter updated: Thu, 23 Sep 2021 00:02:18 +0000
2021-09-23 00:02:18 +00:00
||claims-funds-enczj.run-us-west2.goorm.io$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||claro-controle-downloader.m4u.com.br$all
Filter updated: Mon, 20 Sep 2021 12:02:05 +0000
2021-09-20 12:02:05 +00:00
||classroomnovel.info$all
Filter updated: Tue, 16 Mar 2021 12:06:41 UTC
2021-03-16 12:06:42 +00:00
||claus.bz$all
Filter updated: Thu, 28 Jan 2021 00:06:21 UTC
2021-01-28 00:06:21 +00:00
||clearstageconsulting.com$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||clejohn.hyperphp.com$all
Filter updated: Sat, 28 Aug 2021 00:33:51 +0000
2021-08-28 00:33:51 +00:00
||clemensrau.de$all
Filter updated: Mon, 20 Sep 2021 12:02:05 +0000
2021-09-20 12:02:05 +00:00
||click-here.it$all
Filter updated: Sat, 06 Feb 2021 12:06:42 UTC
2021-02-06 12:06:42 +00:00
||click.em32dat.eu$all
Filter updated: Sun, 18 Jul 2021 12:02:04 +0000
2021-07-18 12:02:04 +00:00
||click.email.office.com/?qs=9cf30363dd29315c3e11be7b9f86e0023a565c20a2375038e17cde83e3918d351e9c862894eecd698e1a9bb86157937bcf1b994ad1bf797a$all
Filter updated: Thu, 18 Feb 2021 12:07:12 UTC
2021-02-18 12:07:12 +00:00
||click.mail.onedrive.com/?qs=db04a8b2d7b04d1f6b3c69c4c5805dfc93097e61c800b87bab9654d4ce1ee7f86c05b36196ea1c673c13d490edbadd368c6e8f39eb68b3bb$all
Filter updated: Wed, 28 Apr 2021 00:06:29 UTC
2021-04-28 00:06:29 +00:00
||click.message.fruit.com/?qs=6541641088c869552ced792d84ee93eabf075e23cd5eba83a7d07a40ad9cf2ce36c931984719b9df7de658999defbc87f999ec46970a0280$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||click.revue.email/ss/c/tvitjqfghbuvlofgnpyl4srww6jg5dxwxapzyi4j9qw4etwkmop2ubvj-vxhywhn4jtwhuiwzkwafagxfumcltdmf84brym26wppt-30k9tnopj-zex8avg30is87mhgvqojaekzbgqaj_z2sznx62c7cdys0xx4xwp-pmjeaprhhqzvyq0x7-pagh_urvhc/3fn/fi4w_sawqoybcvwbvqdl-a/h2/xcmxcsm-opubjqnhcse1dvzomo6q_eyu2go9qs8ysug$all
Filter updated: Sat, 06 Feb 2021 00:06:52 UTC
2021-02-06 00:06:53 +00:00
||clickent.co.jp/owa$all
Filter updated: Fri, 05 Feb 2021 12:06:59 UTC
2021-02-05 12:06:59 +00:00
||clickent.co.jp/owa/$all
Filter updated: Thu, 16 Sep 2021 00:01:52 +0000
2021-09-16 00:01:52 +00:00
||cliente.bradesco.validarcadastros.com$all
Filter updated: Tue, 22 Jun 2021 00:06:28 +0000
2021-06-22 00:06:29 +00:00
||clientebnreserva.ultimatefreehost.in$all
Filter updated: Wed, 22 Sep 2021 00:02:26 +0000
2021-09-22 00:02:26 +00:00
||clientes.bradesco.validarcadastros.com$all
Filter updated: Tue, 01 Jun 2021 00:06:26 UTC
2021-06-01 00:06:26 +00:00
||clientesyscaixa4.10001mb.com$all
Filter updated: Mon, 08 Mar 2021 12:06:34 UTC
2021-03-08 12:06:34 +00:00
||clients.devtux.com$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||clockblox.000webhostapp.com$all
Filter updated: Sun, 02 May 2021 00:06:30 UTC
2021-05-02 00:06:30 +00:00
||clone-7473c.web.app$all
Filter updated: Tue, 16 Mar 2021 00:07:08 UTC
2021-03-16 00:07:09 +00:00
||cloud102.hostgator.com$all
Filter updated: Wed, 03 Mar 2021 12:14:44 UTC
2021-03-03 12:14:44 +00:00
||clouddoc-authorize.firebaseapp.com$all
Filter updated: Thu, 19 Aug 2021 12:02:33 +0000
2021-08-19 12:02:33 +00:00
||cloudflare-ipfs.com/ipfs/qmdjapbwfsgua9vknmbswgfga4y5kj2vnnphvcsc8nc7ia/$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||cloudflare-rbnuo.run.goorm.io$all
Filter updated: Mon, 06 Sep 2021 12:01:50 +0000
2021-09-06 12:01:50 +00:00
||cloudonline1.eddy1702.de$all
Filter updated: Sat, 12 Jun 2021 12:06:23 UTC
2021-06-12 12:06:23 +00:00
||cloudshare-account-auth.firebaseapp.com$all
Filter updated: Wed, 12 May 2021 00:06:26 UTC
2021-05-12 00:06:26 +00:00
||cloudsraindrop.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||cloudzure.in$all
Filter updated: Fri, 30 Oct 2020 00:06:25 UTC
2020-10-30 00:06:25 +00:00
||clt1234529.bmetrack.com$all
Filter updated: Sat, 28 Aug 2021 00:33:51 +0000
2021-08-28 00:33:51 +00:00
||clt1371667.bmetrack.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||clubeamigosdopedrosegundo.com.br$all
Filter updated: Sat, 11 Sep 2021 00:34:15 +0000
2021-09-11 00:34:15 +00:00
||clxitatey.com$all
Filter updated: Wed, 14 Jul 2021 00:03:28 +0000
2021-07-14 00:03:28 +00:00
||cmciasi.ro$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||cmeklcosvdxqozvraxbecmmqcsyqzqrctcgvncqp.04fm.cn$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||cn07057.tmweb.ru$all
Filter updated: Wed, 22 Sep 2021 12:01:56 +0000
2021-09-22 12:01:56 +00:00
||cn29946.tmweb.ru$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||cnam.md/object/html_elements/laxx/en.php$all
||cnam.md/object/html_elements/laxx/en.php?rand=13inboxlightaspxn.1774256418&fid.4.1252899642&fid=1&fav.1&rand.13inboxlight.aspxn.1774256418&fid.1252899642&fid.1&fav.1&email=umf5lmlvenpvqhdlbgxzzmfyz29hzhzpc29ycy5jb20=&.rand=13inboxlight.aspx?n=1774256418&fid=4$all
Filter updated: Wed, 25 Nov 2020 00:06:21 UTC
2020-11-25 00:06:21 +00:00
||cnl.snprobbx.pbz.r.de.a2ip.ru$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||co-jp.rekanuikr.jp$all
||co-jp.rekanuikr.shop$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||co.ip.5et0qi.cn$all
Filter updated: Thu, 22 Apr 2021 00:06:42 UTC
2021-04-22 00:06:42 +00:00
||coanwilliams.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||coastwholesaleappliances-my.sharepoint.com/:o:/g/personal/mfiorini_coastappliances_com/ekgio42ixgvmrgruj7hsx1sbuji-eqg6t2m9bxmcb9latw?e=4smg$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||cocovip.net$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||coda-neww-ff.duckdns.org$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||coda.io/d/microsoft-office365_duu9pzwq-rk$all
Filter updated: Thu, 05 Nov 2020 00:06:22 UTC
2020-11-05 00:06:22 +00:00
||codashop-ph2020.ezua.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||codeblue.ch.net2care.com$all
Filter updated: Thu, 16 Sep 2021 12:02:15 +0000
2021-09-16 12:02:15 +00:00
||codepasta.app$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||coderslashadmin.com$all
Filter updated: Fri, 23 Jul 2021 12:01:47 +0000
2021-07-23 12:01:47 +00:00
||cognitoforms.com/governmentpandemicbonus/form3$all
Filter updated: Tue, 07 Sep 2021 00:01:46 +0000
2021-09-07 00:01:46 +00:00
||coin-best.club$all
Filter updated: Thu, 29 Jul 2021 00:01:57 +0000
2021-07-29 00:01:57 +00:00
||coincheck-137bc.web.app$all
Filter updated: Wed, 25 Aug 2021 12:02:06 +0000
2021-08-25 12:02:07 +00:00
||coinconnectwallet.com$all
Filter updated: Mon, 01 Feb 2021 12:08:15 UTC
2021-02-01 12:08:15 +00:00
||coinly.cz$all
Filter updated: Tue, 21 Sep 2021 00:01:40 +0000
2021-09-21 00:01:40 +00:00
||colegiomarques.com.br$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||collecttssmllbb.gq$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||collinsflg-my.sharepoint.com/:o:/g/personal/kristin_collinsfamilylaw_com/euf0wztyhj9kqzxuzlzixyabi4yll8ikkpy9hzw5mqnk3w?e=l7oitq$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||colorfastinv.com$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||columbiapolska.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||columbiaps-my.sharepoint.com/:x:/r/personal/agerzen_cpsk12_org/_layouts/15/wopiframe.aspx?guestaccesstoken=usnbe6ybjho9h25fk68jtyi54ok8%2b9ellr1aq%2fst9k8%3d&docid=1_1b3a9c7812c9d4683b1b5cc7fc8ae677d&wdformid=%7bf32b5748%2d8761%2d4d74%2db73e%2d295011a92875%7d&action=formsubmit&cid=84c7b00e-f$all
||columbiaps-my.sharepoint.com/:x:/r/personal/agerzen_cpsk12_org/_layouts/15/wopiframe.aspx?guestaccesstoken=usnbe6ybjho9h25fk68jtyi54ok8%2b9ellr1aq%2fst9k8%3d&docid=1_1b3a9c7812c9d4683b1b5cc7fc8ae677d&wdformid=%7bf32b5748%2d8761%2d4d74%2db73e%2d295011a92875%7d&action=formsubmit&cid=84c7b00e-fca9-46c9-b4f6-6c3148ca22a4$all
||columbiaps-my.sharepoint.com/personal/agerzen_cpsk12_org/_layouts/15/wopiframe.aspx?guestaccesstoken=usnbe6ybjho9h25fk68jtyi54ok8%2b9ellr1aq%2fst9k8%3d&docid=1_1b3a9c7812c9d4683b1b5cc7fc8ae677d&wdformid=%7bf32b5748%2d8761%2d4d74%2db73e%2d295011a92875%7d&action=formsubmit&cid=84c7b00e-f$all
||columbiaps-my.sharepoint.com/personal/agerzen_cpsk12_org/_layouts/15/wopiframe.aspx?guestaccesstoken=usnbe6ybjho9h25fk68jtyi54ok8%2b9ellr1aq%2fst9k8%3d&docid=1_1b3a9c7812c9d4683b1b5cc7fc8ae677d&wdformid=%7bf32b5748%2d8761%2d4d74%2db73e%2d295011a92875%7d&action=formsubmit&cid=84c7b00e-fca9-46c9-b4f6-6c3148ca22a4$all
Filter updated: Sat, 27 Mar 2021 12:06:27 UTC
2021-03-27 12:06:27 +00:00
||columbus.shortest-route.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||com-1b6x8r3ep.isiolo.go.ke$all
||com-nezb3mtd.isiolo.go.ke$all
||com-qif9fxw1.isiolo.go.ke$all
Filter updated: Sat, 26 Jun 2021 00:06:14 +0000
2021-06-26 00:06:14 +00:00
||com-vzla.ru$all
Filter updated: Fri, 15 Jan 2021 00:06:14 UTC
2021-01-15 00:06:14 +00:00
||comboniane.org$all
Filter updated: Tue, 02 Mar 2021 00:09:11 UTC
2021-03-02 00:09:11 +00:00
||comigocombr.creatorlink.net$all
Filter updated: Sat, 24 Jul 2021 00:33:22 +0000
2021-07-24 00:33:22 +00:00
||commandes.site$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||communicourt-my.sharepoint.com/personal/nicky_tolley_communicourt_co_uk/_layouts/15/wopiframe.aspx?guestaccesstoken=eamfa28gqrgeiwgts4k6r4jeaw5r3nlvgmrujrqweeg%3d&docid=1_102ac4f4a82ef483da9397726d75865ca&wdformid=%7b6fc04434%2d1bec%2d4c45%2dbfde%2d62f16b91c9eb%7d&action=formsubmit&cid=5964b08a-e45b-4bd6-a4e5-d13338c37e65$all
Filter updated: Sat, 12 Jun 2021 00:25:37 UTC
2021-06-12 00:25:37 +00:00
||community-diskussionsforen-probleme-klaren-de.totalh.net$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||community-ebay-forum-clubs-de.html-5.me$all
Filter updated: Sat, 03 Jul 2021 12:01:36 +0000
2021-07-03 12:01:37 +00:00
||community-ebay-t5-discussions-forum.html-5.me$all
Filter updated: Mon, 05 Jul 2021 00:01:57 +0000
2021-07-05 00:01:57 +00:00
||community-ebay-t6-discussions-forum.22web.org$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||community-ebay-t7-discussions-forum.html-5.me$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||community.shrm.org$all
Filter updated: Tue, 03 Aug 2021 12:01:54 +0000
2021-08-03 12:01:54 +00:00
||compliancetrk.com$all
Filter updated: Sun, 10 Jan 2021 12:06:39 UTC
2021-01-10 12:06:39 +00:00
||comprensivomarrosso.edu.it$all
Filter updated: Sat, 19 Jun 2021 00:06:27 +0000
2021-06-19 00:06:27 +00:00
||comunicationnationalschool.blogspot.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||comunicazioniarubait.tumblr.com$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||comunity-isue-ideent-andromeda-41.web.id$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||con-firma.firebaseapp.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||concreterexpressinc.com$all
Filter updated: Thu, 29 Jul 2021 00:01:57 +0000
2021-07-29 00:01:57 +00:00
||condocopia.org$all
Filter updated: Sat, 04 Sep 2021 00:17:00 +0000
2021-09-04 00:17:00 +00:00
||coneccionclientesbbv.net$all
Filter updated: Mon, 20 Sep 2021 00:01:41 +0000
2021-09-20 00:01:41 +00:00
||conference.pregnacarenigeria.com$all
Filter updated: Sun, 10 Jan 2021 12:06:39 UTC
2021-01-10 12:06:39 +00:00
||confirm-my-newpayments.com$all
Filter updated: Thu, 14 Jan 2021 12:06:32 UTC
2021-01-14 12:06:32 +00:00
||confirm-mynew-payments.com$all
Filter updated: Mon, 18 Jan 2021 12:06:33 UTC
2021-01-18 12:06:33 +00:00
||confirm-mynew-tranfers.com$all
Filter updated: Thu, 14 Jan 2021 00:06:20 UTC
2021-01-14 00:06:20 +00:00
||confirm-mynew-transactions.com$all
Filter updated: Thu, 07 Jan 2021 12:06:18 UTC
2021-01-07 12:06:18 +00:00
||confirm-newpayments.com$all
Filter updated: Wed, 26 May 2021 00:06:29 UTC
2021-05-26 00:06:29 +00:00
||confirm-page-identity.my.id$all
Filter updated: Mon, 28 Jun 2021 12:06:20 +0000
2021-06-28 12:06:20 +00:00
||confirm-pages-department-2021.biz.id$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||confirm-social-required-pages.biz.id$all
Filter updated: Mon, 18 Jan 2021 12:06:33 UTC
2021-01-18 12:06:33 +00:00
||confirm-your-new-payee.com$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||confirm.update.pypl.qs2.co$all
Filter updated: Sat, 31 Jul 2021 00:01:51 +0000
2021-07-31 00:01:51 +00:00
||confirmaci0n3007.ultimatefreehost.in$all
||confirmati0nwe0b.ultimatefreehost.in$all
Filter updated: Mon, 06 Sep 2021 12:01:50 +0000
2021-09-06 12:01:50 +00:00
||confirmationpages.blogspot.com/2021/03/facebooksecuritypages.html$all
Filter updated: Mon, 16 Aug 2021 00:01:59 +0000
2021-08-16 00:01:59 +00:00
||confirmationssan.hostfree.pw$all
Filter updated: Mon, 24 May 2021 00:06:37 UTC
2021-05-24 00:06:37 +00:00
||confirmatlon-pages-fb.blogspot.com/2021/04/facebook-security.html$all
Filter updated: Sat, 13 Mar 2021 00:09:54 UTC
2021-03-13 00:09:54 +00:00
||confirming-page-detect-recover.my.id$all
Filter updated: Thu, 14 Jan 2021 00:06:20 UTC
2021-01-14 00:06:20 +00:00
||confirmnew-payment.com/lloyds$all
Filter updated: Sun, 04 Apr 2021 12:06:34 UTC
2021-04-04 12:06:34 +00:00
||congresosba.com.ar$all
Filter updated: Thu, 16 Sep 2021 12:02:15 +0000
2021-09-16 12:02:15 +00:00
||connecting-to-smtp-msonline-servers-tld.fra1.digitaloceanspaces.com/index.html$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||connectvk.com/restore/84358929$all
Filter updated: Tue, 14 Sep 2021 00:01:48 +0000
2021-09-14 00:01:48 +00:00
||connexion-compte-client.freeweb.pk$all
Filter updated: Tue, 29 Jun 2021 00:01:48 +0000
2021-06-29 00:01:48 +00:00
||connexion-service.com$all
Filter updated: Mon, 20 Sep 2021 12:02:05 +0000
2021-09-20 12:02:05 +00:00
||constitutivelystertors.info$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||constructoravallereal.com$all
Filter updated: Fri, 15 Jan 2021 00:06:14 UTC
2021-01-15 00:06:14 +00:00
||consulting-gvg.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||consumer-capital-advocates.glitch.me$all
Filter updated: Thu, 08 Jul 2021 00:02:02 +0000
2021-07-08 00:02:02 +00:00
||contactmonkey.com/api/v1/tracker?cm_session=354917e2-ac99-45e1-96f9-8be4d200b522&cm_type=link&cm_link=e2ca05a6-2e96-43d5-b07a-cf1ef5e79b36&cm_destination=https://btbusinessbilling.wordpress.com/$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||contactmonkey.com/api/v1/tracker?cm_session=4e1943c3-7a68-47fb-93f5-16d2565a1cce&cm_type=link&cm_link=a4377bcd-c14a-4ace-8c62-a66fecd57e71&cm_destination=https://btbusinessbilling.wordpress.com/$all
||contactmonkey.com/api/v1/tracker?cm_session=d5721ad4-aabf-4e4e-9a14-1b8e7738fbcf&cm_type=link&cm_link=f89aca33-6081-418d-89e6-c9efd6aa36cd&cm_destination=https://www.designbold.com/design/view/80zebbkpa2/presentation$all
Filter updated: Thu, 01 Apr 2021 00:06:39 UTC
2021-04-01 00:06:40 +00:00
||contapessoal.digital$all
Filter updated: Tue, 26 Jan 2021 12:06:26 UTC
2021-01-26 12:06:26 +00:00
||contractordoc.com$all
Filter updated: Thu, 24 Jun 2021 00:06:35 +0000
2021-06-24 00:06:35 +00:00
||contratodeparceria.com.br$all
Filter updated: Tue, 08 Jun 2021 12:06:44 UTC
2021-06-08 12:06:44 +00:00
||conway.sa$all
Filter updated: Mon, 30 Aug 2021 00:02:03 +0000
2021-08-30 00:02:03 +00:00
||conxwallt.com/verifyaccount/$all
Filter updated: Sat, 28 Aug 2021 00:33:51 +0000
2021-08-28 00:33:51 +00:00
||conxwlts.com$all
Filter updated: Fri, 02 Jul 2021 00:01:50 +0000
2021-07-02 00:01:51 +00:00
||coolstool.net$all
Filter updated: Fri, 09 Jul 2021 00:01:59 +0000
2021-07-09 00:01:59 +00:00
||core.opentext.com/pdfjs/web/viewer.html?shortlink=7a416692eb6dd0cb03c4df977ceccd4a8f6ae0e61c2602c2$all
Filter updated: Mon, 19 Apr 2021 00:06:54 UTC
2021-04-19 00:06:54 +00:00
||core.opentext.com/pdfjs/web/viewer.html?shortlink=b9a0c647d82277e3d32057617df9ff5631b3ffef5ef6e44e$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||corinnakegel.com$all
Filter updated: Wed, 27 Jan 2021 12:06:59 UTC
2021-01-27 12:06:59 +00:00
||cornersmascout.com/smartlistings/docusign/index.html$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||correoupd11.000webhostapp.com$all
Filter updated: Tue, 27 Jul 2021 00:02:10 +0000
2021-07-27 00:02:10 +00:00
||corsipercorrispondenza.com$all
Filter updated: Tue, 22 Dec 2020 12:06:42 UTC
2020-12-22 12:06:42 +00:00
||cortijolatapia.com$all
||cortijolatapia.com/wp-includes/js/euro2.safelinks.protection.btinternet.com/voicemail/$all
Filter updated: Thu, 13 May 2021 12:06:27 UTC
2021-05-13 12:06:28 +00:00
||cosemu.com$all
Filter updated: Tue, 31 Aug 2021 00:01:55 +0000
2021-08-31 00:01:55 +00:00
||couchpop.com$all
Filter updated: Fri, 18 Sep 2020 00:06:21 UTC
2020-09-18 00:06:21 +00:00
||courseworkwritingsite.com$all
Filter updated: Thu, 16 Sep 2021 00:01:52 +0000
2021-09-16 00:01:52 +00:00
||courtcase.co.in$all
Filter updated: Mon, 06 Sep 2021 00:01:54 +0000
2021-09-06 00:01:54 +00:00
||coutruoms-davipluhome4.eb2a.com$all
Filter updated: Tue, 16 Feb 2021 12:06:31 UTC
2021-02-16 12:06:31 +00:00
||covaricambi.it$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||covid-19challengecoin.com$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||covid-foyyn.run-us-west2.goorm.io$all
Filter updated: Tue, 17 Aug 2021 00:02:45 +0000
2021-08-17 00:02:45 +00:00
||covreliefcare.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||coworkernepal.com$all
Filter updated: Sat, 31 Oct 2020 12:06:36 UTC
2020-10-31 12:06:36 +00:00
||cox0.yolasite.com$all
Filter updated: Fri, 02 Apr 2021 12:06:43 UTC
2021-04-02 12:06:43 +00:00
||cp45362.tmweb.ru$all
Filter updated: Fri, 24 Sep 2021 00:01:50 +0000
2021-09-24 00:01:51 +00:00
||cpanel.173-82-255-26.cprapid.com$all
Filter updated: Tue, 02 Feb 2021 00:22:14 UTC
2021-02-02 00:22:15 +00:00
||cpanel.telephone-sfr.com$all
Filter updated: Fri, 18 Dec 2020 00:06:14 UTC
2020-12-18 00:06:14 +00:00
||cpanel.thepsychedelics.net$all
Filter updated: Tue, 16 Mar 2021 12:06:41 UTC
2021-03-16 12:06:42 +00:00
||cpanel10wh.bkk1.cloud.z.com$all
Filter updated: Fri, 21 May 2021 12:06:31 UTC
2021-05-21 12:06:31 +00:00
||cpc-lda.co$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||cpc.cx$all
Filter updated: Fri, 24 Sep 2021 00:01:50 +0000
2021-09-24 00:01:51 +00:00
||cpcalendars.granadoemurahara.com.br$all
Filter updated: Wed, 15 Sep 2021 00:01:54 +0000
2021-09-15 00:01:55 +00:00
||cpcontacts.granadoemurahara.com.br$all
Filter updated: Wed, 03 Mar 2021 00:08:05 UTC
2021-03-03 00:08:05 +00:00
||cpu30691.mfs.gg$all
Filter updated: Sun, 13 Jun 2021 00:06:42 UTC
2021-06-13 00:06:42 +00:00
||cr-mufg.co$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||craignorthcutt.com/tsantangelo/analyticsountx/wp_mail/newali/babalogin.php$all
Filter updated: Fri, 24 Sep 2021 00:01:50 +0000
2021-09-24 00:01:51 +00:00
||craigslist.d3t7j05qc58fm2.amplifyapp.com$all
Filter updated: Fri, 26 Mar 2021 00:06:40 UTC
2021-03-26 00:06:40 +00:00
||cranetech.com.br$all
Filter updated: Wed, 11 Aug 2021 12:01:50 +0000
2021-08-11 12:01:50 +00:00
||crazyindiandeals.com$all
Filter updated: Fri, 30 Jul 2021 00:01:47 +0000
2021-07-30 00:01:47 +00:00
||crbd.net$all
Filter updated: Fri, 10 Sep 2021 12:02:02 +0000
2021-09-10 12:02:02 +00:00
||crcandcrcoh.com$all
Filter updated: Mon, 02 Aug 2021 00:02:18 +0000
2021-08-02 00:02:18 +00:00
||create-case.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||createchsoft.com/wp-includes/js/crop/cm$all
Filter updated: Thu, 03 Sep 2020 12:06:37 UTC
2020-09-03 12:06:37 +00:00
||createchsoft.com/wp-includes/js/crop/cm/$all
Filter updated: Wed, 30 Dec 2020 12:06:13 UTC
2020-12-30 12:06:13 +00:00
||creative-console.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||creativecombat.com/wp-admin/network/acct/login.php$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||creativecombat.com/wp-admin/network/acct/login.php?.rand=13inboxlight.aspx?n=1774256418$all
||creativecombat.com/wp-admin/network/acct/login.php?.rand=13inboxlight.aspx?n=1774256418&email=jackdavis@eureliosollutions.com&fid=1&fid=4&rand=13inboxlightaspxn.1774256418$all
||creativecombat.com/wp-admin/network/acct/login.php?rand=13inboxlightaspxn.1774256418$all
||creativecombat.com/wp-admin/network/acct/login.php?rand=13inboxlightaspxn.1774256418&$all
Filter updated: Thu, 03 Sep 2020 12:06:37 UTC
2020-09-03 12:06:37 +00:00
||creativecombat.com/wp-admin/network/acct/login.php?rand=13inboxlightaspxn.1774256418&amp$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||creativecombat.com/wp-admin/network/acct/login.php?rand=13inboxlightaspxn.1774256418&ampopensource:observable-35835700-0d08-4c25-a188-b8312ba00a941067515$all
||creativecombat.com/wp-admin/network/acct/login.php?rand=13inboxlightaspxn.1774256418&ampopensource:observable-35835700-0d08-4c25-a188-b8312ba00a941067515$all
||creativecombat.com/wp-admin/network/acct/login.php?rand=13inboxlightaspxn.1774256418&fid.4.1252899642&fid=1&fav.1&rand.13inboxlight.aspxn.1774256418&fid.1252899642&fid.1&fav.1&email=&.rand=13inboxlight.aspx?n=1774256418&fid=4$all
||creativecombat.com/wp-admin/network/acct/login.php?rand=13inboxlightaspxn.1774256418&fid.4.1252899642&fid=1&fav.1&rand.13inboxlight.aspxn.1774256418&fid.1252899642&fid.1&fav.1&email=jsmith@imaphost.com&.rand=13inboxlight.aspx?n=1774256418&fid=4$all
||creativecombat.com/wp-admin/network/acct/login.php?rand=13inboxlightaspxn.1774256418&fid.4.1252899642&fid=4&fav.1&rand.13inboxlight.aspxn.1774256418&fid.1252899642&fid.1&email=jsmith@imaphost.com&.rand=13inboxlight.aspx?n=1774256418$all
||creativecombat.com/wp-admin/network/acct/login.php?rand=13inboxlightaspxn.1774256418&fid.4.1252899642&fid=1&fav.1&rand.13inboxlight.aspxn.1774256418&fid.1252899642&fid.1&fav.1&email=jackdavis@eureliosollutions.com&.rand=13inboxlight.aspx?n=1774256418&fid=4$all
||creativecombat.com/wp-admin/network/acct?email=jackdavis@eureliosollutions.com$all
Filter updated: Sun, 15 Aug 2021 12:01:40 +0000
2021-08-15 12:01:40 +00:00
||creativeingredient.com/wp-includes/images/verify/update/y.html$all
Filter updated: Tue, 09 Feb 2021 12:06:34 UTC
2021-02-09 12:06:34 +00:00
||credicorpfiduciariasa.com$all
Filter updated: Thu, 18 Feb 2021 12:07:12 UTC
2021-02-18 12:07:12 +00:00
||credifinanciera.didacsis.com$all
Filter updated: Tue, 31 Aug 2021 00:01:55 +0000
2021-08-31 00:01:55 +00:00
||credit-agricole-secteurrecuripass.co14252.tmweb.ru$all
Filter updated: Sat, 18 Sep 2021 00:14:48 +0000
2021-09-18 00:14:48 +00:00
||credit-suisse.world$all
Filter updated: Tue, 06 Jul 2021 00:01:42 +0000
2021-07-06 00:01:42 +00:00
||creditagricole.zyrosite.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||creditiperhabbogratissicuro100.blogspot.com/2011/02/habbo-crediti-gratis-sicuro-100.html$all
||creditiperhabbogratissicuro100.blogspot.it$all
Filter updated: Thu, 10 Jun 2021 00:06:48 UTC
2021-06-10 00:06:48 +00:00
||creditopessoalitau.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||crewscontrolmd-my.sharepoint.com/:o:/g/personal/monica_crewscontrol_com/etsaeagbpbjbtwzh2tom1c4b-dgni3j2covr9b9jmky9na?e=7pz8vh$all
Filter updated: Thu, 09 Sep 2021 12:02:27 +0000
2021-09-09 12:02:27 +00:00
||crimson-koalas.com$all
Filter updated: Fri, 02 Jul 2021 12:01:53 +0000
2021-07-02 12:01:53 +00:00
||cristinamambrini.com.br$all
Filter updated: Fri, 08 Jan 2021 12:06:25 UTC
2021-01-08 12:06:26 +00:00
||crmdocentes.xochicalco.edu.mx$all
Filter updated: Fri, 18 Jun 2021 00:06:41 +0000
2021-06-18 00:06:41 +00:00
||crmlavoz.lavozdelinterior.net$all
Filter updated: Wed, 11 Aug 2021 00:01:55 +0000
2021-08-11 00:01:55 +00:00
||cronologiabacw.ultimatefreehost.in$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||crpmoney.com$all
Filter updated: Sun, 29 Aug 2021 00:01:50 +0000
2021-08-29 00:01:51 +00:00
||crroweb.emiweb.es$all
Filter updated: Sat, 11 Sep 2021 00:34:15 +0000
2021-09-11 00:34:15 +00:00
||crudesoldat.com$all
Filter updated: Mon, 06 Sep 2021 12:01:50 +0000
2021-09-06 12:01:50 +00:00
||crypto-rewardclaimzz.tk$all
Filter updated: Sat, 29 May 2021 12:06:18 UTC
2021-05-29 12:06:19 +00:00
||csemergencylock.typeform.com$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||csgoruny.com$all
Filter updated: Wed, 01 Sep 2021 00:02:20 +0000
2021-09-01 00:02:20 +00:00
||cslanet.ghalisdestock.ma$all
Filter updated: Mon, 01 Feb 2021 12:08:15 UTC
2021-02-01 12:08:15 +00:00
||csss.co.jp$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||ct08975.tmweb.ru$all
Filter updated: Tue, 20 Jul 2021 12:01:48 +0000
2021-07-20 12:01:48 +00:00
||ctcseligibility.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||cteam-my.sharepoint.com/:o:/g/personal/michael_hammes_cteam_de/emvsa57h96dfn3pdorq6h9qbfjioxaqwsf3sn9gvu8tkzq?e=nvhbcy$all
Filter updated: Thu, 23 Sep 2021 00:02:18 +0000
2021-09-23 00:02:18 +00:00
||cu41047.tmweb.ru$all
Filter updated: Wed, 02 Jun 2021 00:06:23 UTC
2021-06-02 00:06:23 +00:00
||cubachristianbrotherhood.org$all
Filter updated: Mon, 16 Aug 2021 00:01:59 +0000
2021-08-16 00:01:59 +00:00
||cuenta0bloqueada.ultimatefreehost.in$all
Filter updated: Thu, 09 Sep 2021 12:02:27 +0000
2021-09-09 12:02:27 +00:00
||cureakyara.com.br$all
Filter updated: Mon, 06 Sep 2021 12:01:50 +0000
2021-09-06 12:01:50 +00:00
||curiousawkward.xyz$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||current-att0000.weebly.com$all
Filter updated: Sun, 01 Aug 2021 00:01:58 +0000
2021-08-01 00:01:59 +00:00
||currentlycom.odoo.com$all
Filter updated: Sat, 06 Mar 2021 12:06:21 UTC
2021-03-06 12:06:21 +00:00
||currentlyfromattverificationupdate1.weebly.com$all
Filter updated: Fri, 27 Nov 2020 12:06:59 UTC
2020-11-27 12:06:59 +00:00
||cusstomerservicee.blogspot.com/?m=0$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||customer-ebay.com$all
Filter updated: Fri, 23 Apr 2021 00:06:35 UTC
2021-04-23 00:06:35 +00:00
||customer-verification-service.cloudns.asia$all
Filter updated: Fri, 18 Sep 2020 12:06:35 UTC
2020-09-18 12:06:35 +00:00
||customer.paypal.restored.cemaco.vn$all
Filter updated: Thu, 02 Sep 2021 12:02:02 +0000
2021-09-02 12:02:02 +00:00
||cut.li$all
Filter updated: Fri, 17 Sep 2021 00:01:45 +0000
2021-09-17 00:01:46 +00:00
||cutt.ly/1w4vrk5$all
Filter updated: Tue, 21 Sep 2021 12:02:11 +0000
2021-09-21 12:02:11 +00:00
||cutt.ly/4wx1k9r$all
Filter updated: Tue, 14 Sep 2021 00:01:48 +0000
2021-09-14 00:01:48 +00:00
||cutt.ly/5wbvx0o$all
Filter updated: Wed, 07 Apr 2021 00:06:43 UTC
2021-04-07 00:06:44 +00:00
||cutt.ly/8cmps8d$all
Filter updated: Sun, 19 Sep 2021 12:01:34 +0000
2021-09-19 12:01:35 +00:00
||cutt.ly/aus_de$all
Filter updated: Fri, 10 Sep 2021 00:02:17 +0000
2021-09-10 00:02:17 +00:00
||cutt.ly/awhatnu$all
Filter updated: Sun, 12 Sep 2021 00:02:13 +0000
2021-09-12 00:02:13 +00:00
||cutt.ly/bwbxfbh$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||cutt.ly/cwbxfq1$all
Filter updated: Mon, 13 Sep 2021 12:01:52 +0000
2021-09-13 12:01:52 +00:00
||cutt.ly/cwx1k2n$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||cutt.ly/dkvkq49$all
||cutt.ly/dkvkq49/$all
Filter updated: Sun, 28 Mar 2021 12:06:32 UTC
2021-03-28 12:06:32 +00:00
||cutt.ly/ee-online-customer-reset$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||cutt.ly/eebvhfw$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||cutt.ly/eklixfr$all
Filter updated: Thu, 23 Sep 2021 00:02:18 +0000
2021-09-23 00:02:18 +00:00
||cutt.ly/gwxm4af$all
Filter updated: Mon, 13 Sep 2021 00:02:04 +0000
2021-09-13 00:02:04 +00:00
||cutt.ly/jwvpsqz$all
Filter updated: Tue, 14 Sep 2021 00:01:48 +0000
2021-09-14 00:01:48 +00:00
||cutt.ly/jwx1lzn$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||cutt.ly/kkk8mtw$all
Filter updated: Tue, 14 Sep 2021 00:01:48 +0000
2021-09-14 00:01:48 +00:00
||cutt.ly/kw0aqc0$all
||cutt.ly/kwx1xnm$all
Filter updated: Tue, 14 Sep 2021 12:01:44 +0000
2021-09-14 12:01:44 +00:00
||cutt.ly/lwbp1b4$all
Filter updated: Thu, 23 Sep 2021 00:02:18 +0000
2021-09-23 00:02:18 +00:00
||cutt.ly/lwvpgpd$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||cutt.ly/pwbnyw1$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||cutt.ly/reactiva-viabcponline$all
Filter updated: Sun, 12 Sep 2021 12:01:35 +0000
2021-09-12 12:01:35 +00:00
||cutt.ly/rwzlorv$all
Filter updated: Thu, 25 Mar 2021 12:06:39 UTC
2021-03-25 12:06:39 +00:00
||cutt.ly/rxudyrb$all
Filter updated: Wed, 18 Aug 2021 00:01:50 +0000
2021-08-18 00:01:50 +00:00
||cutt.ly/tqvnbfg/$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||cutt.ly/uwcrssk$all
Filter updated: Tue, 20 Jul 2021 12:01:48 +0000
2021-07-20 12:01:48 +00:00
||cutt.ly/xmpc3nt$all
Filter updated: Mon, 22 Feb 2021 12:07:47 UTC
2021-02-22 12:07:48 +00:00
||cvkry.snprobbx.pbz.r.de.a2ip.ru$all
Filter updated: Wed, 22 Sep 2021 12:01:56 +0000
2021-09-22 12:01:56 +00:00
||cx97551.tmweb.ru$all
Filter updated: Thu, 26 Nov 2020 12:06:43 UTC
2020-11-26 12:06:43 +00:00
||cxmx2020atualizacao.com$all
Filter updated: Wed, 28 Jul 2021 12:01:46 +0000
2021-07-28 12:01:46 +00:00
||cxnhxiiogwamftdqvcwkryytxm-dot-goff039302032323.rj.r.appspot.com$all
Filter updated: Fri, 28 May 2021 00:06:28 UTC
2021-05-28 00:06:29 +00:00
||cy.tc/oglp$all
Filter updated: Sat, 31 Jul 2021 12:01:55 +0000
2021-07-31 12:01:55 +00:00
||cy7xlpjaxh8.typeform.com$all
Filter updated: Thu, 11 Mar 2021 00:09:12 UTC
2021-03-11 00:09:12 +00:00
||cybersolution.eu$all
Filter updated: Fri, 27 Aug 2021 00:01:47 +0000
2021-08-27 00:01:47 +00:00
||cycleonline.top$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||cyclicmongoose.glitch.me$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||cyrela-imoveis.blogspot.com$all
Filter updated: Thu, 10 Dec 2020 12:06:41 UTC
2020-12-10 12:06:42 +00:00
||cz0centrum.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||cz84.webeden.co.uk$all
Filter updated: Sun, 15 Aug 2021 00:01:57 +0000
2021-08-15 00:01:57 +00:00
||czechineseauction.com$all
Filter updated: Wed, 15 Sep 2021 00:01:54 +0000
2021-09-15 00:01:55 +00:00
||czpdora.com.mk$all
Filter updated: Thu, 15 Jul 2021 12:01:53 +0000
2021-07-15 12:01:53 +00:00
||czsantand3.byethost7.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||d.pr/f/j8j50t$all
||d.pr/jiiayu?updateverify=$all
Filter updated: Mon, 28 Dec 2020 12:06:19 UTC
2020-12-28 12:06:19 +00:00
||d18gc1ytkdv37u.cloudfront.net$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||d1yjjnpx0p53s8.cloudfront.net$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||d2aae6a6.srvr-cloudmail-srvr675eu6r.pages.dev$all
Filter updated: Sat, 07 Aug 2021 12:01:40 +0000
2021-08-07 12:01:40 +00:00
||d38ff0bf.ithemeshosting.com.php73-40.lan3-1.websitetestlink.com$all
Filter updated: Sat, 29 May 2021 12:06:18 UTC
2021-05-29 12:06:19 +00:00
||d3ncuwwrr82.typeform.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||d521e3ba-0de3-4eae-a9a8-bafefca61eda.htmlcomponentservice.com$all
||d5wxk.csb.app$all
Filter updated: Mon, 06 Sep 2021 00:01:54 +0000
2021-09-06 00:01:54 +00:00
||d6185c60.taonbuy.cn$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||da822325-313f-4f85-b334-d9b00a2d64da.htmlcomponentservice.com$all
Filter updated: Sun, 01 Aug 2021 00:01:58 +0000
2021-08-01 00:01:59 +00:00
||dadagency.in$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||dag-mot-lan.firebaseapp.com$all
||dailyexclusiveoffer.com$all
Filter updated: Wed, 14 Oct 2020 00:06:15 UTC
2020-10-14 00:06:15 +00:00
||dailynewsvermont.com/wp-admin/network/www.t-online.de.html$all
Filter updated: Thu, 29 Jul 2021 00:01:57 +0000
2021-07-29 00:01:57 +00:00
||dailysylheterdinkal.com$all
Filter updated: Fri, 27 Nov 2020 12:06:59 UTC
2020-11-27 12:06:59 +00:00
||dainellistudio.eu$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||dainmigration.com$all
Filter updated: Sun, 15 Aug 2021 00:01:57 +0000
2021-08-15 00:01:57 +00:00
||dalatngaynay.com$all
Filter updated: Mon, 13 Sep 2021 12:01:52 +0000
2021-09-13 12:01:52 +00:00
||danaburkart.com$all
Filter updated: Thu, 03 Sep 2020 12:06:37 UTC
2020-09-03 12:06:37 +00:00
||danangxaydung.com/remboursement/$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||danangxaydung.com/remboursement/04983522f756e8bf019193a0910bffab/?security=1qbx7holnntabiwdoj40icoja4v5pmzqblmirl3e8wokdjmc2q&email=$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||daniel-treufeld.de$all
Filter updated: Thu, 03 Sep 2020 12:06:37 UTC
2020-09-03 12:06:37 +00:00
||danielescivoli.it$all
Filter updated: Thu, 05 Aug 2021 00:02:05 +0000
2021-08-05 00:02:05 +00:00
||daniellygolden.com$all
Filter updated: Thu, 04 Mar 2021 12:07:52 UTC
2021-03-04 12:07:52 +00:00
||danielwritingportfolio.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||danitraseoexperts.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||danlaid.com.au$all
||danmuart.com/wp-admin/sharepoint/purchase-order/index.php?email=powerlotos@powerlotos.com$all
Filter updated: Mon, 05 Apr 2021 12:06:40 UTC
2021-04-05 12:06:40 +00:00
||darah.com.br$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||daressalaamtextilemills.com$all
Filter updated: Wed, 02 Jun 2021 12:06:27 UTC
2021-06-02 12:06:28 +00:00
||darmowe-tankowanie.click$all
Filter updated: Sun, 19 Sep 2021 12:01:34 +0000
2021-09-19 12:01:35 +00:00
||dashe.co$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||dataupdaterequired.site44.com$all
||datelsolutions.co.uk$all
Filter updated: Wed, 25 Aug 2021 12:02:06 +0000
2021-08-25 12:02:07 +00:00
||david-held.com$all
Filter updated: Tue, 13 Apr 2021 12:07:03 UTC
2021-04-13 12:07:03 +00:00
||daycoval.contrato.srv.br$all
Filter updated: Sat, 18 Sep 2021 00:14:48 +0000
2021-09-18 00:14:48 +00:00
||daymarkrecovery-electronic-doc.ga$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||dazul.com.ar$all
Filter updated: Sun, 07 Mar 2021 00:06:38 UTC
2021-03-07 00:06:38 +00:00
||dbs-votes-friend.com$all
Filter updated: Mon, 14 Jun 2021 00:06:24 UTC
2021-06-14 00:06:25 +00:00
||dbs.mc.eu1.kontiki.com$all
Filter updated: Wed, 28 Jul 2021 12:01:46 +0000
2021-07-28 12:01:46 +00:00
||dchmisfayfounhklgvutbagkgp-dot-gowa11111111.rj.r.appspot.com$all
Filter updated: Wed, 25 Aug 2021 12:02:06 +0000
2021-08-25 12:02:07 +00:00
||dcinterservices.cz$all
Filter updated: Thu, 29 Jul 2021 00:01:57 +0000
2021-07-29 00:01:57 +00:00
||dcrwkudhpygbmrxkgsuwgryhuu-dot-gowa11111111.rj.r.appspot.com$all
Filter updated: Tue, 14 Sep 2021 00:01:48 +0000
2021-09-14 00:01:48 +00:00
||dctsolution.net$all
Filter updated: Sat, 31 Jul 2021 00:01:51 +0000
2021-07-31 00:01:51 +00:00
||dd90001.github.io$all
Filter updated: Fri, 24 Sep 2021 00:01:50 +0000
2021-09-24 00:01:51 +00:00
||ddss23hytgcr.byethost7.com$all
Filter updated: Tue, 08 Sep 2020 12:06:48 UTC
2020-09-08 12:06:48 +00:00
||dealerzone.greatnortherncabinetry.com$all
Filter updated: Wed, 25 Aug 2021 00:01:57 +0000
2021-08-25 00:01:57 +00:00
||dealsmart247.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||deapplemoundo.blogspot.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||decaturilbgc.com$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||deciduous-groovy-map.glitch.me$all
Filter updated: Tue, 09 Feb 2021 12:06:34 UTC
2021-02-09 12:06:34 +00:00
||declicgestion.fr$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||declined-myaccount.com$all
||declined-myaccount.com/login.php$all
Filter updated: Thu, 01 Jul 2021 00:01:46 +0000
2021-07-01 00:01:46 +00:00
||dedicatedpasswor.byethost9.com$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||deeperlifezambia.org/cic/wellsfargo/wellsfargo/wellsfargo/wellsfargo/home.html$all
Filter updated: Wed, 22 Sep 2021 12:01:56 +0000
2021-09-22 12:01:56 +00:00
||deerectus.com$all
Filter updated: Tue, 20 Oct 2020 00:06:21 UTC
2020-10-20 00:06:21 +00:00
||deficitdeatencionperu.com$all
Filter updated: Mon, 26 Jul 2021 00:02:16 +0000
2021-07-26 00:02:17 +00:00
||dejpaad.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||dekasse-berliner.blogspot.com$all
Filter updated: Fri, 24 Sep 2021 00:01:50 +0000
2021-09-24 00:01:51 +00:00
||dekoyol.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||delaroke.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||delezhen.mashalezhen.com$all
Filter updated: Wed, 21 Jul 2021 00:01:57 +0000
2021-07-21 00:01:57 +00:00
||delgtr.hyperphp.com$all
Filter updated: Mon, 20 Sep 2021 12:02:05 +0000
2021-09-20 12:02:05 +00:00
||delhiescort69.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||delightontour.com$all
Filter updated: Mon, 16 Aug 2021 12:01:42 +0000
2021-08-16 12:01:42 +00:00
||delivery-support-menu.com$all
Filter updated: Wed, 22 Sep 2021 12:01:56 +0000
2021-09-22 12:01:56 +00:00
||delivery4kjdfkjdhfj85ysdg9f.ru$all
Filter updated: Tue, 27 Jul 2021 00:02:10 +0000
2021-07-27 00:02:10 +00:00
||delta.flightstatalert.com$all
Filter updated: Sat, 22 May 2021 00:06:19 UTC
2021-05-22 00:06:19 +00:00
||deltaflights.org$all
Filter updated: Sun, 06 Jun 2021 12:06:15 UTC
2021-06-06 12:06:16 +00:00
||demallplot-tra.web.app$all
Filter updated: Mon, 05 Apr 2021 12:06:40 UTC
2021-04-05 12:06:40 +00:00
||demiregalos.com.ar$all
Filter updated: Fri, 11 Jun 2021 00:06:40 UTC
2021-06-11 00:06:40 +00:00
||demo.bradescocontrol.vertitecnologia.com.br$all
Filter updated: Mon, 13 Sep 2021 12:01:52 +0000
2021-09-13 12:01:52 +00:00
||demo.prunescape.com.au$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||demo.samretpechfinance.com$all
Filter updated: Thu, 09 Sep 2021 00:01:56 +0000
2021-09-09 00:01:56 +00:00
||demo.ui-theme.ir$all
Filter updated: Sun, 05 Sep 2021 12:01:36 +0000
2021-09-05 12:01:37 +00:00
||den-brogede-verden.dk$all
Filter updated: Wed, 14 Oct 2020 00:06:15 UTC
2020-10-14 00:06:15 +00:00
||denartcc.org$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||dentallabor-morgenstern.de$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||denuihuongson.com.vn$all
Filter updated: Tue, 12 Jan 2021 00:06:08 UTC
2021-01-12 00:06:08 +00:00
||deny-application-access.com$all
Filter updated: Wed, 15 Sep 2021 00:01:54 +0000
2021-09-15 00:01:55 +00:00
||dependencia.maktubexperiencias.com$all
Filter updated: Wed, 22 Sep 2021 12:01:56 +0000
2021-09-22 12:01:56 +00:00
||derbycast.com$all
Filter updated: Sat, 20 Mar 2021 12:06:17 UTC
2021-03-20 12:06:17 +00:00
||deregister-lbpayee.com$all
Filter updated: Thu, 31 Dec 2020 12:06:18 UTC
2020-12-31 12:06:18 +00:00
||deregister-lloyd-unauthorisedaccess.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||deregister-unverified-seclloyd.com$all
Filter updated: Thu, 02 Sep 2021 00:01:59 +0000
2021-09-02 00:01:59 +00:00
||derfs.hyperphp.com$all
Filter updated: Fri, 24 Sep 2021 00:01:50 +0000
2021-09-24 00:01:51 +00:00
||derlambank.com$all
Filter updated: Wed, 22 Sep 2021 00:02:26 +0000
2021-09-22 00:02:26 +00:00
||des.camellaschool.edu.ph$all
Filter updated: Tue, 13 Apr 2021 00:06:31 UTC
2021-04-13 00:06:31 +00:00
||design101.com.br$all
Filter updated: Mon, 24 May 2021 12:06:37 UTC
2021-05-24 12:06:37 +00:00
||designandcraftsmanship.com$all
Filter updated: Tue, 17 Aug 2021 00:02:45 +0000
2021-08-17 00:02:45 +00:00
||designbold.com/design/view/7wzzlpy6md/scrolling$all
||designbold.com/design/view/80zebbkpa2/presentation$all
Filter updated: Mon, 16 Aug 2021 12:01:42 +0000
2021-08-16 12:01:42 +00:00
||designbold.com/design/view/onmxgjmvam/scrolling$all
Filter updated: Tue, 29 Jun 2021 00:01:48 +0000
2021-06-29 00:01:48 +00:00
||designbold.com/design/view/ppzpgr8q91/presentation$all
Filter updated: Thu, 01 Apr 2021 12:06:44 UTC
2021-04-01 12:06:45 +00:00
||designerlakehouse.com$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||designvision.com.bd$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||despertardoshormonios.club$all
Filter updated: Wed, 13 Jan 2021 12:06:45 UTC
2021-01-13 12:06:45 +00:00
||detect-new-payee.com$all
Filter updated: Wed, 15 Sep 2021 12:01:46 +0000
2021-09-15 12:01:46 +00:00
||deutsche-waerme.de$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||dev-kijnaaho.pantheonsite.io$all
||dev-kijnaako.pantheonsite.io$all
Filter updated: Tue, 10 Aug 2021 12:02:08 +0000
2021-08-10 12:02:08 +00:00
||dev-nadaj.orlenpaczka.ce5.pl$all
Filter updated: Mon, 06 Sep 2021 00:01:54 +0000
2021-09-06 00:01:54 +00:00
||dev-secu-credit-union.pantheonsite.io$all
Filter updated: Tue, 10 Aug 2021 12:02:08 +0000
2021-08-10 12:02:08 +00:00
||dev-www.orlenpaczka.ce5.pl$all
Filter updated: Mon, 13 Sep 2021 12:01:52 +0000
2021-09-13 12:01:52 +00:00
||dev.prunescape.com.au$all
Filter updated: Fri, 24 Sep 2021 00:01:50 +0000
2021-09-24 00:01:51 +00:00
||dev2087.d1v86sffnlajzm.amplifyapp.com$all
||dev3987.d24e5ec703s80e.amplifyapp.com$all
Filter updated: Fri, 27 Aug 2021 00:01:47 +0000
2021-08-27 00:01:47 +00:00
||developmandate.top$all
||deviceviolin.top$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||devote.servehttp.com$all
Filter updated: Thu, 29 Jul 2021 00:01:57 +0000
2021-07-29 00:01:57 +00:00
||devrising.in$all
Filter updated: Mon, 26 Apr 2021 12:07:30 UTC
2021-04-26 12:07:30 +00:00
||dexlerholdings.com$all
Filter updated: Sun, 19 Sep 2021 00:02:16 +0000
2021-09-19 00:02:17 +00:00
||dexterscommunication.in$all
Filter updated: Fri, 26 Feb 2021 12:08:06 UTC
2021-02-26 12:08:06 +00:00
||dg54asdg15g1.agilecrm.com$all
Filter updated: Sat, 22 May 2021 00:06:19 UTC
2021-05-22 00:06:19 +00:00
||dgfchdjwcf.zyrosite.com$all
Filter updated: Tue, 11 May 2021 00:06:39 UTC
2021-05-11 00:06:40 +00:00
||dgsols.com$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||dhhblwdh.cf$all
Filter updated: Sun, 11 Jul 2021 12:01:37 +0000
2021-07-11 12:01:38 +00:00
||dhl-ru.com$all
Filter updated: Sat, 28 Aug 2021 00:33:51 +0000
2021-08-28 00:33:51 +00:00
||dhl-tracking-id.com.u1459991.cp.regruhosting.ru$all
Filter updated: Wed, 20 Jan 2021 00:06:08 UTC
2021-01-20 00:06:08 +00:00
||dhl.recruitmentplatform.com$all
Filter updated: Mon, 31 May 2021 12:06:30 UTC
2021-05-31 12:06:30 +00:00
||dhlgpi.com$all
Filter updated: Tue, 15 Jun 2021 12:29:08 UTC
2021-06-15 12:29:08 +00:00
||diamond-group.ru$all
Filter updated: Tue, 22 Jun 2021 00:06:28 +0000
2021-06-22 00:06:29 +00:00
||dichvuvinaphone.vn/wp-includes/pomo/office365/office/voicemail/index2.php$all
Filter updated: Thu, 27 May 2021 00:06:23 UTC
2021-05-27 00:06:23 +00:00
||dichvuvinaphone.vn/wp-includes/pomo/office365/office/voicemail/index2.php?h=ed29nkjpsa16bhrjq4na16owq-1mucgfycc664m7vmhpjgqse65-1l5rurej3h44qodo5rn0cdvyn-8om6v2ckrxsbnwf40t9ta8a7e-34tiets5jpj294jd59h8c4s0n-28w7d5j2k2jtil9ncckolke4m-9jzlwicvu376y9q4vjq77y5ks-1m0whdrwis44c1hoa9mrwhlt4-1uvutm1mpyov7rqhtcf8fksby-aac54ic1fmca5xz1yvc5t9nfe-1hn40w0bomeivihj9lopp4hp2-c0121povror81d0xao0yez4gy$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||dichvuvnpt.com/home/components/com_user/bbtonline.html$all
Filter updated: Tue, 16 Mar 2021 12:06:41 UTC
2021-03-16 12:06:42 +00:00
||die-post-swiss-id-19782635812.psd2any.com$all
Filter updated: Mon, 20 Sep 2021 12:02:05 +0000
2021-09-20 12:02:05 +00:00
||diepost.ship-s.org$all
Filter updated: Wed, 22 Sep 2021 12:01:56 +0000
2021-09-22 12:01:56 +00:00
||diepost.ship-w.org$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||digibizads.com$all
Filter updated: Tue, 15 Jun 2021 12:29:08 UTC
2021-06-15 12:29:08 +00:00
||digisails.org$all
Filter updated: Fri, 24 Sep 2021 12:02:36 +0000
2021-09-24 12:02:36 +00:00
||digitalkarachi.pk$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||digitaltaxmatters.co.uk$all
Filter updated: Wed, 02 Jun 2021 12:06:27 UTC
2021-06-02 12:06:28 +00:00
||digitalwarriors.pk$all
Filter updated: Thu, 01 Jul 2021 00:01:46 +0000
2021-07-01 00:01:46 +00:00
||dik.si$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||dimgizbmxzk3zqucgsq23gin3jooej65i5tikvfumzksjcead2.g814.cn$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||dimolo.activehosted.com$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||dip-audit.ru$all
Filter updated: Fri, 24 Sep 2021 00:01:50 +0000
2021-09-24 00:01:51 +00:00
||directi-smbc.com$all
Filter updated: Fri, 24 Sep 2021 12:02:36 +0000
2021-09-24 12:02:36 +00:00
||directj-smbc.com$all
Filter updated: Mon, 13 Sep 2021 12:01:52 +0000
2021-09-13 12:01:52 +00:00
||directlighting.es$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||directlngl.temp.swtest.ru$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||directo-smbc.com$all
Filter updated: Thu, 15 Apr 2021 00:06:48 UTC
2021-04-15 00:06:48 +00:00
||directsites.site44.com$all
Filter updated: Wed, 18 Aug 2021 00:01:50 +0000
2021-08-18 00:01:50 +00:00
||dirtbgoneperth.com$all
Filter updated: Tue, 21 Sep 2021 00:01:40 +0000
2021-09-21 00:01:40 +00:00
||discocrd-nitro.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||discocrd.gift$all
||discord-app.me$all
Filter updated: Wed, 15 Sep 2021 00:01:54 +0000
2021-09-15 00:01:55 +00:00
||discord-app.net$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||discord-event.info$all
||discord-give.org$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||discord-halloween.com$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||discord.givaewey.com$all
Filter updated: Wed, 08 Sep 2021 00:02:08 +0000
2021-09-08 00:02:08 +00:00
||discordgifts.ru.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||discordnitro.ru.com$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||discordsub.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||diskussionsforen-ebay-de.test105227.test-account.com$all
Filter updated: Mon, 06 Sep 2021 00:01:54 +0000
2021-09-06 00:01:54 +00:00
||disney.plus-de.net$all
Filter updated: Mon, 26 Apr 2021 00:08:39 UTC
2021-04-26 00:08:39 +00:00
||disneyplusfreetrial.co.uk$all
Filter updated: Fri, 21 May 2021 00:06:36 UTC
2021-05-21 00:06:36 +00:00
||displayplanet.pl$all
Filter updated: Thu, 08 Jul 2021 00:02:02 +0000
2021-07-08 00:02:02 +00:00
||disq.us/?url=http%3a%2f%2fedd.huntershub.online%2fedd%2520prepaid%2fprepaid%2f&key=tqpetxlm09wtvlwulwkm1g$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||disq.us/?url=http%3a%2f%2fv32vi.org%2fobj%2fx86%2fdebug%2fdebug.html&key=p5-unr13ef1nvpweoa4g6q$all
||disq.us/?url=http%3a%2f%2fwww.rmiembassyus.org%2fmedia%2fjui%2fjs%2f&key=i5eldkzvfyplzuuvh2xytg$all
Filter updated: Wed, 25 Aug 2021 12:02:06 +0000
2021-08-25 12:02:07 +00:00
||disq.us/?url=https%3a%2f%2fbom.to%2fne7tticangmii3&key=0beekpsfvusz9qc-9u-zwq$all
Filter updated: Wed, 15 Sep 2021 00:01:54 +0000
2021-09-15 00:01:55 +00:00
||disq.us/?url=https%3a%2f%2fbom.to%2fvpz1ac&key=yc94ig4npafy0sthcgmlig$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||disq.us/?url=https%3a%2f%2fcompte-suspendu483.tk%2fcaptcha%2f&key=uouejqmfvkrmu_mnfmlqeg$all
||disq.us/?url=https%3a%2f%2fwww.adelaidetowingandcarremoval.com.au%2fwp-content%2f%2fuploads%2f2020%2fsocialsecurity%2f&key=yxyb8swn1zzjw8bcatgrjw######$all
||disq.us/?url=https%3a%2f%2fwww.gepard.ru%2flogin%2faccount%2f&key=jgdq7zs0ratd6src39cdig$all
Filter updated: Fri, 16 Jul 2021 00:01:53 +0000
2021-07-16 00:01:53 +00:00
||distechforum.com/chase/web$all
||distechforum.com/chase/web/$all
Filter updated: Sun, 15 Aug 2021 00:01:57 +0000
2021-08-15 00:01:57 +00:00
||distinctfreight.co.zw/fgjj/pdffile$all
Filter updated: Wed, 17 Mar 2021 12:07:39 UTC
2021-03-17 12:07:39 +00:00
||distrial.ec$all
Filter updated: Wed, 06 Jan 2021 00:06:10 UTC
2021-01-06 00:06:10 +00:00
||dixdomains.com$all
Filter updated: Fri, 24 Sep 2021 00:01:50 +0000
2021-09-24 00:01:51 +00:00
||djdhe747474.weebly.com$all
Filter updated: Sun, 19 Sep 2021 00:02:16 +0000
2021-09-19 00:02:17 +00:00
||djeliza.be$all
Filter updated: Wed, 13 Jan 2021 12:06:45 UTC
2021-01-13 12:06:45 +00:00
||dkb-info.com$all
Filter updated: Thu, 03 Sep 2020 12:06:37 UTC
2020-09-03 12:06:37 +00:00
||dkb1231ag.site44.com$all
Filter updated: Tue, 21 Sep 2021 00:01:40 +0000
2021-09-21 00:01:40 +00:00
||dkbsicherheit.com/349/9044fbbc78660f4086d1b71f73dc80c7/de/identification/?cgi=031320190&token=186d7d1fb84c5293089938f3b30a472d$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||dkbsicherheitsdienst.com.de/122/892c13568d99e1a0e762de73d704cc0a/de/identification/?cgi=031320190&token=7c0aefcbd5ad92411249c7c0477da123$all
||dkbsicherheitsdienst.com.de/123/074fa92c9fe031757d085f7f33face35/de/identification/?cgi=031320190&token=985bdb6166a1ed25f8c5a26e16cd8544$all
||dkbsicherheitsdienst.com.de/13/3096be9e9da35e8ad035cc060e461c21/de/identification/?cgi=031320190&token=4b71a083bfd0ec6c92d24e000019eceb$all
||dkbsicherheitsdienst.com.de/182/38fed72f4f1a7c663dd3a252f3146c32/de/identification/?cgi=031320190&token=20c63bb4a35d8a34b3c00ddecd40a4c5$all
||dkbsicherheitsdienst.com.de/183/d87f26ff44481c0492283b9e23b336cc/de/identification/?cgi=031320190&token=1f96eb6b2c869f9148f13494aeb36640$all
||dkbsicherheitsdienst.com.de/216/f0b33a777825dc338f8ed1686a986e2d/de/identification/?cgi=031320190&token=5bd999a852cc1133b23c9120174f6a0c$all
||dkbsicherheitsdienst.com.de/234/40f887fbce9698fbec957ea4148f2582/de/identification/?cgi=031320190&token=8d0c3c871a778c759de0b07882004964$all
||dkbsicherheitsdienst.com.de/238/2531f1e8a1c1b6314a57ba0cfc197760/de/identification/?cgi=031320190&token=073ad589654f3b3537c56145d6f6516f$all
||dkbsicherheitsdienst.com.de/245/2d90223d62e83f176f9e56392c3e0e18/de/identification/?cgi=031320190&token=c6998e4ec88a0bebadaa02081e8e30d9$all
||dkbsicherheitsdienst.com.de/248/433f6bc59ccdbc464f0263f468d3faa4/de/identification/?cgi=031320190&token=895bb9908c85f40f598b69e04c059f2a$all
||dkbsicherheitsdienst.com.de/272/2b7ba624178b323372c328e811285334/de/identification/?cgi=031320190&token=3d6faf08c46e6faf981febc7566ebecc$all
||dkbsicherheitsdienst.com.de/291/0c49019543bef5f1c860631480bb51fb/de/identification/?cgi=031320190&token=501533adb0216f490c2e676b047f3898$all
||dkbsicherheitsdienst.com.de/298/4c3d396d02e25ebac945983071643bc9/de/identification/?cgi=031320190&token=c7e48f603c5f3c3eb9ae086300c43ed5$all
||dkbsicherheitsdienst.com.de/349/8374e6e9b7abc90554ed51b6cea24788/de/identification/?cgi=031320190&token=08ceffc5b1dcbe39512dcb0dcb7385c8$all
||dkbsicherheitsdienst.com.de/399/65da581e01bf2476c4897ebf470a6fd4/de/identification/?cgi=031320190&token=59765732cbda98b53acadd1b6d2a7452$all
||dkbsicherheitsdienst.com.de/404/225c52a70f7b1a4dbebe3f77d4236f74/de/identification/?cgi=031320190&token=fb64bdfdb622a06fe87e38d7a64e34c7$all
||dkbsicherheitsdienst.com.de/428/50333432fc8b3b032b8d53df3820e8e0/de/identification/?cgi=031320190&token=1ff9a873510f175aa2a5777750837fe4$all
||dkbsicherheitsdienst.com.de/437/993d6e5b608e1d53c1a511a9b62a245d/de/identification/?cgi=031320190&token=2f45c5a87b54e8f2f380437bc683d2a0$all
||dkbsicherheitsdienst.com.de/465/8f36b5666c7169fd453e391bf78ab754/de/identification/?cgi=031320190&token=b8b213126c29ac90f05478ef60b9f089$all
||dkbsicherheitsdienst.com.de/491/d6572f16094588861f5f708f914c2d4c/de/identification/?cgi=031320190&token=bb60a3aae275dc166c612d547d6cb205$all
||dkbsicherheitsdienst.com.de/53/cbe8339f38fd535b58a7cfcde1d7c552/de/identification/?cgi=031320190&token=f3bcf1225acbff6e3a16f3c51682776e$all
||dkbsicherheitsdienst.com.de/542/e192a1a6f0a7d37d39b4bac0735a3baa/de/identification/?cgi=031320190&token=31852d9a28bab26871f058387dee0bb7$all
||dkbsicherheitsdienst.com.de/579/49bd6a799d75a702041b7a6ec1a6a17f/de/identification/?cgi=031320190&token=95f299c514dd8866f83aa04008ccf667$all
||dkbsicherheitsdienst.com.de/637/2461d5653737fcb1571a2f8d45638cbd/de/identification/?cgi=031320190&token=0eb6eaa8242adc27d94da8cc4a1db449$all
||dkbsicherheitsdienst.com.de/638/eb36478ba395cc9e95899383e293a96f/de/identification/?cgi=031320190&token=bbd45155ea1d7df7c833e31866e2bebd$all
||dkbsicherheitsdienst.com.de/666/be45be981826f55c235fb2ec4a0cffc4/de/identification/?cgi=031320190&token=adfc1317e8429db13a3f381215b7579e$all
||dkbsicherheitsdienst.com.de/705/2aaa771b25f2bd57fb7647dbe83eca58/de/identification/?cgi=031320190&token=3459f450e2a6057b9edc4224df96ea97$all
||dkbsicherheitsdienst.com.de/715/679c58d86b884fe5d9b9304eac62e726/de/identification/?cgi=031320190&token=9522dda85554d4c8961e25e3140b65a2$all
||dkbsicherheitsdienst.com.de/720/238c2f9bc586cf6583e1419104f17f24/de/identification/?cgi=031320190&token=b3f72ef50a54949a2c2e3c817caced46$all
||dkbsicherheitsdienst.com.de/735/9eb4c7f7e3274c79aeab0f86aa97529a/de/identification/?cgi=031320190&token=104ae1bb62e30fda8298321a5d649abe$all
||dkbsicherheitsdienst.com.de/737/06b8b26101c2ae3e1b802dd385f4ca45/de/identification/?cgi=031320190&token=cabf50188c436dcc08122f5eff59722b$all
||dkbsicherheitsdienst.com.de/749/20bcd02ed4c53f38e1a0d60667716145/de/identification/?cgi=031320190&token=345c948c6791dd217beeb4c4ddc067f5$all
||dkbsicherheitsdienst.com.de/77/91cdea7d632f828beb855b7bcf56fbc1/de/identification/?cgi=031320190&token=e99269f1b45659f14d4db470ad684f9a$all
||dkbsicherheitsdienst.com.de/799/9f20c6ba5afab5cebf9c9c2c3c81f627/de/identification/?cgi=031320190&token=a4f51a88105b42ffb45789004cd8a8f0$all
||dkbsicherheitsdienst.com.de/829/94d8dd92e0a233652c56df140f52614c/de/identification/?cgi=031320190&token=b0a6da2c2cc12533408fecc412b3d2d1$all
||dkbsicherheitsdienst.com.de/850/100fa8559eda7e435e4c7a44f5ddad7a/de/identification/?cgi=031320190&token=82781edbb7cfd4c457a0dfeaeae97641$all
||dkbsicherheitsdienst.com.de/912/f910caf43e395bba8a838a57780fe175/de/identification/?cgi=031320190&token=a779912593c131d9b34ec02022f0ed75$all
||dkbsicherheitsdienst.com.de/940/3c06bdd9fde4758a59f69976ae647539/de/identification/?cgi=031320190&token=31d863ceb5b92f5e49890c6dcd3d3eba$all
||dkbsicherheitsdienst.com.de/989/495a199f2f39ee3a6b5b8088614a6211/de/identification/?cgi=031320190&token=e1d00283cc1017f0e8cff88bde4d34f7$all
Filter updated: Thu, 29 Jul 2021 00:01:57 +0000
2021-07-29 00:01:57 +00:00
||dkdwmfteuylsitbrsfojilzhad-dot-gowa11111111.rj.r.appspot.com$all
Filter updated: Thu, 09 Sep 2021 00:01:56 +0000
2021-09-09 00:01:56 +00:00
||dkglobaljobs.com$all
Filter updated: Sat, 17 Apr 2021 00:06:31 UTC
2021-04-17 00:06:31 +00:00
||dlink.me$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||dlvr.it/s8djwd$all
Filter updated: Wed, 18 Aug 2021 00:01:50 +0000
2021-08-18 00:01:50 +00:00
||dlxdgl.com$all
Filter updated: Mon, 02 Aug 2021 12:01:44 +0000
2021-08-02 12:01:44 +00:00
||dn1s29yg3m3.typeform.com$all
Filter updated: Mon, 09 Aug 2021 00:02:27 +0000
2021-08-09 00:02:27 +00:00
||doa.go.th/leka/wp-content/nychhc$all
Filter updated: Sun, 15 Aug 2021 00:01:57 +0000
2021-08-15 00:01:57 +00:00
||doa.go.th/leka/wp-content/nychhc/$all
Filter updated: Thu, 16 Sep 2021 12:02:15 +0000
2021-09-16 12:02:15 +00:00
||doc-auth-prohealthpartners.ml$all
||doc-auth-prohealthpartners.tk$all
Filter updated: Wed, 14 Jul 2021 12:02:08 +0000
2021-07-14 12:02:08 +00:00
||doc-naphcare.org$all
||doc-pasadenaisdshop.com$all
Filter updated: Thu, 09 Sep 2021 12:02:27 +0000
2021-09-09 12:02:27 +00:00
||doc38347343.knorish.com$all
Filter updated: Thu, 16 Sep 2021 12:02:15 +0000
2021-09-16 12:02:15 +00:00
||docholdersignature001001-ezm47.ondigitalocean.app$all
Filter updated: Thu, 12 Nov 2020 12:06:49 UTC
2020-11-12 12:06:49 +00:00
||doclab-console-auth.firebaseapp.com$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||docs-verify-c671.thajetiase.workers.dev$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||docs.google.com/document/d/e/2pacx-1vqg5zz0tcdbhy7wfp_7qji6toegexolsgvf_176vf5srqdch5yoc7vqg92mmiz7yvesvbgmzvlagowo/pub$all
||docs.google.com/document/d/e/2pacx-1vrsdmi8kqzhphmq1wq1it08vreztms3u-vsojet5ppl9zuo4ismcqxn4fwtissr-h0txmmzaohvs7ty/pub$all
||docs.google.com/document/d/e/2pacx-1vrww694tkdqcdswba6r6qvkl2j8ggccuxtq-1x4ocowjttilaenattbakijulc7qev-4hqllutzogev/pub$all
Filter updated: Tue, 13 Apr 2021 00:06:31 UTC
2021-04-13 00:06:31 +00:00
||docs.google.com/document/d/e/2pacx-1vrxv6bkbixggv2c_lzouzl6z9ovzqqswl5otameibkkds0jrgilyjy4cpv1lflvobrdumunkipgx6du/pub?embedded=true$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||docs.google.com/document/d/e/2pacx-1vs36y8r0dzpmbkk0kzlhwl7qp56-1x6jrq34lzp4a2cukpsl9y0gfpcpmx8sjlwiw2db5lysyzisg8o/pub$all
Filter updated: Tue, 13 Apr 2021 00:06:31 UTC
2021-04-13 00:06:31 +00:00
||docs.google.com/document/d/e/2pacx-1vszcwxk6nifthkg32wjxfjgq9yc-jjujkbsumqeeau8uw7xkcutyp0tbgux2mvwu8iqfrxxlunajob8/pub$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||docs.google.com/document/d/e/2pacx-1vt_xl-m0ff8yqqhzhgseahgwejo0znh9re6w0qvgbe0qfe084hrebjjg673htphdnvbcdnq6agehncq/pub?mobilelogin$all
Filter updated: Wed, 25 Aug 2021 12:02:06 +0000
2021-08-25 12:02:07 +00:00
||docs.google.com/document/d/e/2pacx-1vth3iya0ov7p49rk9ejozgqnueuk8fna2mky389hertlwx4mnoyhl1mlhnwbz8sxnsqtk8i5uysmq68/pub?embedded=true$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||docs.google.com/document/d/e/2pacx-1vtj_-ldjfuxvxsbw2yivttmklhhwb0xalrxb_sxzub7mvm23nxxvor35_ppdltnvlm7bo8pc5oao0jn/pub$all
||docs.google.com/document/d/e/2pacx-1vts9czxqycsgi-quifs7m1mqjzmlcjlccnhw3dsahdss5ymnpy6y0vsgwvf3piu6js22ydjyew1oyo_/pub?embedded=true$all
||docs.google.com/document/u/6/d/e/2pacx-1vs1dvkfrujajsa7oo5lrr8jtgkptt5bkchxfesyemxh3tajbdgtb25uikmsqpb0kahma4jpgkbvhuw7/pub?embedded=true$all
||docs.google.com/forms/d/12467akksjbdxtns1aefg-fo9hlxamtxynf5brvbz5tc/viewform?edit_requested=true$all
||docs.google.com/forms/d/17rbx8y2bk8n4tzm0fbld5vi4ldsc0skyuqq0ocijhsu/viewform?edit_requested=true$all
Filter updated: Tue, 10 Aug 2021 12:02:08 +0000
2021-08-10 12:02:08 +00:00
||docs.google.com/forms/d/1fpyjsolbptidxpf23lqom1jghfw7qrvbbbfxxi82pzg/viewform?edit_requested=true$all
Filter updated: Mon, 13 Sep 2021 00:02:04 +0000
2021-09-13 00:02:04 +00:00
||docs.google.com/forms/d/e/1faipqlsc-xysogohjsbzmcnoded8ooar2gz1c5zxobgk8envh3jbpow/viewform$all
Filter updated: Wed, 18 Aug 2021 00:01:50 +0000
2021-08-18 00:01:50 +00:00
||docs.google.com/forms/d/e/1faipqlsc_enqwhhv1jnvzy55mb4ghvjd4wcz9plnolh2eoitk7qgbra/viewform?usp=send_form$all
Filter updated: Tue, 20 Jul 2021 12:01:48 +0000
2021-07-20 12:01:48 +00:00
||docs.google.com/forms/d/e/1faipqlsc_f0pxmnwzrtbck6u06fdzocmhgzvjzlc8cu7c9b456fhccq/viewform$all
Filter updated: Tue, 27 Jul 2021 00:02:10 +0000
2021-07-27 00:02:10 +00:00
||docs.google.com/forms/d/e/1faipqlsca1yg551kdvimwhccriwj2kttyqqfalnuaaxacbsdmdwgmwa/viewform$all
Filter updated: Wed, 18 Aug 2021 00:01:50 +0000
2021-08-18 00:01:50 +00:00
||docs.google.com/forms/d/e/1faipqlscaoiohhbm7suyz9ol9o9ueunbxn6donxrfjge2cevdw_8jmw/viewform?usp=send_form$all
Filter updated: Wed, 25 Aug 2021 12:02:06 +0000
2021-08-25 12:02:07 +00:00
||docs.google.com/forms/d/e/1faipqlscclmqirehqtkm3vl4u9gm2zv6xfvrddbrgke9fmsfujqbboq/viewform$all
Filter updated: Tue, 20 Jul 2021 12:01:48 +0000
2021-07-20 12:01:48 +00:00
||docs.google.com/forms/d/e/1faipqlscd8t8sjgxqrsa6dq5kjpmrpsxkvi4bl38sfdu7wa3sl32elg/viewform$all
Filter updated: Mon, 06 Sep 2021 00:01:54 +0000
2021-09-06 00:01:54 +00:00
||docs.google.com/forms/d/e/1faipqlscda1to5ru4sjeeujg3ki2bimklprvsec6u43kpvhbfyhrldw/viewform$all
Filter updated: Thu, 02 Sep 2021 00:01:59 +0000
2021-09-02 00:01:59 +00:00
||docs.google.com/forms/d/e/1faipqlscda1to5ru4sjeeujg3ki2bimklprvsec6u43kpvhbfyhrldw/viewform?usp=sf_link$all
Filter updated: Mon, 06 Sep 2021 00:01:54 +0000
2021-09-06 00:01:54 +00:00
||docs.google.com/forms/d/e/1faipqlsceoxsfawdsbd2r-jk2sppywnv1bchzjjcw2xkcj7oqkwqriw/viewform?usp=send_form$all
Filter updated: Wed, 25 Aug 2021 12:02:06 +0000
2021-08-25 12:02:07 +00:00
||docs.google.com/forms/d/e/1faipqlscf9u8nrld-zvu6clr4jcwnw0buqrykdldtzoullbxy8kc1ta/viewform$all
Filter updated: Fri, 16 Jul 2021 12:01:57 +0000
2021-07-16 12:01:57 +00:00
||docs.google.com/forms/d/e/1faipqlscfh2njwrve6_rkxxy1yz83keoeekd4maqcnd-ivq7rkg0uca/viewform$all
Filter updated: Fri, 24 Sep 2021 12:02:36 +0000
2021-09-24 12:02:36 +00:00
||docs.google.com/forms/d/e/1faipqlscg90j3pjk7wbx0vpznglfcyiq_a2ievm0ny05tehbuc2mr7g/viewform?usp=send_form$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||docs.google.com/forms/d/e/1faipqlsch8_wrvwsg5klxptwjznnmghz9ny516msszkmzzjr6wqll4q/viewform$all
Filter updated: Fri, 13 Aug 2021 12:01:44 +0000
2021-08-13 12:01:44 +00:00
||docs.google.com/forms/d/e/1faipqlscn6xxq_xvtivggy_4rkibou1i27e0kpiimikafpaavki1vsq/viewform?usp=send_form&usp=embed_facebook$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||docs.google.com/forms/d/e/1faipqlsco0gvjsnu6vwouw1cnby9hqmoveqoekq63vj95s1xq5gc01g/viewform?vc=0&c=0&w=1&flr=0&usp=mail_form_link$all
||docs.google.com/forms/d/e/1faipqlscq8lwf5u5pxklisswjs79fcko1u76xaqw2cplb00uamj2epa/viewform?usp=send_form$all
Filter updated: Tue, 20 Jul 2021 12:01:48 +0000
2021-07-20 12:01:48 +00:00
||docs.google.com/forms/d/e/1faipqlscqbbsvkpxnasqgeazpzwxp1ln7qzdurt-nqn4azqa7q14euw/viewform$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||docs.google.com/forms/d/e/1faipqlscsp2ltu8y_5h-m0512ckji9i1rwabxoforr5hgbkwi-gx9mg/viewform?usp=send_form$all
||docs.google.com/forms/d/e/1faipqlsct1pxn0qq6ulzzs2kqgekpwoa-galaegxg5mzuxii-fvmwaq/viewform$all
Filter updated: Tue, 20 Jul 2021 12:01:48 +0000
2021-07-20 12:01:48 +00:00
||docs.google.com/forms/d/e/1faipqlscuttypbph1iazuis8aa6xvrlmagwglmdcrrg8g2oymskvbva/viewform$all
Filter updated: Mon, 06 Sep 2021 00:01:54 +0000
2021-09-06 00:01:54 +00:00
||docs.google.com/forms/d/e/1faipqlscwhydxbja0io9phvf8pmcgb11roz_ed85iyqfoliot05_ugq/viewform?usp=send_form$all
Filter updated: Mon, 23 Aug 2021 00:01:47 +0000
2021-08-23 00:01:47 +00:00
||docs.google.com/forms/d/e/1faipqlscz4uf8dtvwhgxggkzsbbhjcgu9npgc6agxpy5o2fwpo6tv5q/viewform?usp=sf_link$all
Filter updated: Sat, 18 Sep 2021 00:14:48 +0000
2021-09-18 00:14:48 +00:00
||docs.google.com/forms/d/e/1faipqlsd29ecusrbnxs7zu-3rpk0vcfjoquhtkmicosbwx-q8vi0wiq/viewform$all
Filter updated: Mon, 06 Sep 2021 00:01:54 +0000
2021-09-06 00:01:54 +00:00
||docs.google.com/forms/d/e/1faipqlsd29ecusrbnxs7zu-3rpk0vcfjoquhtkmicosbwx-q8vi0wiq/viewform?usp=send_form$all
||docs.google.com/forms/d/e/1faipqlsd3x6brnru3toiionptordwmc4zorxcky1ebpmeg6bb4jfuca/viewform?usp=send_form$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||docs.google.com/forms/d/e/1faipqlsd6h5k1kajgpan-tfvs7w4k_b4wq3m6wjdfh_kfrpiq-3w-ag/viewform?fbzx=8876075289152692257$all
Filter updated: Tue, 13 Apr 2021 00:06:31 UTC
2021-04-13 00:06:31 +00:00
||docs.google.com/forms/d/e/1faipqlsd7jgegqudsjg7blscqgfvdftyvlno6xreg6wjuxl0hnfbwtw/viewform?vc=0&c=0&w=1&flr=0&gxids=7628$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||docs.google.com/forms/d/e/1faipqlsd7shjgl-xzh0b--otxbgyaq02wjun61jituz_kgjvmoqhwrg/viewform?vc=0&c=0&w=1&flr=0&usp=mail_form_link$all
||docs.google.com/forms/d/e/1faipqlsd8vkw5fxeroe_pxa7n5cdfpukhahbg_7k7sg0iuosh_xsyoa/viewform?usp=send_form$all
Filter updated: Wed, 18 Aug 2021 00:01:50 +0000
2021-08-18 00:01:50 +00:00
||docs.google.com/forms/d/e/1faipqlsd_c4wpt0zzouwt5lr9p5kn5cylz3ananv1hlix6u_h36w1rg/viewform$all
Filter updated: Tue, 20 Jul 2021 00:01:58 +0000
2021-07-20 00:01:58 +00:00
||docs.google.com/forms/d/e/1faipqlsda4flfi-1_gvwqnbb1dcxz_mb5omo9t2oc-vslzfgh6avrag/viewform$all
Filter updated: Mon, 06 Sep 2021 00:01:54 +0000
2021-09-06 00:01:54 +00:00
||docs.google.com/forms/d/e/1faipqlsdbgprbyowwcugqslasnoo-sbqcrgi6ppycsytvsw2_dwfeug/viewform?usp=send_form$all
Filter updated: Fri, 20 Aug 2021 00:01:56 +0000
2021-08-20 00:01:56 +00:00
||docs.google.com/forms/d/e/1faipqlsdce9c1bqexlzlu9rojtuwtaatyeeshywbkmuiobrw_a-_mga/viewform$all
Filter updated: Wed, 25 Aug 2021 12:02:06 +0000
2021-08-25 12:02:07 +00:00
||docs.google.com/forms/d/e/1faipqlsdce9c1bqexlzlu9rojtuwtaatyeeshywbkmuiobrw_a-_mga/viewform?usp=pp_url$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||docs.google.com/forms/d/e/1faipqlsdfarxg-0eurkyimsg-ukgl4mbtgvwfhe1wzbdxmb7oaosnyg/viewform?usp=send_form$all
Filter updated: Wed, 14 Jul 2021 00:03:28 +0000
2021-07-14 00:03:28 +00:00
||docs.google.com/forms/d/e/1faipqlsdfyxb1kjjvkaiwbbpbgr0dfaq1xx2ehhzbxnt3adndssy1yw/viewform$all
Filter updated: Tue, 20 Jul 2021 12:01:48 +0000
2021-07-20 12:01:48 +00:00
||docs.google.com/forms/d/e/1faipqlsdfyxb1kjjvkaiwbbpbgr0dfaq1xx2ehhzbxnt3adndssy1yw/viewform?usp=send_form$all
Filter updated: Mon, 06 Sep 2021 00:01:54 +0000
2021-09-06 00:01:54 +00:00
||docs.google.com/forms/d/e/1faipqlsdh3fagetv5atvgouwvzn5l5t5w1liy7azndc77wr6wwyu94q/viewform$all
Filter updated: Fri, 24 Sep 2021 12:02:36 +0000
2021-09-24 12:02:36 +00:00
||docs.google.com/forms/d/e/1faipqlsdh3fagetv5atvgouwvzn5l5t5w1liy7azndc77wr6wwyu94q/viewform?usp=send_form$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||docs.google.com/forms/d/e/1faipqlsdhdloijpfz-djbc5k5nzwa_mbdym5kgjm1ssgrhwex3sj49g/viewform$all
||docs.google.com/forms/d/e/1faipqlsdhr2qehprrqzfimbwtlojynm_nvvsdovser7pmho5v5o4cxw/viewform?usp=sf_link$all
Filter updated: Fri, 13 Aug 2021 12:01:44 +0000
2021-08-13 12:01:44 +00:00
||docs.google.com/forms/d/e/1faipqlsdhyezpletqihy8incmgssiwqjlbqwo03ulvjxipjmjjrrscg/viewform?usp=send_form$all
Filter updated: Fri, 17 Sep 2021 12:01:51 +0000
2021-09-17 12:01:52 +00:00
||docs.google.com/forms/d/e/1faipqlsdmsww4edj2yofwdenmvl3uvyibigishgajtsfa7chvcan0wg/viewform$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||docs.google.com/forms/d/e/1faipqlsdp-5roof4dzzivh9nvegldbqvrbi60inudyjxdj7qoevj9qw/viewform?usp=sf_link$all
||docs.google.com/forms/d/e/1faipqlsdp6gmot9lhhgyqmwp6tavohtvtacptly7nzcuiynoir9cjbg/viewform?usp=sf_link$all
||docs.google.com/forms/d/e/1faipqlsdpyvreq-ep0jbvs8gp2oehnu3bxiac9fskhtmy4gmyvq5ihw/viewform?vc=0&c=0&w=1&flr=0$all
||docs.google.com/forms/d/e/1faipqlsdpyvreq-ep0jbvs8gp2oehnu3bxiac9fskhtmy4gmyvq5ihw/viewform?vc=0&c=0&w=1&flr=0&usp=mail_form_link$all
||docs.google.com/forms/d/e/1faipqlsdvo-nueiprck-o5gw7-bnmsz9jvwlyspeqfhfr2g2osbsrba/viewform$all
Filter updated: Mon, 06 Sep 2021 00:01:54 +0000
2021-09-06 00:01:54 +00:00
||docs.google.com/forms/d/e/1faipqlsdvwkczn_rxvn1522z1mcojbs40ymrctyizpyuv72_0wbypgq/viewform?usp=send_form$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||docs.google.com/forms/d/e/1faipqlsdwbz5hapgqojwjyndeeyjxamg0wnaj3kolh3fb6xf4c-fxjw/viewform$all
||docs.google.com/forms/d/e/1faipqlsdwbz5hapgqojwjyndeeyjxamg0wnaj3kolh3fb6xf4c-fxjw/viewform?usp=send_form$all
||docs.google.com/forms/d/e/1faipqlsdxkjopelrwprbruv5pypgeut5c971mdpwp9w1ndxosaui0oa/viewform?usp=send_form$all
Filter updated: Wed, 18 Aug 2021 00:01:50 +0000
2021-08-18 00:01:50 +00:00
||docs.google.com/forms/d/e/1faipqlsdy1071rbhheyidjzo6fw5busqot5eunllw_thawo6udamfaq/viewform$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||docs.google.com/forms/d/e/1faipqlsdzpz7mn6te18_1olbnvu14ez5j_lscj_pintnwldwht6wtaq/viewform?usp=send_form$all
Filter updated: Tue, 20 Jul 2021 12:01:48 +0000
2021-07-20 12:01:48 +00:00
||docs.google.com/forms/d/e/1faipqlsdzrubbm3nrqdzjs6q7phutjgmn-dm8zquphjg9ge31q7bdhg/viewform$all
Filter updated: Fri, 27 Aug 2021 00:01:47 +0000
2021-08-27 00:01:47 +00:00
||docs.google.com/forms/d/e/1faipqlse3-zgmg83lctfks0egmambwonybkscrvxix--n1azwngkphg/viewform$all
Filter updated: Fri, 13 Aug 2021 12:01:44 +0000
2021-08-13 12:01:44 +00:00
||docs.google.com/forms/d/e/1faipqlse3z7zfganhjkbmdgdzheyfulmoguxmywd9hdulew6swo20lw/viewform?usp=send_form$all
Filter updated: Wed, 21 Jul 2021 12:01:49 +0000
2021-07-21 12:01:49 +00:00
||docs.google.com/forms/d/e/1faipqlse659tcdnppv704bqfgkhuwvmmlufcbpaicqx075d_gxnsqba/viewform?usp=send_form$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||docs.google.com/forms/d/e/1faipqlse8ds15kxxdcrhfspcfrbvy6sbdhp0e4540zzmhhvzouewvka/viewform?vc=0&c=0&w=1&flr=0&usp=mail_form_link$all
Filter updated: Wed, 18 Aug 2021 00:01:50 +0000
2021-08-18 00:01:50 +00:00
||docs.google.com/forms/d/e/1faipqlse_mo9pzgdahzdgz0wctr7lm0cqm_zwos8ljc4cqgtvnqfmfq/viewform$all
Filter updated: Fri, 17 Sep 2021 12:01:51 +0000
2021-09-17 12:01:52 +00:00
||docs.google.com/forms/d/e/1faipqlsebyedalhc7exqq5fljf8x1akbwz0h8l8ojbx5nx3go7bh3sa/viewform$all
Filter updated: Wed, 18 Aug 2021 00:01:50 +0000
2021-08-18 00:01:50 +00:00
||docs.google.com/forms/d/e/1faipqlseht4cdltkad8967jjarcb5nafonbaw3dtpynth9mdk94hf-q/viewform?usp=send_form$all
Filter updated: Fri, 24 Sep 2021 12:02:36 +0000
2021-09-24 12:02:36 +00:00
||docs.google.com/forms/d/e/1faipqlseiivk2oebvd57p1rg53giaiaia9tkswgmcqfisnjyqjdpwoa/viewform?usp=send_form$all
Filter updated: Wed, 25 Aug 2021 12:02:06 +0000
2021-08-25 12:02:07 +00:00
||docs.google.com/forms/d/e/1faipqlseirld9oyigwxmec2bc-ax4yd-m-rhezlne00aminsjf0uteq/viewform$all
Filter updated: Fri, 13 Aug 2021 12:01:44 +0000
2021-08-13 12:01:44 +00:00
||docs.google.com/forms/d/e/1faipqlsejavlqdkikylynqlg6p7kyfu4qnlyy31opnfttucuhgmek4a/viewform$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||docs.google.com/forms/d/e/1faipqlsejg2xiowc36xpgb4yrzafossvuajgg7b3kyoyr91ahcajyhg/viewform?usp=sf_link$all
||docs.google.com/forms/d/e/1faipqlsejg2xiowc36xpgb4yrzafossvuajgg7b3kyoyr91ahcajyhg/viewform?usp=sf_link%3e$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||docs.google.com/forms/d/e/1faipqlsek2havgkyh0nefyqqhxvt5lu7hmj-weg4s9s_j07dnon30iw/viewform?vc=0&c=0&w=1&flr=0&usp=mail_form_link$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||docs.google.com/forms/d/e/1faipqlsel_ki8gcgzajteddl27pbkpo6w90de6hj6epzsurphsvekpg/viewform?embedded=true$all
||docs.google.com/forms/d/e/1faipqlsemuphd9zpegybxx9gwrw-vsu9gbqjuufhz2wx34p7cj1cibq/viewform?vc=0&c=0&w=1&flr=0&usp=mail_form_link$all
Filter updated: Wed, 18 Aug 2021 00:01:50 +0000
2021-08-18 00:01:50 +00:00
||docs.google.com/forms/d/e/1faipqlsemwyrvcln1ql8uxd0dsiswveuehikz5hwalfeni7jjfaefmg/viewform?usp=sf_link$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||docs.google.com/forms/d/e/1faipqlseoz9zpmm0c0fjksklv-p1hsrwsuybmj6bvbd_fkewzzcv_ea/viewform$all
Filter updated: Fri, 24 Sep 2021 12:02:36 +0000
2021-09-24 12:02:36 +00:00
||docs.google.com/forms/d/e/1faipqlseoz9zpmm0c0fjksklv-p1hsrwsuybmj6bvbd_fkewzzcv_ea/viewform?usp=pp_url$all
Filter updated: Wed, 18 Aug 2021 00:01:50 +0000
2021-08-18 00:01:50 +00:00
||docs.google.com/forms/d/e/1faipqlseqdx2wgybdxlhascsuopq1xqsmwrxjf4erl_cpmvtt96dq_g/viewform$all
Filter updated: Wed, 25 Aug 2021 12:02:06 +0000
2021-08-25 12:02:07 +00:00
||docs.google.com/forms/d/e/1faipqlser-b6q--nvif2fj7nbn88dh8lj-s2yfbgjyuygwsacbhm6lw/viewform$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||docs.google.com/forms/d/e/1faipqlseszgantjzuxgteg0dsiizzmadcwjbjqcsri5nidod2rd2_lg/viewform$all
Filter updated: Mon, 06 Sep 2021 00:01:54 +0000
2021-09-06 00:01:54 +00:00
||docs.google.com/forms/d/e/1faipqlset42bzecl3yrdnnffv6f7kecxpd1sy4rbh3h3govwg1k1z1w/viewform?usp=send_form$all
Filter updated: Tue, 03 Aug 2021 12:01:54 +0000
2021-08-03 12:01:54 +00:00
||docs.google.com/forms/d/e/1faipqlseumxp-wga1x873upqxmi_hx8nbbllh12zzmxia1xuqp2mgbq/viewform$all
Filter updated: Tue, 20 Jul 2021 12:01:48 +0000
2021-07-20 12:01:48 +00:00
||docs.google.com/forms/d/e/1faipqlsewr7-ksdpydhc1tv8tkcxrlad8zrf3q_uqt-rj9a_fmmzxya/viewform$all
||docs.google.com/forms/d/e/1faipqlsewr7-ksdpydhc1tv8tkcxrlad8zrf3q_uqt-rj9a_fmmzxya/viewform?usp=send_form$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||docs.google.com/forms/d/e/1faipqlsexrthgahyza746esrgvtj4hqnjlqgmef_k2l3usnolt1fjgg/viewform?usp=send_form$all
Filter updated: Thu, 06 May 2021 00:06:49 UTC
2021-05-06 00:06:49 +00:00
||docs.google.com/forms/d/e/1faipqlseyedrifg-qlmvdq0o9il9kmr_p85q1giqync2uwgbbi5he1q/viewform?vc=0&c=0&w=1&flr=0&usp=mail_form_link$all
Filter updated: Tue, 03 Aug 2021 12:01:54 +0000
2021-08-03 12:01:54 +00:00
||docs.google.com/forms/d/e/1faipqlsf32hx6ujsi_gqji38udpamxxxnhyrx8qhmqcqnteinj_0cmg/viewform$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||docs.google.com/forms/d/e/1faipqlsf43dgkrjoe0kbhyqzxvaswkmbstzlu6x-40xi-sxxgfevhww/viewform?vc=0&c=0&w=1&flr=0&usp=mail_form_link$all
Filter updated: Thu, 29 Jul 2021 00:01:57 +0000
2021-07-29 00:01:57 +00:00
||docs.google.com/forms/d/e/1faipqlsf6z9onabfo6e0tdct4ajfm2jgmyyju_msfaofou8dca04yfa/viewform$all
Filter updated: Tue, 20 Jul 2021 12:01:48 +0000
2021-07-20 12:01:48 +00:00
||docs.google.com/forms/d/e/1faipqlsfacaqo8c7hsu7mr6zkbsfulv8m710ke2qna_7tyusomgmtjw/viewform$all
||docs.google.com/forms/d/e/1faipqlsfacaqo8c7hsu7mr6zkbsfulv8m710ke2qna_7tyusomgmtjw/viewform?usp=send_form$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||docs.google.com/forms/d/e/1faipqlsfaexmgpgntdkiayu-wg3vbkhus9frurejyqxukiiydkjc3ug/viewform?vc=0&c=0&w=1&flr=0&usp=mail_form_link$all
Filter updated: Sun, 11 Jul 2021 12:01:37 +0000
2021-07-11 12:01:38 +00:00
||docs.google.com/forms/d/e/1faipqlsfanborkr2ivrhpsjdnvnb-jktwkjbuub3wnsxb-md7haddsq/viewform?usp=send_form$all
Filter updated: Tue, 24 Aug 2021 12:02:00 +0000
2021-08-24 12:02:00 +00:00
||docs.google.com/forms/d/e/1faipqlsfcadutx0elsh0wfimgfoedkee1p3gr2wf_qnv_ctizw8ztaa/viewform?vc=0&c=0&w=1&flr=0$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||docs.google.com/forms/d/e/1faipqlsfcbbgof7lfcganiwuiubcqdhwl_ppaaxbwiuf7aqmljimizq/viewform?vc=0&c=0&w=1&flr=0$all
Filter updated: Wed, 07 Apr 2021 12:23:11 UTC
2021-04-07 12:23:12 +00:00
||docs.google.com/forms/d/e/1faipqlsfeoy_w3jwkkz8psgsw4nrja9tmg2lx0x0nvtmv38k0hjzzmq/viewform?usp=send_form$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||docs.google.com/forms/d/e/1faipqlsffxdjsibp7kmfd28idwdkvupj3klesiwvpoiecz8xpgdh0cq/viewform$all
||docs.google.com/forms/d/e/1faipqlsfgomlcpbyhodks1bwjmx6f5jr0tqwhngun_juf2qk0jp8dbq/viewform?vc=0&c=0&w=1&flr=0&usp=mail_form_link$all
||docs.google.com/forms/d/e/1faipqlsfhzli805cycnlai887dfo6ra8bwbwjbc8uehmv5amiaqdbyq/viewform$all
Filter updated: Tue, 07 Sep 2021 00:01:46 +0000
2021-09-07 00:01:46 +00:00
||docs.google.com/forms/d/e/1faipqlsfjpx-sxpejnp_q2fmfu0jy8oqoesrx9wbrqplcychw9luupa/viewform$all
Filter updated: Tue, 20 Jul 2021 12:01:48 +0000
2021-07-20 12:01:48 +00:00
||docs.google.com/forms/d/e/1faipqlsfjsgjhbjke-mlmni8cfg1tacz-hdpvmy5j2br9upjr1f7nda/viewform$all
||docs.google.com/forms/d/e/1faipqlsfjsgjhbjke-mlmni8cfg1tacz-hdpvmy5j2br9upjr1f7nda/viewform?usp=send_form$all
||docs.google.com/forms/d/e/1faipqlsfk9hpkld9-qwaxs8b0cpslaw2-oomu6bcwpxkmp-fo8kr3ew/viewform$all
||docs.google.com/forms/d/e/1faipqlsfnjyzbmw-pd1byw4b4opoksx2cealounsnhg5fjc3fk1qocq/viewform$all
Filter updated: Fri, 23 Apr 2021 00:06:35 UTC
2021-04-23 00:06:35 +00:00
||docs.google.com/forms/d/e/1faipqlsfnlsbejsiacubkj2geltmn7slefoweeczuagp3jfmfkijg4a/viewform?usp=send_form$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||docs.google.com/forms/d/e/1faipqlsforgq2zksc0soenei1m7xcow9surjrynoh6ppsku6_kxvdpw/viewform?usp=sf_link$all
Filter updated: Tue, 20 Jul 2021 12:01:48 +0000
2021-07-20 12:01:48 +00:00
||docs.google.com/forms/d/e/1faipqlsfp1eukgsktriyraz2csynqwfwtv6ehlnbszu69dbxz9lirtq/viewform$all
||docs.google.com/forms/d/e/1faipqlsfp1eukgsktriyraz2csynqwfwtv6ehlnbszu69dbxz9lirtq/viewform?usp=send_form$all
Filter updated: Tue, 17 Aug 2021 00:02:45 +0000
2021-08-17 00:02:45 +00:00
||docs.google.com/forms/d/e/1faipqlsfrzt6zpkhgtvzqutkypqtjffxaucn3evqpf6ytbqug3t41yw/viewform?usp=pp_urlorganization$all
Filter updated: Wed, 18 Aug 2021 00:01:50 +0000
2021-08-18 00:01:50 +00:00
||docs.google.com/forms/d/e/1faipqlsfsia_g4fb5yg_cu8fjuxcndbgqz1setzfedm0cw0eaonb57g/viewform?usp=sf_link$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||docs.google.com/forms/d/e/1faipqlsfsr_hufaploql8ruxbcya-5su5xpkzee0qtzs6_ixatjrmcw/viewform?usp=send_form$all
Filter updated: Wed, 18 Aug 2021 00:01:50 +0000
2021-08-18 00:01:50 +00:00
||docs.google.com/forms/d/e/1faipqlsftriyys-rvphnbmh6v6lyimxjy3rpog8xvtb3v1agqhawiva/viewform?usp=sf_link$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||docs.google.com/forms/d/e/1faipqlsfvgwgijgampx2qfseard_pb2bcyonllojnjhrv9qxb8vpeva/viewform?vc=0&c=0&w=1&flr=0&usp=mail_form_link$all
||docs.google.com/forms/d/e/1faipqlsfvgwgijgampx2qfseard_pb2bcyonllojnjhrv9qxb8vpeva/viewform?vc=0&c=0&w=1&flr=0&usp=mail_form_link$all
||docs.google.com/forms/d/e/1faipqlsfvvvnddwmy-3u-agx0bvar5wfmplx8bvgef_zdia7ra9llfg/viewform?usp=send_form$all
||docs.google.com/forms/d/e/1faipqlsfwbcfrxuktidm2ctjalngebxbx4k_dijxbekg2y-naausaqw/viewform?vc=0&c=0&w=1&flr=0&usp=mail_form_link$all
Filter updated: Tue, 20 Jul 2021 12:01:48 +0000
2021-07-20 12:01:48 +00:00
||docs.google.com/forms/d/e/1faipqlsfwdsuczwrih_wnciwh_qjpg1v5p-qk8zyjjoccpbhmyeygrq/viewform$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||docs.google.com/forms/d/e/1faipqlsfxoc8vekgqzkhzna2nynvv4fpmbntvo6_rbnwinjte4at6ya/viewform?vc=0&c=0&w=1&flr=0$all
Filter updated: Thu, 22 Apr 2021 12:08:20 UTC
2021-04-22 12:08:20 +00:00
||docs.google.com/forms/d/e/1faipqlsfyxrzgheo7is9dyegsl1h9_4t7mcqz9msa0ttzh0sby6bmow/viewform$all
Filter updated: Tue, 31 Aug 2021 12:01:54 +0000
2021-08-31 12:01:54 +00:00
||docs.google.com/presentation/d/e/2pacx-1vqhu5f9qjt9duj5oq2is4bqxokuq2ebewhyxc9wz2mcdnhpiz8zkw8vcz6horujg2hbe8yrcjeump4e/pub?start=false&loop=false&delayms=3000$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||docs.google.com/presentation/d/e/2pacx-1vqwerdrrgegf76lduaxtfwhfhia5se9-a_9wyl2zmxiiip6pwrfwo10odljd5d-0_8x-ebkat8t3uei/pub?start=false&loop=false&delayms=3000#slide=id.p$all
Filter updated: Wed, 01 Sep 2021 00:02:20 +0000
2021-09-01 00:02:20 +00:00
||docs.google.com/presentation/d/e/2pacx-1vrn2g1dgcoqbd_vlv01bwwwim-oqfddsmoyj7ias_0bnqd6kes65sy45dil8kk96x5tmjt6sllf0qhe/pub?start=false&loop=false&delayms=3000$all
Filter updated: Tue, 14 Sep 2021 00:01:48 +0000
2021-09-14 00:01:48 +00:00
||docs.google.com/presentation/d/e/2pacx-1vrp2k-b45tcwcadgwzkulyaqrs1f9vfjs3y19o6fs_7p34ymzwuascr7lkuijhc83-o6fmsbbvehcf2/pub?start=false&loop=false&delayms=3000&slide=id.p$all
Filter updated: Tue, 07 Sep 2021 12:01:49 +0000
2021-09-07 12:01:49 +00:00
||docs.google.com/presentation/d/e/2pacx-1vsgy7s11tyex2sq_xbzmjt2b8xz7vq3ae52hbkkzw_7v7dh4kodsweugirq8pogurynufixdub2mq6a/pub?start=false&loop=false&delayms=3000$all
Filter updated: Fri, 24 Sep 2021 12:02:36 +0000
2021-09-24 12:02:36 +00:00
||docs.google.com/presentation/d/e/2pacx-1vtyopjgdntenjfrpl7zkuojklty7ifc03cfu0uxxfmmnprn0hymzms85ybdnu3jujfftxmxrwezxea9/pub$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||docs.google.com/viewerng/viewer?url=proxy.ge.tt/1/files/5d0k9lx2/0/blob?referrer%3duser-a6kjrvmdexz9favkffsdh44k4iybrxak3pn41u-%26pdf&ddrp=1=secured$all
||docs.google.com/viewerng/viewer?url=proxy.ge.tt/1/files/8tnpiby2/0/blob?referrer%3duser-ur6z6ngiuctfxjqxnhc2bxyonvsmvcncqdrvc-%26pdf$all
Filter updated: Thu, 23 Sep 2021 00:02:18 +0000
2021-09-23 00:02:18 +00:00
||docs.pancakeswap.finances.barntochef.com$all
Filter updated: Wed, 17 Mar 2021 00:06:16 UTC
2021-03-17 00:06:16 +00:00
||docs.revv.so$all
Filter updated: Tue, 12 Jan 2021 12:06:44 UTC
2021-01-12 12:06:44 +00:00
||docsharex-authorize.firebaseapp.com$all
Filter updated: Fri, 16 Jul 2021 00:01:53 +0000
2021-07-16 00:01:53 +00:00
||doctorcomboninos1adb.blogspot.com$all
Filter updated: Tue, 21 Sep 2021 00:01:40 +0000
2021-09-21 00:01:40 +00:00
||document.ucraft.site$all
Filter updated: Wed, 22 Sep 2021 12:01:56 +0000
2021-09-22 12:01:56 +00:00
||docusign.hill-top-inn.org$all
Filter updated: Sat, 31 Jul 2021 12:01:55 +0000
2021-07-31 12:01:55 +00:00
||dodtqfpyqxxydzrcxvrwuolraq-dot-goff039302032323.rj.r.appspot.com$all
Filter updated: Wed, 04 Aug 2021 00:02:10 +0000
2021-08-04 00:02:10 +00:00
||dofus-touch.shop$all
Filter updated: Sat, 21 Aug 2021 12:02:04 +0000
2021-08-21 12:02:04 +00:00
||dofus-touch.store$all
Filter updated: Wed, 30 Jun 2021 12:01:58 +0000
2021-06-30 12:01:58 +00:00
||doghouserescue.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||dolcevitabymerit.com/exchange328e91ec88ae4615bbc38ab6ce41104e/jspuser328e91ec88ae4615bbc38ab6ce41107e/?08a3ea=brian_casey@capgroup.com$all
Filter updated: Sat, 11 Sep 2021 12:01:27 +0000
2021-09-11 12:01:27 +00:00
||dollar-cheetah.net$all
Filter updated: Mon, 19 Jul 2021 12:01:46 +0000
2021-07-19 12:01:46 +00:00
||dollar-genius.com$all
Filter updated: Fri, 23 Jul 2021 12:01:47 +0000
2021-07-23 12:01:47 +00:00
||dollarbillsquick.com$all
Filter updated: Tue, 16 Mar 2021 00:07:08 UTC
2021-03-16 00:07:09 +00:00
||dominioits.com$all
Filter updated: Fri, 07 May 2021 00:06:36 UTC
2021-05-07 00:06:36 +00:00
||domy-serramenti.it$all
Filter updated: Mon, 23 Aug 2021 12:02:18 +0000
2021-08-23 12:02:19 +00:00
||domystatlab.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||don-marcos.com$all
Filter updated: Mon, 28 Jun 2021 12:06:20 +0000
2021-06-28 12:06:20 +00:00
||donedealprojects.com$all
Filter updated: Fri, 15 Jan 2021 00:06:14 UTC
2021-01-15 00:06:14 +00:00
||dongsuh.net$all
Filter updated: Fri, 18 Dec 2020 12:06:22 UTC
2020-12-18 12:06:22 +00:00
||dopeydog.co.nz$all
Filter updated: Sun, 07 Mar 2021 00:06:38 UTC
2021-03-07 00:06:38 +00:00
||dostawaolx.pl$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||dotdre.com$all
Filter updated: Sun, 08 Aug 2021 00:02:06 +0000
2021-08-08 00:02:06 +00:00
||doublechecklogin.rf.gd$all
Filter updated: Tue, 29 Jun 2021 12:02:07 +0000
2021-06-29 12:02:07 +00:00
||douuodwoman.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||doveadolescentservices-my.sharepoint.com:443/:b:/g/personal/alice_dovecare_co_uk/eux9kze32kbkhhfsn9xq0neblkljq83z_9o1u8jpewiq2a?e=4%3ah1ax4s&at=9$all
||dowaba-s2dhl.blogspot.com$all
||downehouseschool-my.sharepoint.com/:u:/g/personal/robson-hemmingsi_downehouse_net/evxeexzy66hjj9rkfmnus38bolc6coukehkxv--swrydfw?e=jvp1fk$all
Filter updated: Tue, 31 Aug 2021 00:01:55 +0000
2021-08-31 00:01:55 +00:00
||dowwr.com/.sharepointdrvedrve/commmon/oauths/owa/enclosed_document/enclosed_document/jj.5drivezip/$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||doz.tode.cz$all
Filter updated: Fri, 24 Sep 2021 00:01:50 +0000
2021-09-24 00:01:51 +00:00
||dpasdasfasfasfas.pages.dev$all
Filter updated: Thu, 04 Feb 2021 12:06:49 UTC
2021-02-04 12:06:49 +00:00
||dpd-billingerror.com$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||dpd-parceltracking-status.com$all
Filter updated: Fri, 13 Aug 2021 00:01:48 +0000
2021-08-13 00:01:48 +00:00
||dpd-redelivery-uk.com$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||dpd.dostawa-safety.club$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||dpfoidspoifopdsifpoi.blogspot.com$all
Filter updated: Fri, 27 Aug 2021 12:01:40 +0000
2021-08-27 12:01:40 +00:00
||drasticexclude.top$all
Filter updated: Mon, 20 Sep 2021 12:02:05 +0000
2021-09-20 12:02:05 +00:00
||dratsteamfitter.info$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||dravuczpeter.hu$all
Filter updated: Thu, 19 Aug 2021 12:02:33 +0000
2021-08-19 12:02:33 +00:00
||drclaudiophd.mfs.gg$all
Filter updated: Fri, 06 Aug 2021 00:01:52 +0000
2021-08-06 00:01:52 +00:00
||dreamalive5.com$all
Filter updated: Sat, 07 Aug 2021 00:20:48 +0000
2021-08-07 00:20:48 +00:00
||dreamlearn.ind.in$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||dremlovebd.com$all
Filter updated: Wed, 25 Aug 2021 12:02:06 +0000
2021-08-25 12:02:07 +00:00
||drive.google.com/file/d/19tpqpl-rcxwj-fqpk9yfzch19qtdx50y/view$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||drive.google.com/file/d/19zpw90jgon3j5merxi1pauvkjdmx8nfq/edit$all
||drive.google.com/file/d/1bcdyitw2vo5jp6yrbdmiy8cfrkcf4tby/view?usp=drive_web$all
||drive.google.com/file/d/1c5o9_y8_octsepwyojfarn1k-kj4d9fe$all
||drive.google.com/file/d/1cc4iizuwctob05muvpmydl-rruxdfimu/edit$all
||drive.google.com/file/d/1cppgzjnodnftsks_w82um_b_ctgzn-ah/edit$all
||drive.google.com/file/d/1cvc0ts0fkrsyx6vnnuypmotnh7jkcsln/edit$all
||drive.google.com/file/d/1d47d5zh0cxucg1uupib1hyg9mhhe0ziq/view$all
||drive.google.com/file/d/1fdgs5g6fqqkudcl2meym63ua3yu0o-tb/view?usp=drive_web$all
||drive.google.com/file/d/1fsvmjkcq7ennrsfdufkcxshfhnda_fui/view$all
||drive.google.com/file/d/1ginbnlpvt7kpfnog9a68fqmn7k3aivui$all
||drive.google.com/file/d/1hdvx7j89h5l7yz39idgzhqji93jnkl_c/view$all
||drive.google.com/file/d/1ik3uxh3rdigwar7d269wvkowp17cci1n/edit$all
||drive.google.com/file/d/1jixb69t_nw9tmkhvfrejkfzof3d-ijet/view$all
||drive.google.com/file/d/1jvfh6wq9ea9kxr1shhwbh3pecflqzppc/edit$all
||drive.google.com/file/d/1knolz4xw7mgncsjysbomy_y4zxlk6zld/view?usp=sharing$all
||drive.google.com/file/d/1mg5asnyoeet7qsg2n0d_2paxc3j7wx3k/edit$all
||drive.google.com/file/d/1qf58h-1lunq1pubplwdhwd3uooj_vjxa/view$all
||drive.google.com/file/d/1robiosanbh8doqa7yuiewn3akz4094ho/edit$all
||drive.google.com/file/d/1ttaa6m96xsz9kxqa0zy3mzoirfmbspkd/view?usp=sharing$all
Filter updated: Fri, 30 Apr 2021 00:08:30 UTC
2021-04-30 00:08:30 +00:00
||drive.google.com/file/d/1xpjy2kxsljvynrhgntllyzgvlzfxmvuc/view?usp=sharing$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||drive.google.com/file/d/1zmjm3f6e-mgx8ev829md4mxxyd300nbb$all
Filter updated: Thu, 15 Apr 2021 12:07:36 UTC
2021-04-15 12:07:36 +00:00
||driverschoice.sg$all
Filter updated: Mon, 07 Jun 2021 12:06:42 UTC
2021-06-07 12:06:42 +00:00
||drivingschoolglasgow.co.uk$all
Filter updated: Fri, 29 Jan 2021 12:10:13 UTC
2021-01-29 12:10:13 +00:00
||drumairabubakar.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||ds7.main.jp$all
Filter updated: Tue, 21 Sep 2021 12:02:11 +0000
2021-09-21 12:02:11 +00:00
||dsgcbeonline.com$all
Filter updated: Thu, 05 Aug 2021 00:02:05 +0000
2021-08-05 00:02:05 +00:00
||dskedirekt.web.app$all
Filter updated: Tue, 13 Jul 2021 00:02:30 +0000
2021-07-13 00:02:30 +00:00
||dslogix.io$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||dspofipsdoifopsdifposidopfi.blogspot.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||dsymiller.github.io$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||dtiblog.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||dtks.bekasikota.go.id$all
Filter updated: Mon, 07 Jun 2021 00:06:20 UTC
2021-06-07 00:06:20 +00:00
||dtrexx.com.ng$all
Filter updated: Fri, 18 Jun 2021 00:06:41 +0000
2021-06-18 00:06:41 +00:00
||dublinersalicante.com$all
Filter updated: Fri, 27 Aug 2021 12:01:40 +0000
2021-08-27 12:01:40 +00:00
||ducommaquinarias.com$all
Filter updated: Tue, 14 Sep 2021 12:01:44 +0000
2021-09-14 12:01:44 +00:00
||dudgital.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||duffelbagadventures.com$all
Filter updated: Fri, 22 Jan 2021 12:06:34 UTC
2021-01-22 12:06:34 +00:00
||dukhovnist.in.ua$all
Filter updated: Fri, 10 Sep 2021 00:02:17 +0000
2021-09-10 00:02:17 +00:00
||dukkanplus.com$all
Filter updated: Sun, 23 May 2021 12:06:28 UTC
2021-05-23 12:06:28 +00:00
||durablepools.com$all
Filter updated: Sat, 21 Aug 2021 12:02:04 +0000
2021-08-21 12:02:04 +00:00
||dustdearsxx.com$all
Filter updated: Tue, 24 Aug 2021 00:02:23 +0000
2021-08-24 00:02:24 +00:00
||dvdvdv.hyperphp.com$all
Filter updated: Sat, 05 Dec 2020 00:06:43 UTC
2020-12-05 00:06:43 +00:00
||dvla.myvehicle-rebate.com$all
Filter updated: Wed, 06 Jan 2021 00:06:10 UTC
2021-01-06 00:06:10 +00:00
||dvla.support-schemeuk.com$all
Filter updated: Fri, 10 Sep 2021 12:02:02 +0000
2021-09-10 12:02:02 +00:00
||dwrat.andalous.org$all
Filter updated: Thu, 09 Sep 2021 12:02:27 +0000
2021-09-09 12:02:27 +00:00
||dwsmqrunescape.com-oo.ru$all
Filter updated: Tue, 31 Aug 2021 00:01:55 +0000
2021-08-31 00:01:55 +00:00
||dwz.kr$all
Filter updated: Wed, 01 Sep 2021 00:02:20 +0000
2021-09-01 00:02:20 +00:00
||dxixisport.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||dydy2.app.link$all
Filter updated: Thu, 02 Sep 2021 12:02:02 +0000
2021-09-02 12:02:02 +00:00
||dyn.co$all
Filter updated: Sat, 20 Feb 2021 12:06:44 UTC
2021-02-20 12:06:44 +00:00
||dynastyclinic.ae$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||dzd.rksmb.org$all
Filter updated: Thu, 05 Aug 2021 12:01:57 +0000
2021-08-05 12:01:57 +00:00
||e-bancapersonal.ultimatefreehost.in$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||e-donusum.vbt.com.tr/tmp/?0120amyuym91y2hhcmraywkyyi5jb20n552$all
Filter updated: Fri, 16 Apr 2021 12:06:41 UTC
2021-04-16 12:06:41 +00:00
||e-learningmialmaarifmrk.sch.id$all
Filter updated: Tue, 31 Aug 2021 12:01:54 +0000
2021-08-31 12:01:54 +00:00
||e-linda.com$all
Filter updated: Tue, 14 Sep 2021 12:01:44 +0000
2021-09-14 12:01:44 +00:00
||e-pointpesmobile.cf$all
Filter updated: Thu, 03 Sep 2020 12:06:37 UTC
2020-09-03 12:06:37 +00:00
||e-receipts.co$all
||e-registration.co.in$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||e-transport-cfscoliss-fr.prohoster.biz$all
Filter updated: Tue, 20 Apr 2021 00:06:42 UTC
2021-04-20 00:06:42 +00:00
||e4ra.byethost8.com$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||eagghci.r.bh.d.sendibt3.com$all
Filter updated: Mon, 31 May 2021 00:06:34 UTC
2021-05-31 00:06:34 +00:00
||eaor.surveysparrow.com$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||east-sonnychester.bwpsites.com$all
Filter updated: Wed, 22 Sep 2021 12:01:56 +0000
2021-09-22 12:01:56 +00:00
||easypackagecenter.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||easyquotes4you.com$all
Filter updated: Mon, 20 Sep 2021 12:02:05 +0000
2021-09-20 12:02:05 +00:00
||eatshapelove.it$all
Filter updated: Sun, 16 May 2021 12:06:24 UTC
2021-05-16 12:06:24 +00:00
||eba0200d0c.nxcli.net$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||ebanking.ing.be-npx.info$all
Filter updated: Thu, 29 Jul 2021 00:01:57 +0000
2021-07-29 00:01:57 +00:00
||ebay-communaute-fr-t8-forums-de-discussion.22web.org$all
Filter updated: Sun, 15 Aug 2021 00:01:57 +0000
2021-08-15 00:01:57 +00:00
||ebay-diskussion-forum-de-app.22web.org$all
Filter updated: Thu, 08 Jul 2021 00:02:02 +0000
2021-07-08 00:02:02 +00:00
||ebay-diskussion-forum-t1-de.22web.org$all
||ebay-diskussion-forum-t2-de.html-5.me$all
Filter updated: Wed, 23 Jun 2021 00:06:32 +0000
2021-06-23 00:06:32 +00:00
||ebay-forums-de-discussion-fr.22web.org$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||ebay-seller-center.vercel.app$all
Filter updated: Thu, 18 Feb 2021 12:07:12 UTC
2021-02-18 12:07:12 +00:00
||ebay.com-brand-gwen-food-trailer-37353927.3567102.com$all
Filter updated: Sat, 12 Jun 2021 00:25:37 UTC
2021-06-12 00:25:37 +00:00
||ebay.com-itm.2387687.xyz$all
Filter updated: Mon, 05 Apr 2021 12:06:40 UTC
2021-04-05 12:06:40 +00:00
||ebay.payment-issues-help.com$all
Filter updated: Sun, 28 Feb 2021 12:09:19 UTC
2021-02-28 12:09:19 +00:00
||ebayfraud.gremlins-in-it.com/fraudulent.html$all
Filter updated: Wed, 12 May 2021 00:06:26 UTC
2021-05-12 00:06:26 +00:00
||ebaystore.shop$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||ebhwt.com.cn$all
||ebhwt.com.cn/yzms.html$all
Filter updated: Fri, 04 Jun 2021 12:07:04 UTC
2021-06-04 12:07:04 +00:00
||ebiz4biz.com.cn$all
Filter updated: Fri, 27 Nov 2020 12:06:59 UTC
2020-11-27 12:06:59 +00:00
||ebuddynews.com$all
Filter updated: Mon, 10 May 2021 12:06:32 UTC
2021-05-10 12:06:32 +00:00
||eccobutypolska.com$all
Filter updated: Tue, 22 Jun 2021 12:06:51 +0000
2021-06-22 12:06:51 +00:00
||eces-ecole.org$all
Filter updated: Mon, 13 Sep 2021 12:01:52 +0000
2021-09-13 12:01:52 +00:00
||echo-nomic.com$all
Filter updated: Wed, 22 Sep 2021 12:01:56 +0000
2021-09-22 12:01:56 +00:00
||echostar.pl$all
Filter updated: Wed, 15 Sep 2021 00:01:54 +0000
2021-09-15 00:01:55 +00:00
||eclipsephotovoltech.com$all
Filter updated: Tue, 03 Aug 2021 00:01:58 +0000
2021-08-03 00:01:58 +00:00
||eclipsevpn-new.com$all
Filter updated: Sun, 27 Jun 2021 12:06:19 +0000
2021-06-27 12:06:19 +00:00
||ecngx290.inmotionhosting.com$all
Filter updated: Fri, 20 Aug 2021 12:01:48 +0000
2021-08-20 12:01:48 +00:00
||ecngx300.inmotionhosting.com$all
Filter updated: Fri, 04 Dec 2020 12:06:51 UTC
2020-12-04 12:06:51 +00:00
||ecomcrew.staging.wpengine.com$all
||ecomcrew.staging.wpengine.com/wp-content/plugins/alldomain/domain/dmain/index.php?i=i&0=abuse@optusnet.com.au$all
Filter updated: Tue, 03 Aug 2021 12:01:54 +0000
2021-08-03 12:01:54 +00:00
||ecomuseodebicorp.com$all
Filter updated: Tue, 21 Sep 2021 00:01:40 +0000
2021-09-21 00:01:40 +00:00
||economiaiocupacio.montcada.cat$all
Filter updated: Wed, 18 Aug 2021 12:02:35 +0000
2021-08-18 12:02:36 +00:00
||economicassistancerelief.xyz$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||ecusltd-my.sharepoint.com/:x:/r/personal/angela_ure_ecusltd_co_uk/_layouts/15/wopiframe.aspx?guestaccesstoken=umwosbguhwaqic3hhtqfly7zjwf8oggrcn6d%2bggohoc%3d&docid=1_1956f6e254d71417a89981b2a1c8d0a99&wdformid=%7be61ca4f5-c461-425a-a52e-4598e7b699e5%7d&action=formsubmit&cid=4ab9a2a7-7cf4-43ae-8149-ffead8d66e7b$all
Filter updated: Sat, 24 Jul 2021 00:33:22 +0000
2021-07-24 00:33:22 +00:00
||edd-ui3.sitey.me$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||eddcard.pcfpl.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||eddie-admit-musicians-promoting.trycloudflare.com$all
Filter updated: Thu, 15 Jul 2021 12:01:53 +0000
2021-07-15 12:01:53 +00:00
||edgeurl.com$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||edgeworkflow12.azurefd.net$all
Filter updated: Wed, 26 May 2021 00:06:29 UTC
2021-05-26 00:06:29 +00:00
||edhf0c.webwave.dev$all
Filter updated: Wed, 01 Sep 2021 12:01:58 +0000
2021-09-01 12:01:58 +00:00
||edje.com/cmspagephotos/80-dj774h8dfy/valid$all
Filter updated: Wed, 25 Aug 2021 12:02:06 +0000
2021-08-25 12:02:07 +00:00
||educationsgain.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||edulindberghschools-my.sharepoint.com/personal/20jessicamiller_lindberghschools_ws/_layouts/15/wopiframe.aspx?guestaccesstoken=jv9wbvf6jfqmu%2bpjy3c%2bj7gd%2bvswnc1xz8o9bkulrkm%3d&docid=1_124e7318433ca471780ebffb8ed3119fb&wdformid=%7bfbf01b7f%2dc381%2d45e7%2daa1a%2d86eb8e279071%7d%2f&action=formsubmit$all
Filter updated: Mon, 25 Jan 2021 12:06:29 UTC
2021-01-25 12:06:29 +00:00
||ee-servicehub.com$all
Filter updated: Thu, 04 Mar 2021 00:06:31 UTC
2021-03-04 00:06:31 +00:00
||ee-verify-billing-secure.com$all
Filter updated: Sun, 29 Aug 2021 12:01:39 +0000
2021-08-29 12:01:39 +00:00
||eeverywhere-my.sharepoint.com/personal/marco_eeverywhere_com/_layouts/15/onedrive.aspx?id=/personal/marco_eeverywhere_com/documents/documents&originalpath=ahr0chm6ly9lzxzlcnl3agvyzs1tes5zagfyzxbvaw50lmnvbs86zjovcc9tyxjjby9fcwhvbeq1x3hltknorzbdmdvvmgjvvujoy1z3b25futjvejhtlwxqrg9svwvrp3j0aw1lpvduaunytfu4mlvn$all
Filter updated: Fri, 24 Sep 2021 12:02:36 +0000
2021-09-24 12:02:36 +00:00
||eey203.top$all
Filter updated: Fri, 16 Jul 2021 00:01:53 +0000
2021-07-16 00:01:53 +00:00
||efarms.com.ng$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||effbcjuu.ga$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||effect-print.net$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||efintechnetonline.shop$all
Filter updated: Thu, 16 Sep 2021 00:01:52 +0000
2021-09-16 00:01:52 +00:00
||efjefhfhasfdjajsdajdjs.my-board.org$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||egacal.edu.pe$all
Filter updated: Thu, 26 Aug 2021 12:02:31 +0000
2021-08-26 12:02:31 +00:00
||eggbox.top$all
Filter updated: Thu, 16 Sep 2021 00:01:52 +0000
2021-09-16 00:01:52 +00:00
||eggmutt.com$all
Filter updated: Wed, 15 Sep 2021 12:01:46 +0000
2021-09-15 12:01:46 +00:00
||egypttodaytravel.net$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||eh5ko.csb.app$all
||ehan.org$all
Filter updated: Wed, 20 Jan 2021 00:06:08 UTC
2021-01-20 00:06:08 +00:00
||eharmonyservice.com$all
Filter updated: Thu, 21 Jan 2021 12:06:44 UTC
2021-01-21 12:06:44 +00:00
||ehealthmax.com$all
Filter updated: Mon, 06 Sep 2021 12:01:50 +0000
2021-09-06 12:01:50 +00:00
||einloggen-zur-sparka.xyz$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||eisbt.com/bt/ebtny%20ctupds/ilkopdata/serviliscbe/ertyopl/$all
||eisbt.com/bt/ebtny%20ctupds/ilkopdata/serviliscbe/ertyopl/index.php$all
Filter updated: Thu, 22 Apr 2021 00:06:42 UTC
2021-04-22 00:06:42 +00:00
||ekabel.hu$all
Filter updated: Fri, 09 Apr 2021 12:06:58 UTC
2021-04-09 12:06:58 +00:00
||ekaterinaschol.ru$all
Filter updated: Wed, 30 Jun 2021 00:01:58 +0000
2021-06-30 00:01:58 +00:00
||ekobebe.cn$all
Filter updated: Fri, 26 Feb 2021 12:08:06 UTC
2021-02-26 12:08:06 +00:00
||ekopups.com.ua$all
Filter updated: Sat, 06 Feb 2021 00:06:52 UTC
2021-02-06 00:06:53 +00:00
||ekvarika.ru$all
Filter updated: Wed, 15 Sep 2021 12:01:46 +0000
2021-09-15 12:01:46 +00:00
||elbroder.com$all
Filter updated: Tue, 10 Aug 2021 12:02:08 +0000
2021-08-10 12:02:08 +00:00
||elchavo8181.byethost8.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||electrocoolhvacr.com$all
Filter updated: Sat, 18 Sep 2021 00:14:48 +0000
2021-09-18 00:14:48 +00:00
||electronic-doc-townofscotlandneck.gq$all
Filter updated: Wed, 24 Mar 2021 12:06:42 UTC
2021-03-24 12:06:42 +00:00
||electronicanehuen.com$all
Filter updated: Thu, 16 Sep 2021 00:01:52 +0000
2021-09-16 00:01:52 +00:00
||elektro-live.de$all
Filter updated: Fri, 24 Sep 2021 00:01:50 +0000
2021-09-24 00:01:51 +00:00
||elektroonline.pl$all
Filter updated: Fri, 27 Aug 2021 00:01:47 +0000
2021-08-27 00:01:47 +00:00
||elektrum.top$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||elettrovisiongroup.com$all
Filter updated: Thu, 09 Sep 2021 00:01:56 +0000
2021-09-09 00:01:56 +00:00
||elevatebuilders.lv$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||elexbetgir1.blogspot.com$all
Filter updated: Fri, 19 Feb 2021 00:06:27 UTC
2021-02-19 00:06:28 +00:00
||elexbetgirisadresimiz.blogspot.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||elexusbetgir1.blogspot.com$all
||elexusbetgirissitemiz.blogspot.com$all
||elexusbettgiris4.blogspot.com$all
||elexusgirisim1.blogspot.com$all
Filter updated: Mon, 07 Jun 2021 00:06:20 UTC
2021-06-07 00:06:20 +00:00
||elgozon8589.eshost.com.ar/iniciar%20sesi%c3%b3n.html$all
Filter updated: Tue, 21 Sep 2021 00:01:40 +0000
2021-09-21 00:01:40 +00:00
||ellatinodigital.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||elomo.ro$all
Filter updated: Sun, 16 May 2021 12:06:24 UTC
2021-05-16 12:06:24 +00:00
||eloncoins.space$all
Filter updated: Sun, 19 Sep 2021 12:01:34 +0000
2021-09-19 12:01:35 +00:00
||emahajobs.com$all
Filter updated: Fri, 18 Dec 2020 00:06:14 UTC
2020-12-18 00:06:14 +00:00
||email.2020cycling.cc$all
Filter updated: Thu, 29 Jul 2021 00:01:57 +0000
2021-07-29 00:01:57 +00:00
||email.alsea.com.mx$all
Filter updated: Tue, 21 Sep 2021 00:01:40 +0000
2021-09-21 00:01:40 +00:00
||email.stickercanada.com$all
Filter updated: Fri, 14 May 2021 12:06:36 UTC
2021-05-14 12:06:36 +00:00
||email.touchbasepro.com$all
Filter updated: Thu, 18 Feb 2021 12:07:12 UTC
2021-02-18 12:07:12 +00:00
||email302.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||emailfilter-update.sitebeat.site$all
Filter updated: Thu, 15 Jul 2021 12:01:53 +0000
2021-07-15 12:01:53 +00:00
||emailmarketing.profesionalhosting.com$all
Filter updated: Wed, 28 Jul 2021 12:01:46 +0000
2021-07-28 12:01:46 +00:00
||emailmeform.com/builder/form/rn6bf7v0znavp58$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||emailsettings.webflow.io$all
Filter updated: Sat, 05 Jun 2021 12:06:16 UTC
2021-06-05 12:06:17 +00:00
||emausradio.net$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||embdestech.co.in$all
||emebfsasampaio.creatorlink.net$all
Filter updated: Sat, 30 Jan 2021 00:06:43 UTC
2021-01-30 00:06:43 +00:00
||emergencyelectricianfulham.co.uk$all
Filter updated: Sat, 17 Jul 2021 00:01:47 +0000
2021-07-17 00:01:47 +00:00
||emilianosibada34.byethost4.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||emjel.blogspot.com$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||emo.goodislife.shop$all
Filter updated: Sat, 18 Sep 2021 00:14:48 +0000
2021-09-18 00:14:48 +00:00
||emo.hnvwpa.shop$all
Filter updated: Sat, 18 Sep 2021 12:01:34 +0000
2021-09-18 12:01:34 +00:00
||emo.qkfyqntu.cn$all
Filter updated: Tue, 05 Jan 2021 12:06:21 UTC
2021-01-05 12:06:22 +00:00
||employee-portal.buildingandearth.com$all
Filter updated: Fri, 10 Sep 2021 00:02:17 +0000
2021-09-10 00:02:17 +00:00
||employmentform.godaddysites.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||empresas-lnterlbnlk-pe.com$all
Filter updated: Tue, 07 Sep 2021 00:01:46 +0000
2021-09-07 00:01:46 +00:00
||empresas.lnterbank.bacazinternet.com$all
Filter updated: Tue, 16 Feb 2021 00:06:20 UTC
2021-02-16 00:06:20 +00:00
||empresas.netinterbank.interbol-portal.com$all
Filter updated: Wed, 08 Sep 2021 12:01:51 +0000
2021-09-08 12:01:51 +00:00
||emryq.co.ke$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||emsi-lobo.firebaseapp.com$all
Filter updated: Wed, 08 Sep 2021 00:02:08 +0000
2021-09-08 00:02:08 +00:00
||emtiaz310.github.io$all
Filter updated: Mon, 20 Sep 2021 12:02:05 +0000
2021-09-20 12:02:05 +00:00
||en-claims-funds-verify.com$all
Filter updated: Mon, 24 May 2021 00:06:37 UTC
2021-05-24 00:06:37 +00:00
||en.akirasushi.com.vn$all
Filter updated: Tue, 23 Mar 2021 00:10:01 UTC
2021-03-23 00:10:01 +00:00
||enbolivia.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||encryptdrive.booogle.net$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||encrypted-tbn0.gstatic.com/images?q=tbn:and9gctpssw1eco05z7yyt9h5de gpvythapzl23nhw&usqp=cau$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||endpointsportal.au-bbva-bancomerappnomina.cloud.goog$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||energetic-dent-clipper.glitch.me$all
Filter updated: Sat, 26 Sep 2020 00:06:45 UTC
2020-09-26 00:06:45 +00:00
||energygain.co.uk$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||energynsolucoes.com.br$all
Filter updated: Tue, 16 Mar 2021 12:06:41 UTC
2021-03-16 12:06:42 +00:00
||engcamp.org$all
Filter updated: Tue, 17 Nov 2020 12:06:54 UTC
2020-11-17 12:06:54 +00:00
||englishstudio.ir$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||enjoy.ddnsking.com$all
Filter updated: Wed, 25 Aug 2021 00:01:57 +0000
2021-08-25 00:01:57 +00:00
||enlineamovilapp-aperu-digtal.comtechsystemsinc.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||enorma.is$all
||ensemblearsmundi.com$all
Filter updated: Fri, 14 May 2021 00:06:27 UTC
2021-05-14 00:06:28 +00:00
||entreobras.com.ar$all
Filter updated: Fri, 16 Apr 2021 00:06:41 UTC
2021-04-16 00:06:41 +00:00
||enviosc-cl.blogspot.com$all
Filter updated: Wed, 18 Aug 2021 00:01:50 +0000
2021-08-18 00:01:50 +00:00
||eo.is$all
Filter updated: Tue, 14 Sep 2021 12:01:44 +0000
2021-09-14 12:01:44 +00:00
||eparki.com$all
Filter updated: Tue, 10 Aug 2021 12:02:08 +0000
2021-08-10 12:02:08 +00:00
||epersonsalvagricolog.freecluster.eu$all
Filter updated: Tue, 14 Sep 2021 12:01:44 +0000
2021-09-14 12:01:44 +00:00
||epicdankbot.com$all
Filter updated: Sat, 11 Sep 2021 00:34:15 +0000
2021-09-11 00:34:15 +00:00
||epiciek.com$all
Filter updated: Wed, 02 Jun 2021 12:06:27 UTC
2021-06-02 12:06:28 +00:00
||eproxy.pusan.ac.kr$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||equalchances.org$all
Filter updated: Thu, 08 Apr 2021 00:06:59 UTC
2021-04-08 00:06:59 +00:00
||equitydwellings.com$all
Filter updated: Mon, 23 Aug 2021 00:01:47 +0000
2021-08-23 00:01:47 +00:00
||erastylogestle039.clickfunnels.com$all
Filter updated: Fri, 10 Sep 2021 00:02:17 +0000
2021-09-10 00:02:17 +00:00
||erfanpaslar.ir$all
Filter updated: Thu, 02 Sep 2021 00:01:59 +0000
2021-09-02 00:01:59 +00:00
||ergfg.hyperphp.com$all
Filter updated: Tue, 14 Sep 2021 12:01:44 +0000
2021-09-14 12:01:44 +00:00
||ericoutterson.com$all
Filter updated: Mon, 31 May 2021 12:06:30 UTC
2021-05-31 12:06:30 +00:00
||erp.oriontravels.com.bd$all
Filter updated: Sun, 04 Apr 2021 00:06:31 UTC
2021-04-04 00:06:31 +00:00
||ersal.wuamerigo.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||ersfilter-my.sharepoint.com/:x:/r/personal/nradonich_ersfilter_com/_layouts/15/wopiframe.aspx?guestaccesstoken=t6t%2fhn1dkbyhlyx%2beimbazufa43rrgz6%2faaaewnocdi%3d&docid=1_18168db23429e45f29fdf2e7be120efc4&wdformid=%7bb9970f62%2d44c3%2d4d09%2d9929%2d6e1eb652da57%7d&action=formsubmit$all
||ersfilter-my.sharepoint.com/personal/nradonich_ersfilter_com/_layouts/15/wopiframe.aspx?guestaccesstoken=6ywmlbqi9 sjfgzhadhvte2gyowjf83iqbjrjehik4s=&docid=1_135f7008dfbfa44e6b09dab0eb165b997&wdformid={e037f2d9-5daa-4916-ba03-eb11d0aa6dea}&action=formsubmit$all
||ersfilter-my.sharepoint.com/personal/nradonich_ersfilter_com/_layouts/15/wopiframe.aspx?guestaccesstoken=6ywmlbqi9%20sjfgzhadhvte2gyowjf83iqbjrjehik4s=&docid=1_135f7008dfbfa44e6b09dab0eb165b997&wdformid={e037f2d9-5daa-4916-ba03-eb11d0aa6dea}&action=formsubmit$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||ertlh.denpasarkota.go.id$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||ertu.streamlink.to$all
Filter updated: Thu, 15 Jul 2021 12:01:53 +0000
2021-07-15 12:01:53 +00:00
||ervashipping.com$all
Filter updated: Tue, 04 May 2021 00:15:58 UTC
2021-05-04 00:15:58 +00:00
||ervices.runescape.com-cn.ru$all
||ervices.runescape.com-ov.ru$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||es-dinahosting-comc28abc41.offzarek.com$all
Filter updated: Fri, 03 Sep 2021 12:01:48 +0000
2021-09-03 12:01:48 +00:00
||es.runescape.com-ov.ru$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||eschoolzones.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||esgcommercialbrokers.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||espacecli6.temp.swtest.ru$all
Filter updated: Sat, 03 Apr 2021 12:06:22 UTC
2021-04-03 12:06:22 +00:00
||essence.co.th$all
Filter updated: Thu, 18 Feb 2021 12:07:12 UTC
2021-02-18 12:07:12 +00:00
||estetika2z.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||estudiomaskin.com$all
Filter updated: Sat, 18 Sep 2021 12:01:34 +0000
2021-09-18 12:01:34 +00:00
||eswissch.blogspot.com/?m=0$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||etasarla.com$all
Filter updated: Sat, 11 Sep 2021 12:01:27 +0000
2021-09-11 12:01:27 +00:00
||etc-meisa1.xyz$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||etc-meisa23.monster$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||etc-meisa25.monster$all
||etc-meisacd1.monster$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||etc-meisai.i58g21.cn$all
||etc-meisai.ih7t0d.cn$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||etc-meisai.jp.1ni2qn.cn$all
Filter updated: Fri, 24 Sep 2021 00:01:50 +0000
2021-09-24 00:01:51 +00:00
||etc-meisai.jp.1pbpbw.cn$all
||etc-meisai.jp.1w6l2l.cn$all
||etc-meisai.jp.1y0p65.cn$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||etc-meisai.jp.1zxdmd0.cn$all
||etc-meisai.jp.20aayuy.cn$all
||etc-meisai.jp.22e57oz.cn$all
||etc-meisai.jp.22jp0s.cn$all
||etc-meisai.jp.2zgi12b.cn$all
Filter updated: Mon, 20 Sep 2021 00:01:41 +0000
2021-09-20 00:01:41 +00:00
||etc-meisai.jp.316g3ii.cn$all
||etc-meisai.jp.5wvxlp.cn$all
Filter updated: Fri, 17 Sep 2021 12:01:51 +0000
2021-09-17 12:01:52 +00:00
||etc-meisai.jp.7pc4t5.cn$all
Filter updated: Mon, 20 Sep 2021 12:02:05 +0000
2021-09-20 12:02:05 +00:00
||etc-meisai.jp.7tn4nkm.cn$all
Filter updated: Mon, 20 Sep 2021 00:01:41 +0000
2021-09-20 00:01:41 +00:00
||etc-meisai.jp.7z9s8ua.cn$all
||etc-meisai.jp.8r61ly.cn$all
||etc-meisai.jp.9hlk91h.cn$all
Filter updated: Sat, 18 Sep 2021 12:01:34 +0000
2021-09-18 12:01:34 +00:00
||etc-meisai.jp.co-info.top$all
Filter updated: Thu, 16 Sep 2021 12:02:15 +0000
2021-09-16 12:02:15 +00:00
||etc-meisai.jp.fn-info.top$all
Filter updated: Tue, 14 Sep 2021 00:01:48 +0000
2021-09-14 00:01:48 +00:00
||etc-meisai.jp.kyzqmuh.cn$all
||etc-meisai.jp.mfkrgtb.cn$all
Filter updated: Sun, 19 Sep 2021 00:02:16 +0000
2021-09-19 00:02:17 +00:00
||etc-meisai.jp.ncdcrca.cn$all
Filter updated: Tue, 14 Sep 2021 00:01:48 +0000
2021-09-14 00:01:48 +00:00
||etc-meisai.jp.oml5el8.cn$all
||etc-meisai.jp.piswph7.cn$all
||etc-meisai.jp.pl87dz.cn$all
||etc-meisai.jp.q20cxz5.cn$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||etc-meisai.jp.uhkyzia.cn$all
||etc-meisai.jp.uny0h0.cn$all
||etc-meisai.jp.uq8uok.cn$all
||etc-meisai.jp.uu2sqy.cn$all
||etc-meisai.jp.uz7r34.cn$all
Filter updated: Fri, 24 Sep 2021 00:01:50 +0000
2021-09-24 00:01:51 +00:00
||etc-meisai.jp.zxvzjrd.cn$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||etc-meisai.lptkwkj.cn$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||etc-meisai.sk9p95.cn$all
Filter updated: Fri, 24 Sep 2021 00:01:50 +0000
2021-09-24 00:01:51 +00:00
||etc-meisai.tbizeow.cn$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||etc-meisai.v63a0z.cn$all
||etc-meisai.vfi1oj.cn$all
||etc-meisai.vn09i1.cn$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||etc-meisai.we8y6o.cn$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||etc-meisai.xv4p6t.cn$all
Filter updated: Sat, 11 Sep 2021 12:01:27 +0000
2021-09-11 12:01:27 +00:00
||etc-meisai1.buzz$all
Filter updated: Fri, 24 Sep 2021 12:02:36 +0000
2021-09-24 12:02:36 +00:00
||etc-meisaif2.monster$all
||etc-meisaif3.monster$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||etc-meisal.jn5e53.cn$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||etc-meisal.zo6f1i.cn$all
||etc-meisal.zqydp0.cn$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||etc-meisia.jp.moluqinglian.club$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||etc-melsai.k3ctr6.cn$all
Filter updated: Sun, 19 Sep 2021 12:01:34 +0000
2021-09-19 12:01:35 +00:00
||etc-nnelsai.26tlse.cn$all
Filter updated: Sun, 19 Sep 2021 00:02:16 +0000
2021-09-19 00:02:17 +00:00
||etc-nnelsai.6tkmmzb.cn$all
||etc-nnelsai.8il3j4.cn$all
Filter updated: Sat, 18 Sep 2021 12:01:34 +0000
2021-09-18 12:01:34 +00:00
||etc-nnelsai.aikablog.cn$all
Filter updated: Tue, 14 Sep 2021 12:01:44 +0000
2021-09-14 12:01:44 +00:00
||etc-nnelsai.ansales.cn$all
Filter updated: Sun, 19 Sep 2021 00:02:16 +0000
2021-09-19 00:02:17 +00:00
||etc-nnelsai.hcdot.cn$all
Filter updated: Sat, 18 Sep 2021 12:01:34 +0000
2021-09-18 12:01:34 +00:00
||etc-nnelsai.kedgebs.com.cn$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||etc-nnelsai.lygcmgjg.cn$all
Filter updated: Sun, 19 Sep 2021 12:01:34 +0000
2021-09-19 12:01:35 +00:00
||etc-nnelsai.nx5rc4h.cn$all
Filter updated: Sat, 18 Sep 2021 00:14:48 +0000
2021-09-18 00:14:48 +00:00
||etc-nnelsai.shizuxiehou.cn$all
Filter updated: Sun, 19 Sep 2021 00:02:16 +0000
2021-09-19 00:02:17 +00:00
||etc-nnelsai.tsyjuf4.cn$all
Filter updated: Sat, 18 Sep 2021 12:01:34 +0000
2021-09-18 12:01:34 +00:00
||etc-nnelsai.weishangga.cn$all
Filter updated: Sun, 19 Sep 2021 00:02:16 +0000
2021-09-19 00:02:17 +00:00
||etc-nnelsai.xealv6.cn$all
Filter updated: Sat, 18 Sep 2021 12:01:34 +0000
2021-09-18 12:01:34 +00:00
||etc-nnelsai.xinrongcompressor.cn$all
Filter updated: Sun, 19 Sep 2021 12:01:34 +0000
2021-09-19 12:01:35 +00:00
||etc-nnelsai.ymmx796.cn$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||etc1-nnelsai.0vz5fi.cn$all
||etc1-nnelsai.1ltz77.cn$all
||etc1-nnelsai.2p5ocu.cn$all
||etc1-nnelsai.317433a.cn$all
||etc1-nnelsai.4cb5849.cn$all
Filter updated: Tue, 21 Sep 2021 00:01:40 +0000
2021-09-21 00:01:40 +00:00
||etc1-nnelsai.5woh02.cn$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||etc1-nnelsai.6t2kiw.cn$all
Filter updated: Tue, 21 Sep 2021 00:01:40 +0000
2021-09-21 00:01:40 +00:00
||etc1-nnelsai.6zzl78.cn$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||etc1-nnelsai.7jo3ob.cn$all
||etc1-nnelsai.9w35z4.cn$all
Filter updated: Tue, 21 Sep 2021 00:01:40 +0000
2021-09-21 00:01:40 +00:00
||etc1-nnelsai.aq01nw.cn$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||etc1-nnelsai.bz92hm.cn$all
||etc1-nnelsai.cmoanqf.cn$all
||etc1-nnelsai.d8o68b.cn$all
||etc1-nnelsai.eqllihzk.cn$all
||etc1-nnelsai.flc30g0.cn$all
||etc1-nnelsai.fmtkj7.cn$all
||etc1-nnelsai.g25ymo.cn$all
Filter updated: Mon, 20 Sep 2021 00:01:41 +0000
2021-09-20 00:01:41 +00:00
||etc1-nnelsai.gv0dngk.cn$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||etc1-nnelsai.gweqgvw.cn$all
||etc1-nnelsai.h01ex0.cn$all
Filter updated: Tue, 21 Sep 2021 00:01:40 +0000
2021-09-21 00:01:40 +00:00
||etc1-nnelsai.mzfj88.cn$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||etc1-nnelsai.nzwzsj.cn$all
||etc1-nnelsai.oom4h3.cn$all
||etc1-nnelsai.oz8m59.cn$all
||etc1-nnelsai.p0c2q6.cn$all
Filter updated: Mon, 20 Sep 2021 12:02:05 +0000
2021-09-20 12:02:05 +00:00
||etc1-nnelsai.szclarencefre11.cn$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||etc1-nnelsai.tiv7je.cn$all
Filter updated: Tue, 21 Sep 2021 00:01:40 +0000
2021-09-21 00:01:40 +00:00
||etc1-nnelsai.tq427r.cn$all
Filter updated: Mon, 20 Sep 2021 00:01:41 +0000
2021-09-20 00:01:41 +00:00
||etc1-nnelsai.trumanlouisa1.cn$all
Filter updated: Tue, 21 Sep 2021 00:01:40 +0000
2021-09-21 00:01:40 +00:00
||etc1-nnelsai.tubinqiao.cn$all
Filter updated: Mon, 20 Sep 2021 00:01:41 +0000
2021-09-20 00:01:41 +00:00
||etc1-nnelsai.uriahstevenso3.cn$all
||etc1-nnelsai.vitamacmillan2.cn$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||etc1-nnelsai.xj0c1q.cn$all
Filter updated: Mon, 20 Sep 2021 00:01:41 +0000
2021-09-20 00:01:41 +00:00
||etc1-nnelsai.yahuayelian.cn$all
Filter updated: Tue, 21 Sep 2021 00:01:40 +0000
2021-09-21 00:01:40 +00:00
||etc1-nnelsai.ygj1qi.cn$all
Filter updated: Mon, 20 Sep 2021 00:01:41 +0000
2021-09-20 00:01:41 +00:00
||etc1-nnelsai.yuejinshiye.cn$all
Filter updated: Tue, 21 Sep 2021 00:01:40 +0000
2021-09-21 00:01:40 +00:00
||etc1-nnelsai.yvei8h.cn$all
Filter updated: Mon, 20 Sep 2021 00:01:41 +0000
2021-09-20 00:01:41 +00:00
||etc1-nnelsai.zhaizhenli.cn$all
||etc1-nnelsai.zhugan123.cn$all
||etc1-nnelsai.zzbeatricedupont.cn$all
Filter updated: Wed, 22 Sep 2021 00:02:26 +0000
2021-09-22 00:02:26 +00:00
||etcmeisal.nnuvqee.cn$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||eternityflooringcom-my.sharepoint.com/personal/selena_eternityflooring_com/_layouts/15/doc.aspx?sourcedoc={29a0efff-8f51-40d9-bcd9-4bcf8ae74f33}&action=default&slrid=6b27489f-b027-a000-cb27-3003139f9096&originalpath=ahr0chm6ly9ldgvybml0ewzsb29yaw5ny29tlw15lnnoyxjlcg9pbnquy29tlzpvoi9nl3blcnnvbmfsl3nlbgvuyv9ldgvybml0ewzsb29yaw5nx2nvbs9fdl92b0nsumo5bef2tmxmejryblr6tujpogm4v1nqd3pvbetjlw41q3u3ukrbp3j0aw1lpv91atzqq2pmmtbn&cid=1ad0104b-547c-477b-be5a-854c21f3580b$all
||eternityflooringcom-my.sharepoint.com/personal/selena_eternityflooring_com/_layouts/15/doc.aspx?sourcedoc={29a0efff-8f51-40d9-bcd9-4bcf8ae74f33}&action=default&slrid=9e004d9f-c028-a000-7c23-0d326de333e6&originalpath=ahr0chm6ly9ldgvybml0ewzsb29yaw5ny29tlw15lnnoyxjlcg9pbnquy29tlzpvoi9nl3blcnnvbmfsl3nlbgvuyv9ldgvybml0ewzsb29yaw5nx2nvbs9fdl92b0nsumo5bef2tmxmejryblr6tujpogm4v1nqd3pvbetjlw41q3u3ukrbp3j0aw1lpxozoufndjdxmtbn&cid=502ded77-e010-4694-a1c8-3e651bc6ea9e$all
Filter updated: Mon, 05 Jul 2021 12:02:12 +0000
2021-07-05 12:02:12 +00:00
||ethelpay.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||etrack05.com$all
Filter updated: Sat, 12 Sep 2020 00:07:13 UTC
2020-09-12 00:07:13 +00:00
||eu.nuvuneu.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||eugene-commercial.com$all
Filter updated: Sun, 01 Nov 2020 12:06:58 UTC
2020-11-01 12:06:58 +00:00
||eugnerally-wixsite-com.filesusr.com$all
Filter updated: Fri, 27 Aug 2021 00:01:47 +0000
2021-08-27 00:01:47 +00:00
||euroautomentes.hu$all
Filter updated: Mon, 29 Mar 2021 12:06:44 UTC
2021-03-29 12:06:44 +00:00
||eurobankovnikredit.com/?fbclid=iwar3cu_8pblosqw-rwa7evcrs5jpl6zvzkou0qrf7vl9oqge4h2ctmcxrdyk$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||eusa-lombo.firebaseapp.com$all
Filter updated: Fri, 17 Sep 2021 00:01:45 +0000
2021-09-17 00:01:46 +00:00
||evashoes.com.ua$all
Filter updated: Thu, 14 Jan 2021 12:06:32 UTC
2021-01-14 12:06:32 +00:00
||eve292929.dothome.co.kr$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||eventgratismobilelegend11.duckdns.org$all
Filter updated: Sun, 19 Sep 2021 12:01:34 +0000
2021-09-19 12:01:35 +00:00
||eventshopunipingames.duckdns.org$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||eventsroyalepassmonth.jetos.com$all
Filter updated: Sun, 15 Aug 2021 00:01:57 +0000
2021-08-15 00:01:57 +00:00
||everestmotors.com.np$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||evernote.com/shard/s321/client/snv?noteguid=777735b6-7206-0be1-628f-b095ff26a485&notekey=803670c5e267fe76b14b5c7466cb9dd8&sn=https%3a%2f%2fwww.evernote.com%2fshard%2fs321%2fsh%2f777735b6-7206-0be1-628f-b095ff26a485%2f803670c5e267fe76b14b5c7466cb9dd8&title=you%2bhave%2ba%2bfax%2521%2bcopy%2bcopy$all
||evernote.com/shard/s321/client/snv?noteguid=777735b6-7206-0be1-628f-b095ff26a485&notekey=803670c5e267fe76b14b5c7466cb9dd8&sn=https%3a%2f%2fwww.evernote.com%2fshard%2fs321%2fsh%2f777735b6-7206-0be1-628f-b095ff26a485%2f803670c5e267fe76b14b5c7466cb9dd8&title=you%2bhave%2ba%2bfax%2521%2bcopy%2bcopy$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||evernote.com/shard/s321/sh/9b9c2e56-0df3-1e03-5a66-617cf5ca0041/1153b91b874b7a19b82fe1a3955ecad2$all
Filter updated: Tue, 13 Apr 2021 00:06:31 UTC
2021-04-13 00:06:31 +00:00
||evernote.com/shard/s339/client/snv?noteguid=f48e12fd-48da-e57f-8e76-cdf6e4054e1d&notekey=02a9fa6bd051dc6b4581ee3b617b3f88&sn=https://www.evernote.com/shard/s339/sh/f48e12fd-48da-e57f-8e76-cdf6e4054e1d/02a9fa6bd051dc6b4581ee3b617b3f88&title=optus%20webmail$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||evernote.com/shard/s339/client/snv?noteguid=f48e12fd-48da-e57f-8e76-cdf6e4054e1d&notekey=02a9fa6bd051dc6b4581ee3b617b3f88&sn=https%3a%2f%2fwww.evernote.com%2fshard%2fs339%2fsh%2ff48e12fd-48da-e57f-8e76-cdf6e4054e1d%2f02a9fa6bd051dc6b4581ee3b617b3f88&title=optus%2bwebmail$all
Filter updated: Mon, 15 Mar 2021 12:43:24 UTC
2021-03-15 12:43:24 +00:00
||evernote.com/shard/s339/sh/f48e12fd-48da-e57f-8e76-cdf6e4054e1d/02a9fa6bd051dc6b4581ee3b617b3f88$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||evernote.com/shard/s349/client/snv?noteguid=febdfb3a-d3dc-4087-8cc9-5f87708ee16b&notekey=8ca96608bc2196024b9081f6dcfcfb14&sn=https%3a%2f%2fwww.evernote.com%2fshard%2fs349%2fsh%2ffebdfb3a-d3dc-4087-8cc9-5f87708ee16b%2f8ca96608bc2196024b9081f6dcfcfb14&title=new%2bfax%2bmessage%2breceived%2bcopy$all
||evernote.com/shard/s417/client/snv?noteguid=df310074-30f9-9003-58c2-15885df371d2&notekey=3f0a7060a363b0def315a6d1c98f0a9c&sn=https%3a%2f%2fwww.evernote.com%2fshard%2fs417%2fsh%2fdf310074-30f9-9003-58c2-15885df371d2%2f3f0a7060a363b0def315a6d1c98f0a9c&title=payment%2badvice%252fremittance$all
||evernote.com/shard/s430/client/snv?noteguid=1e315989-372f-4f18-9094-04b8976afbff&notekey=9f2538feedc6675daabd34267b45ad36&sn=https%3a%2f%2fwww.evernote.com%2fshard%2fs430%2fsh%2f1e315989-372f-4f18-9094-04b8976afbff%2f9f2538feedc6675daabd34267b45ad36&title=secured%2bmicrosoft%2bazure%2bfor%2bone%2bdrive%2bcloud%2bcopy$all
||evernote.com/shard/s430/client/snv?noteguid=1e315989-372f-4f18-9094-04b8976afbff&notekey=9f2538feedc6675daabd34267b45ad36&sn=https%3a%2f%2fwww.evernote.com%2fshard%2fs430%2fsh%2f1e315989-372f-4f18-9094-04b8976afbff%2f9f2538feedc6675daabd34267b45ad36&title=secured%2bmicrosoft%2bazure%2bfor%2bone%2bdrive%2bcloud%2bcopy$all
||evernote.com/shard/s446/client/snv?noteguid=483c5f32-f1b7-7c70-925c-47f2705bab52&notekey=911c810bd15ccbd1f19fba1c3e4cc4d5&sn=https%3a%2f%2fwww.evernote.com%2fshard%2fs446%2fsh%2f483c5f32-f1b7-7c70-925c-47f2705bab52%2f911c810bd15ccbd1f19fba1c3e4cc4d5&title=you%2bhave%2breceived%2ban%2binvoice$all
Filter updated: Tue, 13 Apr 2021 00:06:31 UTC
2021-04-13 00:06:31 +00:00
||evernote.com/shard/s446/client/snv?noteguid=4dc119ab-57d6-b8e0-4fcb-c11c0a637b94&notekey=9ddb3753cb700b0c86a78176be71f4f5&sn=https%3a%2f%2fwww.evernote.com%2fshard%2fs446%2fsh%2f4dc119ab-57d6-b8e0-4fcb-c11c0a637b94%2f9ddb3753cb700b0c86a78176be71f4f5&title=you%2bhave%2breceived%2ban%2binvoice.$all
Filter updated: Tue, 01 Dec 2020 12:06:48 UTC
2020-12-01 12:06:48 +00:00
||evernote.com/shard/s446/sh/483c5f32-f1b7-7c70-925c-47f2705bab52/911c810bd15ccbd1f19fba1c3e4cc4d5$all
Filter updated: Tue, 13 Apr 2021 00:06:31 UTC
2021-04-13 00:06:31 +00:00
||evernote.com/shard/s446/sh/4dc119ab-57d6-b8e0-4fcb-c11c0a637b94/9ddb3753cb700b0c86a78176be71f4f5$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||evernote.com/shard/s661/client/snv?noteguid=bb8d3313-c8e9-0ead-34c7-0a149c4fd42d&notekey=f25f8be6665ac7e37aff532080567fab&sn=https%3a%2f%2fwww.evernote.com%2fshard%2fs661%2fsh%2fbb8d3313-c8e9-0ead-34c7-0a149c4fd42d%2ff25f8be6665ac7e37aff532080567fab&title=you%2bhave%2breceived%2ba%2bsecure%2bdocument%2bvia%2bonedrive.$all
||evernote.com/shard/s672/client/snv?noteguid=b30b4b36-5bf9-846c-0577-bbb0c4439efc&notekey=2f0f6f89194031fabbc3b4a455071a64&sn=https%3a%2f%2fwww.evernote.com%2fshard%2fs672%2fsh%2fb30b4b36-5bf9-846c-0577-bbb0c4439efc%2f2f0f6f89194031fabbc3b4a455071a64&title=microsoft%2boffice365$all
||evernote.com/shard/s740/client/snv?noteguid=6dd4c982-2f3f-7d83-4e18-5e028127e7d1&notekey=399d3f6c5e422fb90527fefea85cfc44&sn=https%3a%2f%2fwww.evernote.com%2fshard%2fs740%2fsh%2f6dd4c982-2f3f-7d83-4e18-5e028127e7d1%2f399d3f6c5e422fb90527fefea85cfc44&title=initial%2bpage$all
Filter updated: Thu, 02 Sep 2021 12:02:02 +0000
2021-09-02 12:02:02 +00:00
||evershineenterprises.co.in$all
Filter updated: Tue, 08 Jun 2021 12:06:44 UTC
2021-06-08 12:06:44 +00:00
||evershineuae.net$all
Filter updated: Tue, 07 Sep 2021 12:01:49 +0000
2021-09-07 12:01:49 +00:00
||everythingmobilelimited-my.sharepoint.com/personal/jameswaterston_everythingmobilelimited_onmicrosoft_com/_layouts/15/onedrive.aspx$all
Filter updated: Thu, 08 Jul 2021 00:02:02 +0000
2021-07-08 00:02:02 +00:00
||everythingmobilelimited-my.sharepoint.com/personal/jameswaterston_everythingmobilelimited_onmicrosoft_com/_layouts/15/onedrive.aspx?id=/personal/jameswaterston_everythingmobilelimited_onmicrosoft_com/documents/new%20project.pdf&parent=/personal/jameswaterston_everythingmobilelimited_onmicrosoft_com/documents&originalpath=ahr0chm6ly9ldmvyexroaw5nbw9iawxlbgltaxrlzc1tes5zagfyzxbvaw50lmnvbs86yjovzy9wzxjzb25hbc9qyw1lc3dhdgvyc3rvbl9ldmvyexroaw5nbw9iawxlbgltaxrlzf9vbm1py3jvc29mdf9jb20vrvdlwwrbqvrqvzlqz0nvvjhmlwvavdrcc3lhv3rndhpvvfbla01pdfdkqnnzut9ydgltzt1ouuvztxjrudjvzw$all
Filter updated: Tue, 16 Feb 2021 00:06:20 UTC
2021-02-16 00:06:20 +00:00
||evotechss.com$all
Filter updated: Tue, 21 Sep 2021 00:01:40 +0000
2021-09-21 00:01:40 +00:00
||ewroiuwogdsljgsjfdoguraoie.xyz$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||ex-m-0.web.app$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||examinacion78.byethost31.com$all
Filter updated: Tue, 07 Sep 2021 12:01:49 +0000
2021-09-07 12:01:49 +00:00
||excelelectrical0-my.sharepoint.com/personal/tim_hansen_excelelectrical_com/_layouts/15/onedrive.aspx?id=/personal/tim_hansen_excelelectrical_com/documents/open%20to%20view%20shared%20document%20in%20hitech%20sharepoint&originalpath=ahr0chm6ly9legnlbgvszwn0cmljywwwlw15lnnoyxjlcg9pbnquy29tlzpmoi9nl3blcnnvbmfsl3rpbv9oyw5zzw5fzxhjzwxlbgvjdhjpy2fsx2nvbs9fa2zoazdydndfaettvl9pwulkctdzmejlveeyr3awzwjnsdfkrgdjrfdfttznp3j0aw1lpunrvevzrwxcmlvn$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||exchange.pancakeswap.finances.barntochef.com$all
Filter updated: Wed, 22 Sep 2021 12:01:56 +0000
2021-09-22 12:01:56 +00:00
||exchange.pancakeswap.finances.clanventure.com$all
Filter updated: Wed, 24 Mar 2021 00:06:36 UTC
2021-03-24 00:06:36 +00:00
||exchange4free.com$all
Filter updated: Thu, 03 Sep 2020 12:06:37 UTC
2020-09-03 12:06:37 +00:00
||exchangedictionary.com$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||exclusivegearsbd.com/https/181.58.39.1984341/sucursalpersonas.transaccionesbancolombia.com/mua/index.html$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||exhibition-really-platinum-seminar.trycloudflare.com$all
Filter updated: Sat, 18 Sep 2021 12:01:34 +0000
2021-09-18 12:01:34 +00:00
||exit-coin.com$all
Filter updated: Wed, 15 Sep 2021 12:01:46 +0000
2021-09-15 12:01:46 +00:00
||exobus.net$all
Filter updated: Thu, 23 Sep 2021 00:02:18 +0000
2021-09-23 00:02:18 +00:00
||exods.online$all
Filter updated: Thu, 08 Jul 2021 00:02:02 +0000
2021-07-08 00:02:02 +00:00
||exodus-airdrop.com$all
Filter updated: Thu, 03 Sep 2020 12:06:37 UTC
2020-09-03 12:06:37 +00:00
||exodus-staking.web.app$all
Filter updated: Sun, 30 May 2021 12:06:22 UTC
2021-05-30 12:06:22 +00:00
||exodusc.com$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||exodusl.com$all
Filter updated: Thu, 08 Jul 2021 00:02:02 +0000
2021-07-08 00:02:02 +00:00
||exoduswl.com$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||exodvsweb.com$all
Filter updated: Sun, 04 Apr 2021 12:06:34 UTC
2021-04-04 12:06:34 +00:00
||exosomes.sale$all
Filter updated: Wed, 15 Sep 2021 12:01:46 +0000
2021-09-15 12:01:46 +00:00
||exoticautowa.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||expeditions-of-e.com$all
Filter updated: Wed, 15 Sep 2021 12:01:46 +0000
2021-09-15 12:01:46 +00:00
||expenseeraser.com$all
Filter updated: Wed, 17 Feb 2021 00:06:37 UTC
2021-02-17 00:06:37 +00:00
||expire-o2-billingupdate.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||explorebathurst.com.au/rrefeeieoj.html?erectrcsq@*cthiytvcdx$zsxycuikjmkjivee$terdtygjyvtrre$all
Filter updated: Mon, 13 Sep 2021 12:01:52 +0000
2021-09-13 12:01:52 +00:00
||exproofpoint.com/imct.nerb/inac.php$all
Filter updated: Wed, 04 Aug 2021 12:01:54 +0000
2021-08-04 12:01:54 +00:00
||extension-metamask.com.rstebet.co.id$all
Filter updated: Thu, 16 Sep 2021 00:01:52 +0000
2021-09-16 00:01:52 +00:00
||extension.asue.am$all
Filter updated: Fri, 19 Mar 2021 12:06:36 UTC
2021-03-19 12:06:36 +00:00
||extracash-interlbankonline.com$all
Filter updated: Thu, 02 Sep 2021 00:01:59 +0000
2021-09-02 00:01:59 +00:00
||extracloud.com.au$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||extravasatingmetalworker.com$all
Filter updated: Fri, 11 Jun 2021 00:06:40 UTC
2021-06-11 00:06:40 +00:00
||exunbiocell.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||ey8jl.csb.app$all
||eye-lucir.com$all
Filter updated: Mon, 08 Feb 2021 12:09:02 UTC
2021-02-08 12:09:02 +00:00
||ezapostille.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||ezblox.site$all
Filter updated: Fri, 30 Jul 2021 00:01:47 +0000
2021-07-30 00:01:47 +00:00
||ezssausage.com$all
Filter updated: Fri, 16 Jul 2021 12:01:57 +0000
2021-07-16 12:01:57 +00:00
||f.ls$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||f002.backblazeb2.com/file/frontend3/index.html$all
Filter updated: Fri, 04 Dec 2020 00:06:15 UTC
2020-12-04 00:06:16 +00:00
||f6fr7.codesandbox.io$all
Filter updated: Sat, 27 Feb 2021 12:09:09 UTC
2021-02-27 12:09:09 +00:00
||f9w1lned0ruqblxi6jahwotak.filesusr.com$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||fabiasurgical.com/cot/home/myaccount/billing.php?websrc=e17ea285ad581008aac6b89b49ab879e&dispatched=68&id=4976600593$all
Filter updated: Fri, 19 Mar 2021 12:06:36 UTC
2021-03-19 12:06:36 +00:00
||facabook.in$all
Filter updated: Fri, 13 Aug 2021 12:01:44 +0000
2021-08-13 12:01:44 +00:00
||facbuck.com$all
Filter updated: Fri, 13 Nov 2020 00:06:21 UTC
2020-11-13 00:06:21 +00:00
||facealert.fr$all
Filter updated: Thu, 19 Aug 2021 00:01:47 +0000
2021-08-19 00:01:47 +00:00
||faceb00k.thrillsnation.com$all
Filter updated: Mon, 16 Nov 2020 00:06:15 UTC
2020-11-16 00:06:16 +00:00
||facebook-login.tbit.vn$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||facebook-validation-check.ml$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||facebook.com-29ta3qbv.isiolo.go.ke$all
||facebook.com-67mlpjqszh.isiolo.go.ke$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||facebook.com-marketplace-93839.mediaryte.co$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||facebook.com-z1au8cxghl.isiolo.go.ke$all
||facebook.com-zj07679bw4.isiolo.go.ke$all
Filter updated: Mon, 05 Apr 2021 12:06:40 UTC
2021-04-05 12:06:40 +00:00
||facebook.eventspinff.wtf$all
Filter updated: Wed, 30 Sep 2020 00:06:34 UTC
2020-09-30 00:06:35 +00:00
||facebook.hrbureaugh.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||facebookapp-terminal-annulla-la-richiesta-di-disattivazione.com$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||facebookbusinessaccount.binamulle.com$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||faceibookii.blogspot.com$all
Filter updated: Wed, 04 Aug 2021 12:01:54 +0000
2021-08-04 12:01:54 +00:00
||factoryrider.com$all
Filter updated: Wed, 21 Jul 2021 00:01:57 +0000
2021-07-21 00:01:57 +00:00
||facturard.com$all
Filter updated: Sat, 01 May 2021 12:06:37 UTC
2021-05-01 12:06:37 +00:00
||faithcitychapel.org$all
Filter updated: Thu, 15 Jul 2021 12:01:53 +0000
2021-07-15 12:01:53 +00:00
||faizankhan0408.github.io$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||faktura-share.duckdns.org$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||faktypolska7.b-cdn.net$all
||faleupas.kissr.com$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||famecala.com$all
Filter updated: Wed, 15 Sep 2021 12:01:46 +0000
2021-09-15 12:01:46 +00:00
||famiecomea.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||fanage9972.temp.swtest.ru$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||fancanseda.com$all
Filter updated: Fri, 24 Sep 2021 00:01:50 +0000
2021-09-24 00:01:51 +00:00
||fancycricket11.com$all
Filter updated: Wed, 15 Sep 2021 12:01:46 +0000
2021-09-15 12:01:46 +00:00
||fandeoma.com$all
Filter updated: Mon, 20 Sep 2021 12:02:05 +0000
2021-09-20 12:02:05 +00:00
||fandocean.com$all
Filter updated: Wed, 15 Sep 2021 12:01:46 +0000
2021-09-15 12:01:46 +00:00
||fantameca.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||fanxtv.info$all
Filter updated: Sat, 07 Aug 2021 00:20:48 +0000
2021-08-07 00:20:48 +00:00
||farmaclub.com.ec$all
Filter updated: Fri, 27 Aug 2021 00:01:47 +0000
2021-08-27 00:01:47 +00:00
||fascinatingquick.top$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||fashionphotographycourse.com$all
Filter updated: Fri, 02 Jul 2021 00:01:50 +0000
2021-07-02 00:01:51 +00:00
||fasthost.hk$all
Filter updated: Sat, 17 Jul 2021 00:01:47 +0000
2021-07-17 00:01:47 +00:00
||fastskins.ru.com$all
Filter updated: Wed, 16 Jun 2021 12:06:46 +0000
2021-06-16 12:06:46 +00:00
||fastupload.ybjcsoft.com/login.paypal/wnjblmdk=/index.php$all
Filter updated: Fri, 27 Aug 2021 00:01:47 +0000
2021-08-27 00:01:47 +00:00
||fastupload.ybjcsoft.com/login.paypal/wnjblmdk=/index.php...$all
Filter updated: Thu, 20 May 2021 12:06:36 UTC
2021-05-20 12:06:36 +00:00
||fatura-digitalhiiper.net$all
Filter updated: Thu, 08 Jul 2021 00:02:02 +0000
2021-07-08 00:02:02 +00:00
||fatura-hiiiper-digital.net$all
Filter updated: Mon, 24 May 2021 00:06:37 UTC
2021-05-24 00:06:37 +00:00
||faturadigiital-hiper.net$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||fax.gruppobiesse.it$all
||faxitalia.com$all
Filter updated: Fri, 24 Sep 2021 00:01:50 +0000
2021-09-24 00:01:51 +00:00
||fb-privacy-help-10000001234598695868715.tk$all
Filter updated: Wed, 22 Sep 2021 12:01:56 +0000
2021-09-22 12:01:56 +00:00
||fb-privacy-help-1000011234507980591407067.tk$all
Filter updated: Thu, 23 Sep 2021 00:02:18 +0000
2021-09-23 00:02:18 +00:00
||fb-recovery-help-100000012345986958190.ml$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||fb-security-help-10000001234598695868746.tk$all
||fb-security-help-10000001234598695868748.tk$all
||fb-security-help-10000001234598695868749.tk$all
Filter updated: Thu, 23 Sep 2021 00:02:18 +0000
2021-09-23 00:02:18 +00:00
||fb-verified-account2903283.smpn3sk.sch.id$all
Filter updated: Thu, 01 Apr 2021 00:06:39 UTC
2021-04-01 00:06:40 +00:00
||fb.expressturkeyi.com$all
Filter updated: Sat, 27 Mar 2021 00:06:27 UTC
2021-03-27 00:06:27 +00:00
||fb.probox.lk$all
Filter updated: Sun, 15 Aug 2021 00:01:57 +0000
2021-08-15 00:01:57 +00:00
||fb7927.bget.ru$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||fbads.idei.or.id/campaign/manager/id/57121900/$all
Filter updated: Thu, 20 May 2021 12:06:36 UTC
2021-05-20 12:06:36 +00:00
||fbcom-2oemj4g3j.streamsteam.ca$all
||fbcom-39jq7lml83.streamsteam.ca$all
||fbcom-3ro3nng7.streamsteam.ca$all
Filter updated: Thu, 24 Jun 2021 00:06:35 +0000
2021-06-24 00:06:35 +00:00
||fbcom-461utr3op.streamsteam.ca$all
Filter updated: Tue, 11 May 2021 00:06:39 UTC
2021-05-11 00:06:40 +00:00
||fbcom-7pt7rdqfb8.streamsteam.ca$all
||fbcom-8mqggv786m.streamsteam.ca$all
Filter updated: Thu, 20 May 2021 12:06:36 UTC
2021-05-20 12:06:36 +00:00
||fbcom-cq1nduup95.streamsteam.ca$all
Filter updated: Tue, 07 Sep 2021 12:01:49 +0000
2021-09-07 12:01:49 +00:00
||fbcom-lkt6sgmqe.streamsteam.ca$all
Filter updated: Thu, 24 Jun 2021 00:06:35 +0000
2021-06-24 00:06:35 +00:00
||fbcom-pwtdp8c3i.streamsteam.ca$all
Filter updated: Tue, 07 Sep 2021 12:01:49 +0000
2021-09-07 12:01:49 +00:00
||fbcom-shlb2vg1hx.streamsteam.ca$all
Filter updated: Tue, 11 May 2021 00:06:39 UTC
2021-05-11 00:06:40 +00:00
||fbcom-wtcsucu1.streamsteam.ca$all
Filter updated: Wed, 01 Sep 2021 12:01:58 +0000
2021-09-01 12:01:58 +00:00
||fbcom-z1tfm09d.streamsteam.ca$all
Filter updated: Thu, 23 Sep 2021 00:02:18 +0000
2021-09-23 00:02:18 +00:00
||fbead23swus.gb.net$all
Filter updated: Tue, 27 Jul 2021 12:01:59 +0000
2021-07-27 12:01:59 +00:00
||fbforpages1414141.web.app$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||fbforpages1848151.web.app$all
Filter updated: Thu, 08 Apr 2021 00:06:59 UTC
2021-04-08 00:06:59 +00:00
||fbpages-claim-center.my.id$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||fbscmaintennsconffrim.tk$all
||fda-lat-played-let.trycloudflare.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||fdx.co.th$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||feceboolk.blogspot.com$all
Filter updated: Sat, 17 Apr 2021 00:06:31 UTC
2021-04-17 00:06:31 +00:00
||federalaccesscredit.com$all
Filter updated: Fri, 17 Sep 2021 00:01:45 +0000
2021-09-17 00:01:46 +00:00
||fedexdelivery.drm.com.ng$all
Filter updated: Wed, 22 Sep 2021 12:01:56 +0000
2021-09-22 12:01:56 +00:00
||fedexoutdelivery.page.link$all
Filter updated: Fri, 17 Sep 2021 00:01:45 +0000
2021-09-17 00:01:46 +00:00
||fedextrackingonlinedelivery.drm.com.ng$all
Filter updated: Mon, 19 Oct 2020 12:06:35 UTC
2020-10-19 12:06:35 +00:00
||fedexvoyager.com$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||fediburgame.com$all
Filter updated: Sun, 21 Feb 2021 12:06:45 UTC
2021-02-21 12:06:45 +00:00
||fedner.net$all
Filter updated: Sat, 17 Oct 2020 12:06:37 UTC
2020-10-17 12:06:37 +00:00
||feedilicious.com$all
Filter updated: Mon, 20 Sep 2021 12:02:05 +0000
2021-09-20 12:02:05 +00:00
||feedlot.com.ar/to/authorize_client_id:hl2je3nc-o128-ifbd-t1kn-yakh3ls509pf_p1wi6no4rzlmsg29c30ftyjbdxhk78v5ueaqj2z0bpownumratv59xs6e713dg8h4lckfqiy4fzwtgs8x12dqjrc6aoik73hvpeum05blyn9?data=&email=info@tamarackpipeline.com$all
Filter updated: Tue, 22 Jun 2021 12:06:51 +0000
2021-06-22 12:06:51 +00:00
||feedproxy.google.com/~r/lnqsfxqwsed/~3/yywjpi-42i4/analog.php$all
||feedproxy.google.com/~r/spqgxlzjlss/~3/byf895vf6tk/nutrition.php$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||feeds.feedburner.com/investorway$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||feeffegrrgrg.000webhostapp.com$all
Filter updated: Wed, 01 Sep 2021 12:01:58 +0000
2021-09-01 12:01:58 +00:00
||felipecostta94.github.io$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||fene-modi.firebaseapp.com$all
Filter updated: Sun, 20 Dec 2020 12:06:45 UTC
2020-12-20 12:06:45 +00:00
||ferienhof-gempel.de$all
Filter updated: Thu, 23 Sep 2021 00:02:18 +0000
2021-09-23 00:02:18 +00:00
||ferrariparts4less.com$all
Filter updated: Thu, 02 Sep 2021 00:01:59 +0000
2021-09-02 00:01:59 +00:00
||ffcs.com.pk$all
Filter updated: Wed, 28 Jul 2021 12:01:46 +0000
2021-07-28 12:01:46 +00:00
||fgebhyvqzntgkerjdihuoxquhi-dot-gowa11111111.rj.r.appspot.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||fghjr74rhudfguhtfguji.blogspot.com$all
Filter updated: Wed, 11 Aug 2021 00:01:55 +0000
2021-08-11 00:01:55 +00:00
||fgts2021.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||fhhw1u.webwave.dev$all
Filter updated: Sat, 11 Sep 2021 12:01:27 +0000
2021-09-11 12:01:27 +00:00
||fianceflowers.ir$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||fiestanube.com.ar$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||fifohbibou.blogspot.com$all
Filter updated: Fri, 19 Feb 2021 00:06:27 UTC
2021-02-19 00:06:28 +00:00
||fifohbibou.blogspot.com/?m=1$all
Filter updated: Wed, 22 Sep 2021 00:02:26 +0000
2021-09-22 00:02:26 +00:00
||fileundelete.net$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||filsafat.stahnmpukuturan.ac.id$all
Filter updated: Fri, 03 Sep 2021 00:01:54 +0000
2021-09-03 00:01:55 +00:00
||filtrosmil.com.br$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||financiallifecoaching.builderallwp.com$all
||financialone.com.hk$all
Filter updated: Wed, 17 Mar 2021 12:07:39 UTC
2021-03-17 12:07:39 +00:00
||financieracredicorpltda.com$all
Filter updated: Wed, 05 May 2021 12:12:51 UTC
2021-05-05 12:12:51 +00:00
||findmy-support-icloud.com$all
Filter updated: Fri, 30 Apr 2021 00:08:30 UTC
2021-04-30 00:08:30 +00:00
||findrealtors.tv$all
Filter updated: Fri, 18 Sep 2020 00:06:21 UTC
2020-09-18 00:06:21 +00:00
||findurway.tech$all
Filter updated: Wed, 15 Sep 2021 12:01:46 +0000
2021-09-15 12:01:46 +00:00
||finplustechnology.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||firebasestorage.googleapis.com/v0/b/achproject509353-i353-3ih5f-10.appspot.com/o/achbf-vye-ur-g8%252fbv-ebry-8g%252fbf-vye-ur-g8%252fbv-ebry-8g%25%40fabf-vye-ur-g8%252fbv-ebry-8g10.html?alt=media&token=cf886132-ee55-43e8-9d0f-a6dbb7ba590a#$all
||firebasestorage.googleapis.com/v0/b/armaoffices.appspot.com/o/fdsklxrsqgdkqrwszsprjmbwtftqgpthwjwqjvvzscstgnmcvbblfcbcgwzjjbt.htm?alt=media&token=e3feec53-9d57-4eff-9b7a-d58e91e54d4c#user@domain.com$all
Filter updated: Wed, 22 Sep 2021 12:01:56 +0000
2021-09-22 12:01:56 +00:00
||firebasestorage.googleapis.com/v0/b/asno-ec966.appspot.com/o/dhl-new-hash.html?alt=media&token=fba9bf90-b41c-48e5-9f47-eee71a69b049$all
Filter updated: Tue, 25 May 2021 12:06:34 UTC
2021-05-25 12:06:34 +00:00
||firebasestorage.googleapis.com/v0/b/bet2604ver.appspot.com/o/bet2604ver%2findex2bat904rff27dcf22a2ea9163406004.html?alt=media&token=e70fe211-f84a-4ae7-a4d0-c9376ee4cf57#$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||firebasestorage.googleapis.com/v0/b/biyugbhiuhgy7o900-h9oh98h9-987.appspot.com/o/vnmbvuyt8-8y98yh0%3d890y8iuh9yyh%2f5rtyfghtfyu67-9876trfc%3d9ygv.htm?alt=media&token=dce6f041-19ff-4e8a-8012-1cfdac4cf369#bv@pplsi.com$all
Filter updated: Thu, 19 Aug 2021 12:02:33 +0000
2021-08-19 12:02:33 +00:00
||firebasestorage.googleapis.com/v0/b/bmvfhjewter358bsvgtst.appspot.com/o/!%40%25%24%23ohow2%26%25%26%24%23!%23%24!.html?alt=media&token=a7216a8f-9691-45b2-9775-693dd99503e8#randyharp@prepaidlegal.com$all
Filter updated: Fri, 25 Sep 2020 12:06:47 UTC
2020-09-25 12:06:47 +00:00
||firebasestorage.googleapis.com/v0/b/bnnnnnn-2133f.appspot.com/o/sboy.htm?alt=media&token=4b58a3ec-3a18-4152-a41f-55a89a34d017&login$all
Filter updated: Tue, 20 Jul 2021 12:01:48 +0000
2021-07-20 12:01:48 +00:00
||firebasestorage.googleapis.com/v0/b/bus0607clougensatem.appspot.com/o/bus0607clougen%2findex2bus0607447d066cb774.html?alt=media&token=5baac3e2-5da8-4153-86b4-8971a2ac5892#banko@10acrewood.com$all
Filter updated: Sun, 15 Aug 2021 12:01:40 +0000
2021-08-15 12:01:40 +00:00
||firebasestorage.googleapis.com/v0/b/car2-2004crgpng.appspot.com/o/index2ibicar.html?alt=media&token=9c9647f6-f132-4e13-8ad4-c44765b9133e#abuse@google.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||firebasestorage.googleapis.com/v0/b/ceoagogo-76923.appspot.com/o/owa20934856%2findex.html?alt=media&token=7a9d6756-93f2-499f-9f94-a9aaa3c5dd51#reima.helminen@utu.fi$all
||firebasestorage.googleapis.com/v0/b/ceoagogo-76923.appspot.com/o/owa20934856%2findex.html?alt=media&token=7a9d6756-93f2-499f-9f94-a9aaa3c5dd51#service.itz@zhdk.ch$all
Filter updated: Sat, 21 Aug 2021 00:01:53 +0000
2021-08-21 00:01:54 +00:00
||firebasestorage.googleapis.com/v0/b/cjrnpslmbkmsnnffjnjjxzdf7.appspot.com/o/zgcgqzdmsmjflxmbbphppxtfvdcg%20(7).html?alt=media&token=420eab1e-153e-406c-a171-b7ab2ba04864$all
Filter updated: Wed, 25 Aug 2021 12:02:06 +0000
2021-08-25 12:02:07 +00:00
||firebasestorage.googleapis.com/v0/b/cphost-c0a1c.appspot.com/o/cig%2fc0a1c.appspot.com%2fv0%2fcpanel%2fumd-popper.min%2finbox%2fsha384-kj3o2dktikv%2fo%2findex2.html?alt=media&token=7ecda91c-77a0-4374-89b1-8b2a96e022fc#@yorku.ca$all
Filter updated: Tue, 06 Jul 2021 00:01:42 +0000
2021-07-06 00:01:42 +00:00
||firebasestorage.googleapis.com/v0/b/dam3005genwtbgfam.appspot.com/o/reddam0806%2flag0806famegen-040447d066cb774f1.html?alt=media&token=f1dd8ee6-33f2-4149-93f7-3db577373528#dickfleming@prepaidlegal.com$all
Filter updated: Mon, 16 Aug 2021 00:01:59 +0000
2021-08-16 00:01:59 +00:00
||firebasestorage.googleapis.com/v0/b/dfhdskfkgkrgr8zrhrthrdrdh.appspot.com/o/!%23%24%26%25%24%23bn3%23%24!%26%25%24.html?alt=media&token=311bb9c7-ae6f-40e9-96e3-a06e7bccfa0e#viestinta@utu.fi$all
Filter updated: Wed, 07 Apr 2021 12:23:11 UTC
2021-04-07 12:23:12 +00:00
||firebasestorage.googleapis.com/v0/b/dr-clin-c4f68.appspot.com/o/drweb.html?alt=media&token=09293ba9-0738-41ea-9cf3-67cb43af2b88&x=famacas-cfa0appspotappspotmacas-macas-vfwefsaxsppspotcfa0ps&prox=p2000isolation@aaa.kr$all
Filter updated: Sat, 13 Mar 2021 00:09:54 UTC
2021-03-13 00:09:54 +00:00
||firebasestorage.googleapis.com/v0/b/dr-clin-c4f68.appspot.com/o/drweb.html?alt=media&token=09293ba9-0738-41ea-9cf3-67cb43af2b88&x=famacas-cfa0appspotappspotmacas-macas-vfwefsaxsppspotcfa0ps&prox=yourname@yourcompany.com$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||firebasestorage.googleapis.com/v0/b/elprofessor0fficerd85.appspot.com/o/thankyou.html?alt=media&token=97df93ad-fb68-4c09-b6c1-90ed6dfdf02e$all
Filter updated: Sat, 07 Aug 2021 12:01:40 +0000
2021-08-07 12:01:40 +00:00
||firebasestorage.googleapis.com/v0/b/emailserver-6b445.appspot.com/o/shared%2fassignments%2fwebsite%2fg63%2fg63%20all%2findex.html?alt=media&token=077a9af1-5fc3-4ab8-974a-a2274660d199#absa.kenya@absa.africa$all
Filter updated: Mon, 19 Jul 2021 00:01:54 +0000
2021-07-19 00:01:54 +00:00
||firebasestorage.googleapis.com/v0/b/emailserver-6b445.appspot.com/o/shared%2fassignments%2fwebsite%2fg63%2fg63%20all%2findex.html?alt=media&token=077a9af1-5fc3-4ab8-974a-a2274660d199#abc@abc?email=abc@abc$all
Filter updated: Sat, 19 Dec 2020 12:06:36 UTC
2020-12-19 12:06:36 +00:00
||firebasestorage.googleapis.com/v0/b/goo2-ac630.appspot.com/o/goo (2).html?alt=media&token=2d1281a2-3364-420f-a3b5-c693b7bda1f2#a@b.com$all
Filter updated: Wed, 25 Aug 2021 12:02:06 +0000
2021-08-25 12:02:07 +00:00
||firebasestorage.googleapis.com/v0/b/gsdffdwatdfwdadddadsgd.appspot.com/o/!%23%24%40%26buli%24!%40%26!%40%23%24!%26.html?alt=media&token=110228a1-3566-41ef-b241-427ad3b25a9f#aaronfredricks@legalshield.com$all
Filter updated: Wed, 11 Nov 2020 12:06:45 UTC
2020-11-11 12:06:45 +00:00
||firebasestorage.googleapis.com/v0/b/hing9-f9bc0.appspot.com/o/hi1 (9).html?alt=media&token=0d56c7d7-2e03-41f5-b764-4473f0ad4d51#a@b.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||firebasestorage.googleapis.com/v0/b/hoihio-f6e0d.appspot.com/o/wwuihoihoiwwwjjjhjkj.html?alt=media&token=a4b10bbb-6e16-485e-a010-adaa8b5b31cb$all
Filter updated: Sat, 18 Sep 2021 12:01:34 +0000
2021-09-18 12:01:34 +00:00
||firebasestorage.googleapis.com/v0/b/hutobonmu7g.appspot.com/o/butokilopo.html?alt=media&token=6b98d9bd-5513-45d3-ab8a-e46571a70ee4#user@example.org$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||firebasestorage.googleapis.com/v0/b/king-706ff.appspot.com/o/index.htm?alt=media&token=bb50594a-96ca-4e68-a38c-fdcd32076a2c$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||firebasestorage.googleapis.com/v0/b/lines-c8ae9.appspot.com/o/webmail_login.html?alt=media&token=8d06efff-8a8b-406d-bf41-edff2e36b932#raymondtripp@prepaidlegal.com$all
Filter updated: Thu, 03 Sep 2020 12:06:37 UTC
2020-09-03 12:06:37 +00:00
||firebasestorage.googleapis.com/v0/b/lines-c8ae9.appspot.com/o/webmail_login.html?alt=media&token=8d06efff-8a8b-406d-bf41-edff2e36b932$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||firebasestorage.googleapis.com/v0/b/macryti-109.appspot.com/o/kp-oe0%2fbtt-hash.html?alt=media&token=02abe8bd-5141-4b5a-a7d4-08120e5f43dd#choiteng@motenghaiplc.com$all
Filter updated: Mon, 05 Jul 2021 12:02:12 +0000
2021-07-05 12:02:12 +00:00
||firebasestorage.googleapis.com/v0/b/mail9-e6376.appspot.com/o/index.html?alt=media&token=f619a1f5-b1a4-4b63-9d00-6df1874c4b1b#memberservices@legalshield.com$all
Filter updated: Fri, 06 Nov 2020 12:06:28 UTC
2020-11-06 12:06:28 +00:00
||firebasestorage.googleapis.com/v0/b/master-a7f25.appspot.com/o/cerkcfroek.html?alt=media&token=420caa32-915f-40c5-86a6-28ada5625a7a&prox=eimaste@stinpriza.org$all
Filter updated: Fri, 27 Nov 2020 12:06:59 UTC
2020-11-27 12:06:59 +00:00
||firebasestorage.googleapis.com/v0/b/master-a7f25.appspot.com/o/cerkcfroek.html?alt=media&token=420caa32-915f-40c5-86a6-28ada5625a7a&prox=eimaste@stinpriza.org$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||firebasestorage.googleapis.com/v0/b/mic-apps03629.appspot.com/o/index.html?alt=media&token=d9f4f11c-e123-4b2b-8cba-b4f3f3541786#peterawl@prepaidlegal.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||firebasestorage.googleapis.com/v0/b/mon-office.appspot.com/o/mscsq1-t-check-packet.htm?alt=media&token=72ab1aeb-a7a9-4a84-9852-099a56ca500e#dxnlckblegftcgxllm9yzw$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||firebasestorage.googleapis.com/v0/b/newiffh.appspot.com/o/eghhd.html?alt=media&token=5e6721e5-8e30-48ea-878e-627f61f2aac5$all
Filter updated: Tue, 13 Apr 2021 00:06:31 UTC
2021-04-13 00:06:31 +00:00
||firebasestorage.googleapis.com/v0/b/ntachi-e1dbe.appspot.com/o/hgigieiciejceinhviejrie95489349%20(19).html?alt=media&token=5901e369-e71e-416b-9688-b21c62e31587#m.couvee@colasit.nl$all
Filter updated: Sun, 11 Oct 2020 00:07:18 UTC
2020-10-11 00:07:18 +00:00
||firebasestorage.googleapis.com/v0/b/on1rt-44071.appspot.com/o/index.html?alt=media&token=0d469e93-836b-4af8-b206-16a5d882d556#abuse@fasthosts.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||firebasestorage.googleapis.com/v0/b/onlineupdatebase3456.appspot.com/o/sm123%2findex.htm?alt=media&token=158cbd55-4c67-4ef6-b13f-d69aba854f3a#aaaa@example.jp$all
||firebasestorage.googleapis.com/v0/b/onlineupdatebase3456.appspot.com/o/sm123%2findex.htm?alt=media&token=158cbd55-4c67-4ef6-b13f-d69aba854f3a#fgsnews@yorku.ca$all
||firebasestorage.googleapis.com/v0/b/onlineupdatebase3456.appspot.com/o/sm123%2findex.htm?alt=media&token=158cbd55-4c67-4ef6-b13f-d69aba854f3a#test@test.de$all
||firebasestorage.googleapis.com/v0/b/onlineupdatebase3456.appspot.com/o/sm123%2findex.htm?alt=media&token=158cbd55-4c67-4ef6-b13f-d69aba854f3a#test@test.test$all
||firebasestorage.googleapis.com/v0/b/onlineupdatebase3456.appspot.com/o/sm123%2findex.htm?alt=media&token=158cbd55-4c67-4ef6-b13f-d69aba854f3a#vid@yorku.ca$all
||firebasestorage.googleapis.com/v0/b/onlineupdatebase3456.appspot.com/o/sm123%2findex.htm?alt=media&token=158cbd55-4c67-4ef6-b13f-d69aba854f3a$all
||firebasestorage.googleapis.com/v0/b/onlineupdatebase3456.appspot.com/o/sm123%2findex.htm?alt=media&token=158cbd55-4c67-4ef6-b13f-d69aba854f3a#kbaesler@bellsouth.net$all
||firebasestorage.googleapis.com/v0/b/onlineupdatebase3456.appspot.com/o/sm123%2findex.htm?alt=media&token=158cbd55-4c67-4ef6-b13f-d69aba854f3a#landman56@att.net$all
||firebasestorage.googleapis.com/v0/b/onlineupdatebase3456.appspot.com/o/sm123%2findex.htm?alt=media&token=158cbd55-4c67-4ef6-b13f-d69aba854f3a#sdeco@prodigy.net$all
||firebasestorage.googleapis.com/v0/b/onlineupdatebase3456.appspot.com/o/sm123%2findex.htm?alt=media&token=158cbd55-4c67-4ef6-b13f-d69aba854f3a$all
||firebasestorage.googleapis.com/v0/b/onlineupdatebase3456.appspot.com/o/tb%2findex.htm?alt=media&token=8176e96d-c102-4018-9888-17d4dec8d489#$all
||firebasestorage.googleapis.com/v0/b/onlineupdatebase3456.appspot.com/o/web123%2findex.htm?alt=media&token=442069a5-b026-42a7-bcea-e6d92963d1d3$all
Filter updated: Wed, 25 Aug 2021 12:02:06 +0000
2021-08-25 12:02:07 +00:00
||firebasestorage.googleapis.com/v0/b/ord0907clogensatm.appspot.com/o/index2ord0907447d066cb774.html?alt=media&token=2ce10760-9073-4421-8b15-4de88b7b3fdb#bb@bb.com.br$all
||firebasestorage.googleapis.com/v0/b/ord0907clogensatm.appspot.com/o/index2ord0907447d066cb774.html?alt=media&token=2ce10760-9073-4421-8b15-4de88b7b3fdb#eafaef@eafaef.com.br$all
Filter updated: Thu, 12 Aug 2021 12:01:52 +0000
2021-08-12 12:01:53 +00:00
||firebasestorage.googleapis.com/v0/b/ord0907clogensatm.appspot.com/o/index2ord0907447d066cb774.html?alt=media&token=2ce10760-9073-4421-8b15-4de88b7b3fdb#fdsfsdfsd@fdsfsdfsd.com.br$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||firebasestorage.googleapis.com/v0/b/outlook-4c0f2.appspot.com/o/books%2fwebmail.htm?alt=media&token=216401d2-aba7-42f4-8fd5-9b672cade830#a@b.com$all
||firebasestorage.googleapis.com/v0/b/outlook-4c0f2.appspot.com/o/books%2fwebmail.htm?alt=media&token=216401d2-aba7-42f4-8fd5-9b672cade830#abuse@optusnet.com.au$all
||firebasestorage.googleapis.com/v0/b/outlook-4c0f2.appspot.com/o/books%2fwebmail.htm?alt=media&token=216401d2-aba7-42f4-8fd5-9b672cade830#tiekimas@tidlo.lt$all
Filter updated: Sat, 24 Apr 2021 00:06:51 UTC
2021-04-24 00:06:52 +00:00
||firebasestorage.googleapis.com/v0/b/q797k09738937033.appspot.com/o/kb9468478928903284782.html?alt=media&token=a19b3d7c-3450-40a6-81df-d5149266a912#fssf@fssf.com.br$all
Filter updated: Wed, 25 Aug 2021 12:02:06 +0000
2021-08-25 12:02:07 +00:00
||firebasestorage.googleapis.com/v0/b/qrwetryuiopoiouer.appspot.com/o/golibe%20first%20refud%20.html?alt=media&token=a8d86c77-73ee-4286-b3f5-70b77fda2646#aaaa@example.jp$all
Filter updated: Thu, 20 May 2021 12:06:36 UTC
2021-05-20 12:06:36 +00:00
||firebasestorage.googleapis.com/v0/b/recover-5622d.appspot.com/o/%23%26%26%23%40!%24%25smg%23%24%24%26%23.html?alt=media&token=e98506ab-1e03-43e1-b627-244173d11623#igorek@prepaidlegal.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||firebasestorage.googleapis.com/v0/b/rei-rezuio-rexire-565.appspot.com/o/%40%40%40indexv-vb-vau-ry-8%252fbv-yu-er-8f%25252525%2525252f%25252525%2525252f%25252525%2525252f%25252525%2525252f%25252525%20-%20copy.html?alt=media&token=da92acdd-870d-4049-b9ac-f0d373777f06#info@legalshield.com$all
||firebasestorage.googleapis.com/v0/b/rei-rezuio-rexire-565.appspot.com/o/%40%40%40indexv-vb-vau-ry-8%252fbv-yu-er-8f%25252525%2525252f%25252525%2525252f%25252525%2525252f%25252525%2525252f%25252525%20-%20copy.html?alt=media&token=da92acdd-870d-4049-b9ac-f0d373777f06#support@legalshieldcorp.com$all
Filter updated: Tue, 13 Apr 2021 00:06:31 UTC
2021-04-13 00:06:31 +00:00
||firebasestorage.googleapis.com/v0/b/rned-a824v.appspot.com/o/gen%252findex2oli.html?alt=media&token=828c2259-c86f-442e-91a0-8d43a1fe7d8b#abuse@optusnet.com.au$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||firebasestorage.googleapis.com/v0/b/serveradministratoryikjrpee1.appspot.com/o/second%20(1).html?alt=media&token=d92aaee3-61c4-4326-9384-d39d22513c26#info@cobos-fs.de$all
||firebasestorage.googleapis.com/v0/b/solomidey-57f22.appspot.com/o/%ec%8a%b5s832%eb%8b%a4%ed%95%a0j%ec%98%a4%eb%98%90%eb%8b%a4f-1dr2%ec%9d%80bo%2f-%ec%9e%88otr4s%eb%a1%9cuz9-tov%ec%9e%88-73l-os%eb%8b%88os9%ec%98%a4ck-z-rr%2f-5-lc:26ppdz3:a%ed%95%a0nb%ed%95%a08%eb%b0%9bw%ec%82%ac%2f487hhu74y.html?alt=media&token=2a2c8312-b0dd-4adf-8b8a-d5655ecb2174#$all
Filter updated: Fri, 24 Sep 2021 12:02:36 +0000
2021-09-24 12:02:36 +00:00
||firebasestorage.googleapis.com/v0/b/spo2706genclou97.appspot.com/o/rbtreplac1909%2findex2rbt1909.html?alt=media&token=11006eda-0bfe-430b-8ae9-113c3b453622#klima@mup.cz$all
Filter updated: Sat, 21 Aug 2021 00:01:53 +0000
2021-08-21 00:01:54 +00:00
||firebasestorage.googleapis.com/v0/b/start-e65e8.appspot.com/o/index.html?alt=media&token=238a55a4-cd6d-4df2-8cb8-eca24b670093$all
Filter updated: Wed, 25 Aug 2021 12:02:06 +0000
2021-08-25 12:02:07 +00:00
||firebasestorage.googleapis.com/v0/b/syundon-45969.appspot.com/o/vutoprwz.html?alt=media&token=d778956b-9882-4818-863e-5e6d5627d4ea$all
Filter updated: Wed, 09 Dec 2020 12:06:49 UTC
2020-12-09 12:06:49 +00:00
||firebasestorage.googleapis.com/v0/b/tei-neriou-reuix-678.appspot.com/o/%40%40%40indexv-vb-veu-ry-8%25433%2569.html?alt=media&token=6b0a9c43-8711-491b-9f40-50ad280ffb32#ggradnigo@prepaidlegal.com$all
Filter updated: Thu, 29 Jul 2021 00:01:57 +0000
2021-07-29 00:01:57 +00:00
||firebasestorage.googleapis.com/v0/b/trows9098.appspot.com/o/25%255e%2524%2523%2540.html?alt=media&token=51dbb7d7-54ca-47bb-bbfc-f03691ac3d14&utm_medium=marketing&%24web_only=true&_branch_match_id=716254997194823397#samba@jubileegroup.co.uk$all
Filter updated: Mon, 24 May 2021 00:06:37 UTC
2021-05-24 00:06:37 +00:00
||firebasestorage.googleapis.com/v0/b/tu-03yg-3yhg-3yh4g-93h4g-h.appspot.com/o/wrjfgbho3429uy-03294y-gf93hgf-9y%2f30t49u30-tu-3hg3hg-39g-jug.html?alt=media&token=a35ff937-2752-4bdc-b4fe-da15853821c5#jtucker@prepaidlegal.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||firebasestorage.googleapis.com/v0/b/tunewhctkjvzxjfzfxwkhnfshpct4.appspot.com/o/tuntbf-vye-ur-g8%252fbv-ebry-8g%252fbf-vye-ur-g8%252fbv-ebry-8g%25%40fabf-vye-ur-g8%252fbv-ebry-8g%20-%20copy%20(7).html?alt=media&token=27479f48-3c7f-4e9b-89f3-71d3885085aa#info@asona.nl$all
||firebasestorage.googleapis.com/v0/b/user3987267105468.appspot.com/o/a1%2findex.htm?alt=media&token=0ea51307-7b68-4058-abb5-4d7006478527#test@example.com$all
||firebasestorage.googleapis.com/v0/b/user3987267105468.appspot.com/o/xt%2findex.htm?alt=media&token=673d3b79-aa9b-43eb-8526-d9e508f2035c#$all
||firebasestorage.googleapis.com/v0/b/wdrhghxlcnwtjkjltmrtztqlh.appspot.com/o/celibacy - copy (7).html?alt=media&token=30c670b1-9299-45c6-a16b-5bd1037c4499#@yorku.ca$all
Filter updated: Tue, 13 Apr 2021 00:06:31 UTC
2021-04-13 00:06:31 +00:00
||firebasestorage.googleapis.com/v0/b/work-project-333bf.appspot.com/o/updateloginnowss.htm?alt=media&token=d867adc6-ee5a-4c1d-b871-97640129a5dd#mail@example.com$all
Filter updated: Thu, 26 Aug 2021 12:02:31 +0000
2021-08-26 12:02:31 +00:00
||firebasestorage.googleapis.com/v0/b/xmailzytrsdemailkipt.appspot.com/o/dom1.html?alt=media&token=2c0996a9-d916-47f9-9d23-d876408acb88#aaaa@example.jp$all
Filter updated: Mon, 16 Aug 2021 12:01:42 +0000
2021-08-16 12:01:42 +00:00
||firebasestorage.googleapis.com/v0/b/xsxiz-77918.appspot.com/o/zx8six.html?alt=media&token=37023509-8607-4487-99de-22f2f5480716#reneesumpter@prepaidlegal.com$all
Filter updated: Wed, 25 Aug 2021 12:02:06 +0000
2021-08-25 12:02:07 +00:00
||firebasestorage.googleapis.com/v0/b/ze-nerio-reoz-447.appspot.com/o/indexxxv3534.html?alt=media&token=147ed254-cb63-40a9-aca6-9e544f1929f1#abuse@uregina.ca$all
Filter updated: Mon, 16 Aug 2021 00:01:59 +0000
2021-08-16 00:01:59 +00:00
||firebasestorage.googleapis.com/v0/b/zhi3006clogenusd.appspot.com/o/zhi3006clogenusd%2findex2zhi3006i447d066cb774.html?alt=media&token=ac8398b1-6be0-4e85-b567-10779ffd66f3#chammond@prepaidlegal.com$all
Filter updated: Wed, 25 Aug 2021 12:02:06 +0000
2021-08-25 12:02:07 +00:00
||firebasestorage.googleapis.com/v0/b/zhi3006clogenusd.appspot.com/o/zhi3006clogenusd%2findex2zhi3006i447d066cb774.html?alt=media&token=ac8398b1-6be0-4e85-b567-10779ffd66f3#davidedavis@prepaidlegal.com$all
||firebasestorage.googleapis.com/v0/b/zhi3006clogenusd.appspot.com/o/zhi3006clogenusd%2findex2zhi3006i447d066cb774.html?alt=media&token=ac8398b1-6be0-4e85-b567-10779ffd66f3#dougbloomer@prepaidlegal.com$all
||firebasestorage.googleapis.com/v0/b/zhi3006clogenusd.appspot.com/o/zhi3006clogenusd%2findex2zhi3006i447d066cb774.html?alt=media&token=ac8398b1-6be0-4e85-b567-10779ffd66f3#dove@prepaidlegal.com$all
||firebasestorage.googleapis.com/v0/b/zhi3006clogenusd.appspot.com/o/zhi3006clogenusd%2findex2zhi3006i447d066cb774.html?alt=media&token=ac8398b1-6be0-4e85-b567-10779ffd66f3#locy@prepaidlegal.com$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||first.myvnc.com$all
Filter updated: Tue, 14 Sep 2021 12:01:44 +0000
2021-09-14 12:01:44 +00:00
||firstcallautomation.in$all
Filter updated: Wed, 22 Sep 2021 12:01:56 +0000
2021-09-22 12:01:56 +00:00
||fish.tw1.su$all
Filter updated: Sat, 12 Jun 2021 00:25:37 UTC
2021-06-12 00:25:37 +00:00
||fiteram.eliotek.net$all
Filter updated: Sun, 11 Apr 2021 00:06:52 UTC
2021-04-11 00:06:52 +00:00
||fiuf89ufgigigi.yolasite.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||fixertawa.blogspot.com$all
Filter updated: Tue, 21 Sep 2021 12:02:11 +0000
2021-09-21 12:02:11 +00:00
||fixi.monster$all
||fixi.rest$all
Filter updated: Wed, 22 Sep 2021 12:01:56 +0000
2021-09-22 12:01:56 +00:00
||fixin1click.com$all
Filter updated: Mon, 24 May 2021 00:06:37 UTC
2021-05-24 00:06:37 +00:00
||fizikagroup.ru$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||fkjzei.top$all
Filter updated: Sun, 11 Oct 2020 00:07:18 UTC
2020-10-11 00:07:18 +00:00
||flavena.co.rs/mc.html$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||flaviovieiraadv.com.br$all
Filter updated: Fri, 24 Sep 2021 00:01:50 +0000
2021-09-24 00:01:51 +00:00
||flher.com$all
Filter updated: Mon, 25 Jan 2021 00:06:27 UTC
2021-01-25 00:06:27 +00:00
||flixpassed.com$all
Filter updated: Thu, 15 Jul 2021 12:01:53 +0000
2021-07-15 12:01:53 +00:00
||flladv.com.br$all
Filter updated: Fri, 17 Sep 2021 00:01:45 +0000
2021-09-17 00:01:46 +00:00
||floorsdirectltd.co.uk$all
Filter updated: Fri, 06 Aug 2021 12:01:57 +0000
2021-08-06 12:01:57 +00:00
||flouchs112.freecluster.eu$all
Filter updated: Thu, 02 Sep 2021 00:01:59 +0000
2021-09-02 00:01:59 +00:00
||flow.page/btconnnect$all
Filter updated: Tue, 31 Aug 2021 00:01:55 +0000
2021-08-31 00:01:55 +00:00
||flowcode.com/p/dnitl0pla?$all
Filter updated: Thu, 09 Sep 2021 12:02:27 +0000
2021-09-09 12:02:27 +00:00
||flowcode.com/page/btconnnect$all
Filter updated: Thu, 04 Feb 2021 00:06:18 UTC
2021-02-04 00:06:18 +00:00
||flowtork.com$all
Filter updated: Thu, 22 Jul 2021 00:01:54 +0000
2021-07-22 00:01:54 +00:00
||fluksrv.mycpanel.rs$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||fluorgov.sharepoint.us.mcas-gov.us$all
Filter updated: Wed, 16 Sep 2020 12:06:34 UTC
2020-09-16 12:06:34 +00:00
||flywed.turbo.site$all
Filter updated: Fri, 15 Jan 2021 00:06:14 UTC
2021-01-15 00:06:14 +00:00
||fm.registrobarretos.com.br$all
Filter updated: Sun, 19 Sep 2021 00:02:16 +0000
2021-09-19 00:02:17 +00:00
||fmail.youxjiauun.work$all
Filter updated: Thu, 10 Jun 2021 00:06:48 UTC
2021-06-10 00:06:48 +00:00
||fmpos.ucad.sn$all
Filter updated: Thu, 22 Jul 2021 00:01:54 +0000
2021-07-22 00:01:54 +00:00
||fn.tc/p9j2$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||fn.tc/p9jg$all
Filter updated: Mon, 20 Sep 2021 00:01:41 +0000
2021-09-20 00:01:41 +00:00
||fnatic-go.com$all
Filter updated: Wed, 28 Jul 2021 12:01:46 +0000
2021-07-28 12:01:46 +00:00
||fnzskhxpymppkjqtzljqayrjgf-dot-gowa11111111.rj.r.appspot.com$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||fo1bbbcf4445.info$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||foamnflow.com$all
Filter updated: Fri, 30 Apr 2021 00:08:30 UTC
2021-04-30 00:08:30 +00:00
||focar.vn$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||focusphotography.co.vu$all
Filter updated: Tue, 05 Jan 2021 12:06:21 UTC
2021-01-05 12:06:22 +00:00
||foliar.pl$all
Filter updated: Sat, 10 Apr 2021 00:06:30 UTC
2021-04-10 00:06:30 +00:00
||folignocrediti.it$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||foma-ura-lote.firebaseapp.com$all
Filter updated: Tue, 20 Jul 2021 12:01:48 +0000
2021-07-20 12:01:48 +00:00
||fon-gsm.pl$all
Filter updated: Tue, 13 Jul 2021 00:02:30 +0000
2021-07-13 00:02:30 +00:00
||foorwhatepouse.byethost9.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||foresta-mod.firebaseapp.com$all
Filter updated: Fri, 25 Jun 2021 12:06:17 +0000
2021-06-25 12:06:17 +00:00
||forfoodies.co$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||forgesmithvr.com$all
Filter updated: Wed, 11 Aug 2021 12:01:50 +0000
2021-08-11 12:01:50 +00:00
||forlifehome.net$all
Filter updated: Thu, 05 Aug 2021 00:02:05 +0000
2021-08-05 00:02:05 +00:00
||form.123formbuilder.com/5884980$all
Filter updated: Mon, 09 Aug 2021 00:02:27 +0000
2021-08-09 00:02:27 +00:00
||form.asana.com/?k=cdxmabdeiqp1ls8o45yzlw&d=1200547430279636$all
Filter updated: Thu, 19 Aug 2021 12:02:33 +0000
2021-08-19 12:02:33 +00:00
||form.jotform.com/elenabrown266/government-pandemic-extra-stimulus-$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||formbuddy.com$all
Filter updated: Wed, 18 Aug 2021 00:01:50 +0000
2021-08-18 00:01:50 +00:00
||forms.formium.io$all
Filter updated: Mon, 06 Sep 2021 00:01:54 +0000
2021-09-06 00:01:54 +00:00
||forms.gle/19fzdjrlxxquwqpf7$all
||forms.gle/1tzv1hp4qhvnccoq8$all
||forms.gle/4j3mttszzsm3asqh9$all
Filter updated: Tue, 20 Jul 2021 00:01:58 +0000
2021-07-20 00:01:58 +00:00
||forms.gle/9bwawhpz5vi7ilpe6$all
Filter updated: Tue, 20 Jul 2021 12:01:48 +0000
2021-07-20 12:01:48 +00:00
||forms.gle/b7lqaal42juffiw1a$all
Filter updated: Thu, 05 Aug 2021 00:02:05 +0000
2021-08-05 00:02:05 +00:00
||forms.gle/bfz2l7i3wvrp5heb9$all
Filter updated: Mon, 26 Jul 2021 00:02:16 +0000
2021-07-26 00:02:17 +00:00
||forms.gle/dncj4btc56n1n71n8$all
Filter updated: Fri, 17 Sep 2021 00:01:45 +0000
2021-09-17 00:01:46 +00:00
||forms.gle/edtu6r7rqxqyegcf6$all
Filter updated: Tue, 20 Jul 2021 12:01:48 +0000
2021-07-20 12:01:48 +00:00
||forms.gle/egj66jkgwkcd3aat8$all
Filter updated: Tue, 03 Aug 2021 12:01:54 +0000
2021-08-03 12:01:54 +00:00
||forms.gle/eozlrnnf7jh84xdp8$all
Filter updated: Mon, 06 Sep 2021 00:01:54 +0000
2021-09-06 00:01:54 +00:00
||forms.gle/fz7y7tfq5utrgcry8$all
||forms.gle/fzlons3fgnjdqdd19?omgbfzrazhlppbtx$all
||forms.gle/gjcgpyjcmp4cdrmn8$all
Filter updated: Thu, 05 Aug 2021 00:02:05 +0000
2021-08-05 00:02:05 +00:00
||forms.gle/gkszreuf5x38hgfb7$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||forms.gle/goerpntl5tfeumdz6$all
Filter updated: Thu, 05 Aug 2021 00:02:05 +0000
2021-08-05 00:02:05 +00:00
||forms.gle/gr4b9sxradtcj7or7$all
Filter updated: Tue, 20 Jul 2021 12:01:48 +0000
2021-07-20 12:01:48 +00:00
||forms.gle/guptjarp2xatzbvo8$all
||forms.gle/iai7pzm4pxyb145i9$all
Filter updated: Mon, 06 Sep 2021 00:01:54 +0000
2021-09-06 00:01:54 +00:00
||forms.gle/jnkkauxwwbfhtuqz9?hkgotygikyoujp$all
Filter updated: Tue, 20 Jul 2021 12:01:48 +0000
2021-07-20 12:01:48 +00:00
||forms.gle/jzxtb9auexgjcewfa$all
Filter updated: Mon, 06 Sep 2021 00:01:54 +0000
2021-09-06 00:01:54 +00:00
||forms.gle/kb2rdkamvphenokva$all
||forms.gle/kehch96avaku7oey7?akowgmooutpwa$all
||forms.gle/puadbxscibgw5ma79?xfccuwmmhgwrwztd$all
Filter updated: Sat, 11 Sep 2021 12:01:27 +0000
2021-09-11 12:01:27 +00:00
||forms.gle/pzduf4a8ms7p3mot7$all
Filter updated: Fri, 23 Apr 2021 00:06:35 UTC
2021-04-23 00:06:35 +00:00
||forms.gle/qrrg7m5mcasfuk6e9$all
Filter updated: Tue, 20 Jul 2021 00:01:58 +0000
2021-07-20 00:01:58 +00:00
||forms.gle/ruaxzqjjzghi8rar9$all
Filter updated: Tue, 13 Jul 2021 00:02:30 +0000
2021-07-13 00:02:30 +00:00
||forms.gle/rwpcmhm8vtfa7f4m8$all
Filter updated: Tue, 03 Aug 2021 12:01:54 +0000
2021-08-03 12:01:54 +00:00
||forms.gle/sj21ehdebhkcpvfv6$all
Filter updated: Mon, 06 Sep 2021 00:01:54 +0000
2021-09-06 00:01:54 +00:00
||forms.gle/smufgmyhduckbq6ka?fjxhgyroek$all
Filter updated: Tue, 20 Jul 2021 12:01:48 +0000
2021-07-20 12:01:48 +00:00
||forms.gle/uqzzznxv4cfhu3yr9$all
||forms.gle/v5xtnywt5s6zvpp27$all
||forms.gle/w6uh9p66tdq6l1m66$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||forms.gle/wqycsyy8jhuhvaex7$all
Filter updated: Tue, 20 Jul 2021 12:01:48 +0000
2021-07-20 12:01:48 +00:00
||forms.gle/x3aasffazsrl8pcr9$all
||forms.gle/x8hybjggubfftabw8$all
Filter updated: Mon, 06 Sep 2021 00:01:54 +0000
2021-09-06 00:01:54 +00:00
||forms.gle/xxjqmu6luzkpnalg6$all
Filter updated: Fri, 17 Sep 2021 00:01:45 +0000
2021-09-17 00:01:46 +00:00
||forms.gle/yfxkceytox2zuyvb6$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||forms.office.com/formspro/pages/responsepage.aspx?id=t3dj48rwk0sjoalzgnmn6bafynfdky5orhyq9zv62tpuqusztlhxmvviuupxskvlrvmyuldyuko5ny4u&vt=e36377b7-70c4-4493-a338-095918d327e9_1973aa6c-a10f-46bb-a912-07c43f73112e_hash7_gcdqoyksqmupfbm4pwloqi%2bnuyahsmp%2b8bemc6qhdqu%3d$all
Filter updated: Sat, 31 Jul 2021 12:01:55 +0000
2021-07-31 12:01:55 +00:00
||forms.office.com/pages/responsepage.aspx?id=60hhzfbtoe-qdzpnyrluyo-ivxb0mexgqufvg5tcyifunzg5uknzne1irjzvt1y3slewrepwnflmvs4u$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||forms.office.com/pages/responsepage.aspx?id=79zc40bzquqwhsumk8wi7ifmk8wscglbvpsk75lcq2funzlxovuzrfm2vthps0jfuzg1qvrevtkzmc4u$all
||forms.office.com/pages/responsepage.aspx?id=9mkl-ub4beksg-bmxxmbpmobeab-n85cvyzfhjasiu5urvdoqja3q1vrqlyyvehtqu9vntfhvelqtc4u$all
||forms.office.com/pages/responsepage.aspx?id=bu78ampjjeewrm5mbe2yjju5rluqqzbmpxmzobiguotum05arfrrr1bmmfhnqlvumlphtlfnrlg2mc4u$all
Filter updated: Fri, 23 Apr 2021 00:06:35 UTC
2021-04-23 00:06:35 +00:00
||forms.office.com/pages/responsepage.aspx?id=cuqqaa9ryuoh9axxczoijhhpjakus7bnnjfzgq5cylhum0rptlhfndbbwfnmu1k2uktsve9jszk0rc4u$all
||forms.office.com/pages/responsepage.aspx?id=cuqqaa9ryuoh9axxczoijhhpjakus7bnnjfzgq5cylhumus3nklqsuuzoetaofldrdjtvu82muhxms4u$all
Filter updated: Tue, 13 Apr 2021 00:06:31 UTC
2021-04-13 00:06:31 +00:00
||forms.office.com/pages/responsepage.aspx?id=cuqqaa9ryuoh9axxczoijhhpjakus7bnnjfzgq5cylhunehvsvgywurrwvfxr1qwodliwepdtkpqmi4u$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||forms.office.com/pages/responsepage.aspx?id=dqsikwdsw0yxejajblztrqaaaaaaaaaaaaa__qth0uruodzxsevzmvldsepnvkjotudjm1e0nk9evy4u$all
||forms.office.com/pages/responsepage.aspx?id=dqsikwdsw0yxejajblztrqaaaaaaaaaaaaa__qtvbajunvzamtfcvlq4q0yxm05pmkvwtllimzdnwc4u$all
||forms.office.com/pages/responsepage.aspx?id=dqsikwdsw0yxejajblztrqaaaaaaaaaaaamaabxpdkjumkljwjzsnvpduec1tutmuvpqqtnlufnwuc4u$all
||forms.office.com/pages/responsepage.aspx?id=dqsikwdsw0yxejajblztrqaaaaaaaaaaaamaaca_cgtumlpuvfc1veneu0zwvenyu01asljnn0vfqi4u$all
||forms.office.com/pages/responsepage.aspx?id=dqsikwdsw0yxejajblztrqaaaaaaaaaaaamaaca_cgtunexjt1hfrfi1nzk0n1lutthsnzvjv0e2uy4u$all
||forms.office.com/pages/responsepage.aspx?id=dqsikwdsw0yxejajblztrqaaaaaaaaaaaamaaca_cgtuq00xqlhsr1hiwelun0rwwe0ymtfjmdawns4u$all
||forms.office.com/pages/responsepage.aspx?id=dqsikwdsw0yxejajblztrqaaaaaaaaaaaamaaca_cgtuq0fpvfbfrkpnn0kxv08wrtvmoekymenbus4u$all
||forms.office.com/pages/responsepage.aspx?id=dqsikwdsw0yxejajblztrqaaaaaaaaaaaamaacuhhh9urjbfulzfvulpnthxnljgquy0tdrpmulfry4u$all
||forms.office.com/pages/responsepage.aspx?id=dqsikwdsw0yxejajblztrqaaaaaaaaaaaamaadtgljzurew0nuc4szawvznimehywuu5wvmyvfczri4u$all
||forms.office.com/pages/responsepage.aspx?id=dqsikwdsw0yxejajblztrqaaaaaaaaaaaamaanf70j5umkk5t0gwtthlnly2mffpnzdzr0hqt0tlvi4u$all
||forms.office.com/pages/responsepage.aspx?id=dqsikwdsw0yxejajblztrqaaaaaaaaaaaamaanf70j5uqtc4sei3tkhyn1hgwlmxslbvnvddqzjptc4u$all
||forms.office.com/pages/responsepage.aspx?id=dqsikwdsw0yxejajblztrqaaaaaaaaaaaan__idhxlruofndulbkv1yxuva0mvpbsdjynk02vtq0ws4u$all
||forms.office.com/pages/responsepage.aspx?id=dqsikwdsw0yxejajblztrqaaaaaaaaaaaan__idqx2luqkvdqzfcvfpiulhrvzbisfngwefqsznrmc4u$all
||forms.office.com/pages/responsepage.aspx?id=dqsikwdsw0yxejajblztrqaaaaaaaaaaaan__iryfuzurvngmfbtvdzfmjfgufhvwkm3rzzar1jvns4u$all
||forms.office.com/pages/responsepage.aspx?id=dqsikwdsw0yxejajblztrqaaaaaaaaaaaan__jdhomtumug3tk00ruhdt0vhsudysluwq0rbnencmi4u$all
||forms.office.com/pages/responsepage.aspx?id=dqsikwdsw0yxejajblztrqaaaaaaaaaaaanaadkwe9jumllwstgxmtdhvetgnjbqn0dfvlfiuzjsms4u$all
||forms.office.com/pages/responsepage.aspx?id=dqsikwdsw0yxejajblztrqaaaaaaaaaaaanaarzinhfurfkytlznnvq2r0fumfhiseptn0i2sjdcsi4u$all
||forms.office.com/pages/responsepage.aspx?id=dqsikwdsw0yxejajblztrqaaaaaaaaaaaanaasedm8vum1zrrk9zv1jzsjlvqvrawfgyrtbxvtjboc4u$all
||forms.office.com/pages/responsepage.aspx?id=dqsikwdsw0yxejajblztrqaaaaaaaaaaaanaash00u5um0jmrk5fvlzatfphnddjslhct0tqofzdvy4u$all
Filter updated: Thu, 15 Apr 2021 12:07:36 UTC
2021-04-15 12:07:36 +00:00
||forms.office.com/pages/responsepage.aspx?id=dqsikwdsw0yxejajblztrqaaaaaaaaaaaanaatnvo6numk8xntbxqk1dodlwu1bbrjjstfvjufjymy4u$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||forms.office.com/pages/responsepage.aspx?id=dqsikwdsw0yxejajblztrqaaaaaaaaaaaao__r4jmpzuqu9qvtnynuq0rfrlvdzznlzxquhpsercmi4u$all
||forms.office.com/pages/responsepage.aspx?id=dqsikwdsw0yxejajblztrqaaaaaaaaaaaao__seywchunehdtzm5vjayvjzkmlvrs0vwnvbnujhnmy4u$all
||forms.office.com/pages/responsepage.aspx?id=dqsikwdsw0yxejajblztrqaaaaaaaaaaaao__sfhld5uqvrirlzgntk0u1zsqzyysfawwvbbvu85ni4u$all
||forms.office.com/pages/responsepage.aspx?id=dqsikwdsw0yxejajblztrqaaaaaaaaaaaao__sfnbxluqlbctexonfc4oevgnefcufywm1fjtju5ss4u$all
||forms.office.com/pages/responsepage.aspx?id=dqsikwdsw0yxejajblztrqaaaaaaaaaaaao__snrwtpuqjvenecwqkzbnfdfr1jku0nkqjlwrzdsrc4u$all
||forms.office.com/pages/responsepage.aspx?id=dqsikwdsw0yxejajblztrqaaaaaaaaaaaao__spb8hhurdnondhfouw3ndlavjdyrfddwjlzsedsvs4u$all
||forms.office.com/pages/responsepage.aspx?id=dqsikwdsw0yxejajblztrqaaaaaaaaaaaao__srwmhxuretyne5nrjdkq0dasjznujm2mdhmsflkvy4u$all
||forms.office.com/pages/responsepage.aspx?id=dqsikwdsw0yxejajblztrqaaaaaaaaaaaao__svkz5xurjnlvug3netwszexnudqovdyuda2tdyxrc4u$all
||forms.office.com/pages/responsepage.aspx?id=dqsikwdsw0yxejajblztrqaaaaaaaaaaaao__sweyulumuxnwlbytvhlnu5wstyzvkviredwskzcws4u$all
Filter updated: Tue, 20 Jul 2021 12:01:48 +0000
2021-07-20 12:01:48 +00:00
||forms.office.com/pages/responsepage.aspx?id=dqsikwdsw0yxejajblztrqaaaaaaaaaaaao__tdasqlurfrqmjzxneyxn0g3vexutfvzq0mztu9fms4u$all
Filter updated: Thu, 15 Apr 2021 12:07:36 UTC
2021-04-15 12:07:36 +00:00
||forms.office.com/pages/responsepage.aspx?id=dqsikwdsw0yxejajblztrqaaaaaaaaaaaao__thg5xvuodnbwtvytzhwwdnctknvovo4tldctexmvi4u$all
Filter updated: Tue, 27 Jul 2021 00:02:10 +0000
2021-07-27 00:02:10 +00:00
||forms.office.com/pages/responsepage.aspx?id=dqsikwdsw0yxejajblztrqaaaaaaaaaaaao__tmcie5uode4ourdofzzwepgtkdzmzjlwk40tfbkui4u$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||forms.office.com/pages/responsepage.aspx?id=dqsikwdsw0yxejajblztrqaaaaaaaaaaaayaaa0-vkzunzrzmu1zrda1odrftlnlodhguzlssfbhrs4u$all
||forms.office.com/pages/responsepage.aspx?id=dqsikwdsw0yxejajblztrqaaaaaaaaaaaayaaa2meqpurufbvjc1q1czuke4ulrvr1y2oernqlzkvy4u$all
||forms.office.com/pages/responsepage.aspx?id=dqsikwdsw0yxejajblztrqaaaaaaaaaaaayaaalzmthuourlq0vqtvfdt0u3wlhfretfvkhir0pvws4u$all
||forms.office.com/pages/responsepage.aspx?id=dqsikwdsw0yxejajblztrqaaaaaaaaaaaayaaao2yyrurffavkw1u1lwulbawlbqwevzqtjkmulity4u$all
||forms.office.com/pages/responsepage.aspx?id=dqsikwdsw0yxejajblztrqaaaaaaaaaaaayaaas-la5urvmwqvqyvufjmvbomu5vsvbcudywvezwsi4u$all
||forms.office.com/pages/responsepage.aspx?id=dqsikwdsw0yxejajblztrqaaaaaaaaaaaayaaaunxyrumtzmrlnnv1hwvfdwr1zinvzutfrtvke0ty4u$all
||forms.office.com/pages/responsepage.aspx?id=dqsikwdsw0yxejajblztrqaaaaaaaaaaaayaaave1ljumkjardbxn0plmkrbn1nsn1ztuezcvjhros4u$all
||forms.office.com/pages/responsepage.aspx?id=dqsikwdsw0yxejajblztrqaaaaaaaaaaaayaaavwmwlumdq4m1donkpasdzhwehkvurptzdmndi2vc4u$all
||forms.office.com/pages/responsepage.aspx?id=dqsikwdsw0yxejajblztrqaaaaaaaaaaaayaaawff7humutduk85ruwzn0hcovk4n0e3nunyovizvy4u$all
||forms.office.com/pages/responsepage.aspx?id=dqsikwdsw0yxejajblztrqaaaaaaaaaaaayaaawk7snun0qyneuwr0nyntg0r1nwq05cn08wwefery4u$all
||forms.office.com/pages/responsepage.aspx?id=dqsikwdsw0yxejajblztrqaaaaaaaaaaaayaaaycqtvurjexwuxnsu4znuvctzrywly4qviwt1frsi4u$all
||forms.office.com/pages/responsepage.aspx?id=dqsikwdsw0yxejajblztrqaaaaaaaaaaaaz__g2q2wzuq1zynjq1wfhjr1y3wtrsszlxwthywljxrs4u$all
||forms.office.com/pages/responsepage.aspx?id=dqsikwdsw0yxejajblztrqaaaaaaaaaaaaz__gs1jibumzjhwkezsdzvwvzendnnwly0r0zkmjrmtc4u$all
||forms.office.com/pages/responsepage.aspx?id=dqsikwdsw0yxejajblztrqaaaaaaaaaaaaz__guylchunfcxt0prvurnsezcrtm4vdeytklcwuiytc4u$all
||forms.office.com/pages/responsepage.aspx?id=dqsikwdsw0yxejajblztrqaaaaaaaaaaaaz__gy-0ydurtg3mzc4wfixveq3wdnbqvfovdbhvkxmtc4u$all
||forms.office.com/pages/responsepage.aspx?id=dqsikwdsw0yxejajblztrqaaaaaaaaaaaaz__gyeyavunjvrv1nonjvhs0c4qvkwmfa3qlhurk5zsc4u$all
||forms.office.com/pages/responsepage.aspx?id=dqsikwdsw0yxejajblztrqaaaaaaaaaaaaz__gypjlduqvravvlqtepnwlnjn1iytuc0mfixs0tfrc4u$all
||forms.office.com/pages/responsepage.aspx?id=dqsikwdsw0yxejajblztrqaaaaaaaaaaaazaaadym1fuotfisfdam1fjmk1kqju3rk82uvnhvfptvc4u$all
||forms.office.com/pages/responsepage.aspx?id=dqsikwdsw0yxejajblztrqaaaaaaaaaaaazaaaei3rhuq0fnuu5rmznyuky1t1gxmjfru1uxv1viuy4u$all
||forms.office.com/pages/responsepage.aspx?id=dqsikwdsw0yxejajblztrqaaaaaaaaaaaazaaaets9fun1nfntazovrqn1lbwtdzrzlwqumynze0my4u$all
||forms.office.com/pages/responsepage.aspx?id=dqsikwdsw0yxejajblztrqaaaaaaaaaaaazaaafdyoxurehctzjdmjfrwjntndjem0xenkntmtdhmy4u$all
||forms.office.com/pages/responsepage.aspx?id=dqsikwdsw0yxejajblztrqaaaaaaaaaaaazaaaflubtumfhem0vlnfjuszu4tktmnk9xovzmqthytc4u$all
||forms.office.com/pages/responsepage.aspx?id=dqsikwdsw0yxejajblztrqaaaaaaaaaaaazaaaiprvrunlrbuewzmvlkqljnrdlqukfsmlu4wevmry4u$all
||forms.office.com/pages/responsepage.aspx?id=fz-8elvwiu6kicn2zo2olhg81y6qaolpsppzfph-tm5un0iyr0hnn1vqtezonjewuvhpq0tju0fqsi4u$all
||forms.office.com/pages/responsepage.aspx?id=ihle7-a1oei7afvzywhaws5xiqgz8mfkm8p-86mqnr9undhln1lqteyzqvc1tlk5mfozwvawtknkmy4u$all
||forms.office.com/pages/responsepage.aspx?id=jrbxvx3x9keewcq72hm6fnkqekonandcsjd9av060h5urepumvvgmks2te41rfewmlletulvufnuqy4u$all
Filter updated: Wed, 15 Sep 2021 12:01:46 +0000
2021-09-15 12:01:46 +00:00
||forms.office.com/pages/responsepage.aspx?id=lsipqxnvleck4xxhpkfav5ivtrnxmdhngicoeqskxorunlaws1ngrujswvnvnzfdrfjnvljdtehmwi4u$all
Filter updated: Mon, 03 May 2021 00:07:34 UTC
2021-05-03 00:07:34 +00:00
||forms.office.com/pages/responsepage.aspx?id=ngregipt_k6tg1m4a_cm6emdexhpbtfao3l5c4fjinbunk9qu1uwstjys1jumfnytlfhmllwsjuzvc4u$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||forms.office.com/pages/responsepage.aspx?id=o1kpbby4gegron8dfasq2ijzeu7mzr9pqflgizarhujun0vvvkrumvvxuecyt1hqmuo1ttg3we02tc4u$all
||forms.office.com/pages/responsepage.aspx?id=qjetd-pj6eer0hggxsw7en8q0eijx4rkhjeopersgj5unjvevdlktextr0vdujg0mlvqs09uwvq1ui4u$all
||forms.office.com/pages/responsepage.aspx?id=tdtustnlhem59-pmb0_bsirohc__jc9lgcdfek0aqshumudjnfiynehuuvnoquuxsthnmehfmvu3vs4u$all
||forms.office.com/pages/responsepage.aspx?id=ucuxcxtdou2goz1lrb39f18hvs8pokvjkugvzz4uwvxumflbrjaywe1hq0q3tlo3sdjcvjfqmddbrc4u$all
Filter updated: Tue, 27 Jul 2021 00:02:10 +0000
2021-07-27 00:02:10 +00:00
||forms.office.com/pages/responsepage.aspx?id=zxaxwd0jf06p5cqmduzpgkuxo26r9wtjo7rvzofgckbuodbeqtlmtlzislpjmui5n01zq1but0ptni4u$all
||forms.office.com/pages/responsepage.aspx?id=zzzg0pjjwuckyuiehxswjrab8y4i7hbcnnkwxccpxl5um08xmlzrs05ruerlwuphnknwmlm2ovnwsy4u$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||forms.plumsail.com$all
Filter updated: Thu, 12 Aug 2021 12:01:52 +0000
2021-08-12 12:01:53 +00:00
||formtools.com$all
||formulario-conta-segura.arcanal.com.br$all
Filter updated: Sun, 23 May 2021 12:06:28 UTC
2021-05-23 12:06:28 +00:00
||forumasik.com$all
Filter updated: Thu, 29 Jul 2021 00:01:57 +0000
2021-07-29 00:01:57 +00:00
||forumgalixia.byethost6.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||forums.rstools.club$all
Filter updated: Mon, 16 Aug 2021 00:01:59 +0000
2021-08-16 00:01:59 +00:00
||fosnetsecuritycameras.com$all
Filter updated: Mon, 13 Sep 2021 12:01:52 +0000
2021-09-13 12:01:52 +00:00
||fotoljilja.com$all
Filter updated: Mon, 10 May 2021 12:06:32 UTC
2021-05-10 12:06:32 +00:00
||foxdancecompany.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||fpmaam.org$all
Filter updated: Wed, 28 Oct 2020 00:06:13 UTC
2020-10-28 00:06:13 +00:00
||fr-europe564598-com.filesusr.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||fr.surveymonkey.com$all
Filter updated: Wed, 01 Sep 2021 00:02:20 +0000
2021-09-01 00:02:20 +00:00
||fra1.digitaloceanspaces.com/round-cube/r.html?email=dkadwan@dnata.jo$all
Filter updated: Wed, 15 Sep 2021 00:01:54 +0000
2021-09-15 00:01:55 +00:00
||fraenkly-speaking.de$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||frailcoralclient.codesandbox.repl.co$all
Filter updated: Fri, 24 Sep 2021 00:01:50 +0000
2021-09-24 00:01:51 +00:00
||fralindendre.com$all
Filter updated: Wed, 09 Jun 2021 12:06:26 UTC
2021-06-09 12:06:26 +00:00
||framecapturestudio.com$all
Filter updated: Sat, 11 Sep 2021 12:01:27 +0000
2021-09-11 12:01:27 +00:00
||franchino0-my.sharepoint.com/personal/nchurchill_franchino_com/_layouts/15/guestaccess.aspx?guestaccesstoken=gxvs24po1pqv483r%2bksfddmp4j%2f%2fam07r2jepythmh0%3d&docid=1_1e885f7a3dd044717ae4b7322836b1672&wdformid=%7bcb419e87%2d6da3%2d41e3%2d9ad5%2d4971852f5dd5%7d$all
Filter updated: Tue, 13 Apr 2021 00:06:31 UTC
2021-04-13 00:06:31 +00:00
||franckpilier23-my-cheetah-website-copy.cheetah.builderall.com$all
Filter updated: Tue, 29 Jun 2021 00:01:48 +0000
2021-06-29 00:01:48 +00:00
||franckpilier23-oro.cheetah.builderall.com$all
Filter updated: Sat, 10 Apr 2021 00:06:30 UTC
2021-04-10 00:06:30 +00:00
||franckpilier23-ro.cheetah.builderall.com$all
Filter updated: Mon, 06 Sep 2021 00:01:54 +0000
2021-09-06 00:01:54 +00:00
||frank-auth.cf$all
Filter updated: Thu, 22 Jul 2021 00:01:54 +0000
2021-07-22 00:01:54 +00:00
||freddsur111.byethost32.com$all
Filter updated: Sat, 18 Sep 2021 00:14:48 +0000
2021-09-18 00:14:48 +00:00
||fredounv.000webhostapp.com$all
Filter updated: Mon, 23 Aug 2021 00:01:47 +0000
2021-08-23 00:01:47 +00:00
||free-counters.co.uk/cgi-bin/go.pl?go=bfranklin.info?8466714862$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||free-fire-event-gratis298.duckdns.org$all
Filter updated: Fri, 24 Sep 2021 12:02:36 +0000
2021-09-24 12:02:36 +00:00
||free-firecoderedem.blogspot.com$all
Filter updated: Fri, 24 Sep 2021 00:01:50 +0000
2021-09-24 00:01:51 +00:00
||free345sschool.gb.net$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||free50v1d3oproxx.duckdns.org$all
Filter updated: Mon, 14 Jun 2021 00:06:24 UTC
2021-06-14 00:06:25 +00:00
||freedomtonight.com/connexion/105f60268899aad/region.php?particulier$all
Filter updated: Sun, 13 Jun 2021 12:06:36 UTC
2021-06-13 12:06:36 +00:00
||freedomtonight.com/connexion/1c57cc490e9d5e5/region.php?particulier$all
Filter updated: Sun, 13 Jun 2021 00:06:42 UTC
2021-06-13 00:06:42 +00:00
||freedomtonight.com/connexion/48e3e31d6f469f5/region.php?particulier$all
Filter updated: Mon, 14 Jun 2021 00:06:24 UTC
2021-06-14 00:06:25 +00:00
||freedomtonight.com/connexion/684ee8f67724e20/region.php?particulier$all
Filter updated: Sun, 13 Jun 2021 12:06:36 UTC
2021-06-13 12:06:36 +00:00
||freedomtonight.com/connexion/874e7b70f340c1b/region.php?particulier$all
||freedomtonight.com/connexion/d83e97792d12108/region.php?particulier$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||freefiregarena-br.thats.im$all
Filter updated: Mon, 05 Jul 2021 00:01:57 +0000
2021-07-05 00:01:57 +00:00
||freegsm.co$all
Filter updated: Thu, 19 Aug 2021 12:02:33 +0000
2021-08-19 12:02:33 +00:00
||freeliker.net$all
Filter updated: Tue, 24 Nov 2020 00:06:20 UTC
2020-11-24 00:06:20 +00:00
||freeproductkey.org$all
Filter updated: Sun, 01 Nov 2020 12:06:58 UTC
2020-11-01 12:06:58 +00:00
||freepubgs.live$all
Filter updated: Fri, 13 Aug 2021 12:01:44 +0000
2021-08-13 12:01:44 +00:00
||freeride-gulmarg.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||frerfire-gaming.mrbonus.com$all
Filter updated: Tue, 02 Feb 2021 00:22:14 UTC
2021-02-02 00:22:15 +00:00
||freshskinandbodyfairport.com/contact/$all
Filter updated: Mon, 20 Sep 2021 12:02:05 +0000
2021-09-20 12:02:05 +00:00
||friendlystorewyo.com$all
Filter updated: Wed, 11 Aug 2021 12:01:50 +0000
2021-08-11 12:01:50 +00:00
||frizzter.freecluster.eu$all
Filter updated: Thu, 16 Sep 2021 12:02:15 +0000
2021-09-16 12:02:15 +00:00
||frontllineed.com$all
Filter updated: Tue, 01 Jun 2021 12:06:34 UTC
2021-06-01 12:06:34 +00:00
||fruernes.dk$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||fsgs653526sghg.000webhostapp.com$all
Filter updated: Mon, 07 Jun 2021 00:06:20 UTC
2021-06-07 00:06:20 +00:00
||fsstradingco-my.sharepoint.com/:b:/g/personal/jeff_fsstrading_com/ec1yk-fkwzlkst3oymd07zsbczspqpfzu5xd2yuha-cdkq?e=4:u3zdsc&$all
Filter updated: Tue, 14 Sep 2021 12:01:44 +0000
2021-09-14 12:01:44 +00:00
||fsstradingco-my.sharepoint.com/personal/jeff_fsstrading_com/_layouts/15/onedrive.aspx?id=/personal/jeff_fsstrading_com/documents/scans/scan210505142847/7992.346dod__513%20fa%20pdf.pdf&parent=/personal/jeff_fsstrading_com/documents/scans/scan210505142847&originalpath=ahr0chm6ly9mc3n0cmfkaw5ny28tbxkuc2hhcmvwb2ludc5jb20vomi6l2cvcgvyc29uywwvamvmzl9mc3n0cmfkaw5nx2nvbs9fyzf5ay1gs1dabetzvdnveu1emddac0jjwlnwcvbmwlu1wgqyevvoqs1dretrp3j0aw1lptfsymt5qzfymlvn$all
Filter updated: Fri, 24 Sep 2021 00:01:50 +0000
2021-09-24 00:01:51 +00:00
||fsstradingco-my.sharepoint.com/personal/jeff_fsstrading_com/_layouts/15/onedrive.aspx?id=/personal/jeff_fsstrading_com/documents/scans/scan210505142847/7992.346dod__513%20fa%20pdf.pdf&parent=/personal/jeff_fsstrading_com/documents/scans/scan210505142847&originalpath=ahr0chm6ly9mc3n0cmfkaw5ny28tbxkuc2hhcmvwb2ludc5jb20vomi6l2cvcgvyc29uywwvamvmzl9mc3n0cmfkaw5nx2nvbs9fyzf5ay1gs1dabetzvdnveu1emddac0jjwlnwcvbmwlu1wgqyevvoqs1dretrp3j0aw1lpw5vumzpbezxmlvn$all
Filter updated: Tue, 07 Sep 2021 00:01:46 +0000
2021-09-07 00:01:46 +00:00
||fsstradingco-my.sharepoint.com/personal/jeff_fsstrading_com/_layouts/15/onedrive.aspx?id=/personal/jeff_fsstrading_com/documents/scans/scan210505142847/7992.346dod__513%20fa%20pdf.pdf&parent=/personal/jeff_fsstrading_com/documents/scans/scan210505142847&originalpath=ahr0chm6ly9mc3n0cmfkaw5ny28tbxkuc2hhcmvwb2ludc5jb20vomi6l2cvcgvyc29uywwvamvmzl9mc3n0cmfkaw5nx2nvbs9fyzf5ay1gs1dabetzvdnveu1emddac0jjwlnwcvbmwlu1wgqyevvoqs1dretrp3j0aw1lpxhhu3nzawszmlvn$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||ftp.lesterandco.com$all
Filter updated: Thu, 20 May 2021 12:06:36 UTC
2021-05-20 12:06:36 +00:00
||ftp.trialshop.it$all
Filter updated: Fri, 07 May 2021 12:12:56 UTC
2021-05-07 12:12:56 +00:00
||fuad.iainkendari.ac.id$all
Filter updated: Thu, 15 Jul 2021 12:01:53 +0000
2021-07-15 12:01:53 +00:00
||fundrive.proket.co.in/old/how/chase1.html$all
||fundrive.proket.co.in/old/new/$all
||fundrive.proket.co.in/reloading/okay/ait/att/at&t%20-%20login.htm$all
Filter updated: Wed, 28 Oct 2020 12:09:06 UTC
2020-10-28 12:09:06 +00:00
||futuretroveschool.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||fxt27.csb.app$all
Filter updated: Wed, 25 Aug 2021 12:02:06 +0000
2021-08-25 12:02:07 +00:00
||fyfb-9h4s5ryhgh.tv1space.az$all
Filter updated: Sat, 12 Sep 2020 00:07:13 UTC
2020-09-12 00:07:13 +00:00
||fzbfhn.webwave.dev$all
Filter updated: Thu, 08 Apr 2021 12:07:09 UTC
2021-04-08 12:07:09 +00:00
||g-mtcc.com$all
Filter updated: Tue, 14 Sep 2021 12:01:44 +0000
2021-09-14 12:01:44 +00:00
||g1lib.skipdns.link$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||gabbygiftcard.org$all
||gabung-grup-dewasa18.duckdns.org$all
Filter updated: Thu, 03 Sep 2020 12:06:37 UTC
2020-09-03 12:06:37 +00:00
||gabungg-gruppwhattsapp18.ftp1.biz$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||gabunggrupwakaka.duckdns.org$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||gagafan.net/rt$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||gagafan.net/rt/$all
Filter updated: Mon, 14 Jun 2021 00:06:24 UTC
2021-06-14 00:06:25 +00:00
||gajaraet.com/secured/daum$all
Filter updated: Sat, 29 May 2021 00:06:23 UTC
2021-05-29 00:06:23 +00:00
||galcbheoo9.byethost33.com$all
Filter updated: Thu, 29 Jul 2021 00:01:57 +0000
2021-07-29 00:01:57 +00:00
||galiciabankimg.ihostfull.com$all
Filter updated: Thu, 22 Jul 2021 00:01:54 +0000
2021-07-22 00:01:54 +00:00
||galiciaspersonal.eshost.com.ar$all
Filter updated: Sat, 11 Sep 2021 00:34:15 +0000
2021-09-11 00:34:15 +00:00
||gambling1.ru.com$all
Filter updated: Sat, 14 Aug 2021 12:02:02 +0000
2021-08-14 12:02:02 +00:00
||gameofbet.info$all
Filter updated: Thu, 09 Sep 2021 00:01:56 +0000
2021-09-09 00:01:56 +00:00
||gameofbet.org$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||gamepit.mobi$all
Filter updated: Wed, 14 Jul 2021 00:03:28 +0000
2021-07-14 00:03:28 +00:00
||gamestoppc.com$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||gamingtools.xyz$all
Filter updated: Tue, 22 Jun 2021 00:06:28 +0000
2021-06-22 00:06:29 +00:00
||gardeniahotel.in$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||garena--freefire.com$all
Filter updated: Fri, 30 Jul 2021 12:01:52 +0000
2021-07-30 12:01:52 +00:00
||garenabaomatvipham.com$all
Filter updated: Thu, 02 Sep 2021 12:02:02 +0000
2021-09-02 12:02:02 +00:00
||gasterdeckbuilde.com$all
Filter updated: Sat, 11 Sep 2021 12:01:27 +0000
2021-09-11 12:01:27 +00:00
||gategrouphq-my.sharepoint.com/personal/blong_gategroup_com/_layouts/15/guestaccess.aspx?guestaccesstoken=jkghay3r4orn8wc0zd79dnyb04dbnmyodqfqq3l16ai%3d&docid=1_1301726a996e54eeeb9bb73b976ebfd9f&wdformid=%7bdb9d2414%2d67ae%2d4062%2d8a45%2dd2b36a1684b6%7dorganization$all
Filter updated: Tue, 14 Sep 2021 12:01:44 +0000
2021-09-14 12:01:44 +00:00
||gator3030.temp.domains$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||gawvs.in$all
Filter updated: Thu, 18 Feb 2021 00:06:34 UTC
2021-02-18 00:06:34 +00:00
||gayatriprojects.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||gbmfg-my.sharepoint.com/:x:/r/personal/lbuckner_gbfab_com/_layouts/15/wopiframe.aspx?guestaccesstoken=gdnrnx745yiwuqi1wzlf6w9k%2b6ozugek1niyoatemo4%3d&docid=1_1a36206e272bc431d8dfc6cbdca53c0b9&wdformid=%7b68959735%2da202%2d46a8%2dafa8%2d88abc1501bcf%7d&action=formsubmit$all
Filter updated: Wed, 28 Jul 2021 12:01:46 +0000
2021-07-28 12:01:46 +00:00
||gceporvrspacdswdhcxtczdzuc-dot-gowa11111111.rj.r.appspot.com$all
Filter updated: Sat, 12 Jun 2021 00:25:37 UTC
2021-06-12 00:25:37 +00:00
||gchronics.com$all
Filter updated: Thu, 23 Sep 2021 00:02:18 +0000
2021-09-23 00:02:18 +00:00
||gcmtraders.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||gdfgfgdfgfdgfdgfdgfdgfdgf.jimdofree.com$all
Filter updated: Wed, 25 Nov 2020 12:06:48 UTC
2020-11-25 12:06:48 +00:00
||ge-ge.snprobbx.pbz.r.de.a2ip.ru$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||geauxcartz.com$all
Filter updated: Wed, 22 Sep 2021 12:01:56 +0000
2021-09-22 12:01:56 +00:00
||gebaek-derman.eu$all
Filter updated: Sun, 20 Jun 2021 12:06:22 +0000
2021-06-20 12:06:22 +00:00
||geelongtrailers.com.au$all
Filter updated: Tue, 07 Sep 2021 00:01:46 +0000
2021-09-07 00:01:46 +00:00
||gelisimfilo.com.tr$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||gencon010-my.sharepoint.com/personal/rod_genconfoundation_ca/_layouts/15/wopiframe.aspx?guestaccesstoken=qbytax%2bl2vxnykfybitwe9%2fn%2b6efsyak3%2fwkifsixbw%3d&docid=1_133834fad9cd14e23a7158c9b824fb8dd&wdformid=%7b9dcdb876%2df09f%2d406d%2dab2b%2d0136fd43ab4d%7d&action=formsubmit$all
Filter updated: Sun, 15 Aug 2021 00:01:57 +0000
2021-08-15 00:01:57 +00:00
||generarba232.ultimatefreehost.in$all
Filter updated: Fri, 24 Sep 2021 00:01:50 +0000
2021-09-24 00:01:51 +00:00
||generarcita-sv.com$all
Filter updated: Thu, 29 Jul 2021 00:01:57 +0000
2021-07-29 00:01:57 +00:00
||generationalkidz.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||genie-alba.firebaseapp.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||gentle.camention.cn$all
Filter updated: Sun, 11 Jul 2021 12:01:37 +0000
2021-07-11 12:01:38 +00:00
||gestacultura.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||getactive365.com$all
Filter updated: Mon, 19 Apr 2021 00:06:54 UTC
2021-04-19 00:06:54 +00:00
||getapps.vip$all
Filter updated: Mon, 23 Nov 2020 12:06:43 UTC
2020-11-23 12:06:44 +00:00
||getco-genetics.com$all
Filter updated: Fri, 27 Aug 2021 00:01:47 +0000
2021-08-27 00:01:47 +00:00
||getfunding.pledesma.com$all
Filter updated: Tue, 16 Feb 2021 00:06:20 UTC
2021-02-16 00:06:20 +00:00
||getlikesfree.com$all
Filter updated: Sat, 24 Jul 2021 12:01:38 +0000
2021-07-24 12:01:38 +00:00
||getrealreview.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||gfhfhfgfhghgfhfghfghfgfg.jimdofree.com$all
Filter updated: Wed, 01 Sep 2021 12:01:58 +0000
2021-09-01 12:01:58 +00:00
||gfivesf-my.sharepoint.com/personal/adrian_vanschalkwyk_j-maynard_com/_layouts/15/onedrive.aspx?id=%2fpersonal%2fadrian%5fvanschalkwyk%5fj%2dmaynard%5fcom%2fdocuments%2fmda%2frevised%20financial%20proposal%20pdf%2e%20%2epdf&parent=%2fpersonal%2fadrian%5fvanschalkwyk%5fj%2dmaynard%5fcom%2fdocuments%2fmda&originalpath=ahr0chm6ly9nzml2zxnmlw15lnnoyxjlcg9pbnquy29tlzpioi9nl3blcnnvbmfsl2fkcmlhbl92yw5zy2hhbgt3ewtfai1tyxluyxjkx2nvbs9fwks0nk9wvxnvcevuoxzmofq5uzm1qujtdgjzcxjpcuk2q0c5owfomkjxv2zbp3j0aw1lpwnfdwfmze5imlvn$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||gfmfxefsrr-my.sharepoint.com/personal/jose_pozos_ferromex_mx/_layouts/15/doc.aspx?sourcedoc=%7b898ad54d-f65d-469d-9423-f005add906d1%7d&action=view&wd=target%28sveriges%20kommuner%20och%20regioner.one%7c824a1570-71a2-449b-8f1b-52edf0fb672c%2fsveriges%20kommuner%20och%20regioner%7c2911b9b7-5576-49e5-9af3-8fb42aa40f70%2f%29$all
Filter updated: Wed, 21 Jul 2021 12:01:49 +0000
2021-07-21 12:01:49 +00:00
||gfprcjvijumkuxtkftvpgdawkqrxrz.22web.org$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||gfxx.creatorlink.net$all
Filter updated: Mon, 20 Sep 2021 12:02:05 +0000
2021-09-20 12:02:05 +00:00
||gg-attorneys.ml$all
Filter updated: Mon, 06 Sep 2021 00:01:54 +0000
2021-09-06 00:01:54 +00:00
||gg.gg/caixa-liberar$all
Filter updated: Thu, 24 Jun 2021 00:06:35 +0000
2021-06-24 00:06:35 +00:00
||gg.gg/v3ngy$all
Filter updated: Thu, 02 Sep 2021 12:02:02 +0000
2021-09-02 12:02:02 +00:00
||gg.gg/vnb37$all
Filter updated: Wed, 18 Aug 2021 00:01:50 +0000
2021-08-18 00:01:50 +00:00
||gg.gg/vq7cw$all
Filter updated: Tue, 14 Sep 2021 12:01:44 +0000
2021-09-14 12:01:44 +00:00
||ggattorneys.tk$all
Filter updated: Thu, 05 Aug 2021 00:02:05 +0000
2021-08-05 00:02:05 +00:00
||ggivrrterxnndbcunfchzyeirxdcnv.22web.org$all
Filter updated: Thu, 02 Sep 2021 12:02:02 +0000
2021-09-02 12:02:02 +00:00
||ghanahealthservice.org/pur/excel/xl/link/excel/po/page.php?mylove=bwfyay53yw5nqhdpbndhewdsb2jhbc5jb20=&.rand=13vqcr8bp0gud&lc=1033&id=64855&mkt=en-us&cbcxt=mai&snsc=1$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||ghgfhgfhgfhgfgfdgfdgfdg.jimdofree.com$all
Filter updated: Fri, 07 May 2021 00:06:36 UTC
2021-05-07 00:06:36 +00:00
||ghislain.dartois.pagesperso-orange.fr$all
Filter updated: Sat, 14 Aug 2021 00:01:49 +0000
2021-08-14 00:01:49 +00:00
||ghoostheplain.byethost7.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||ghorana.com$all
Filter updated: Wed, 19 May 2021 00:06:43 UTC
2021-05-19 00:06:44 +00:00
||giftcards.allomoncoco.com$all
Filter updated: Sat, 28 Aug 2021 00:33:51 +0000
2021-08-28 00:33:51 +00:00
||giggleassist.top$all
Filter updated: Wed, 15 Sep 2021 00:01:54 +0000
2021-09-15 00:01:55 +00:00
||gionghatvietnhii2021.ga$all
Filter updated: Mon, 20 Sep 2021 00:01:41 +0000
2021-09-20 00:01:41 +00:00
||gipvpn.xyz$all
Filter updated: Wed, 17 Feb 2021 00:06:37 UTC
2021-02-17 00:06:37 +00:00
||giris-papara.net$all
Filter updated: Tue, 04 May 2021 00:15:58 UTC
2021-05-04 00:15:58 +00:00
||girlsgroupwhtsapponlysexxy.xxuz.com$all
Filter updated: Wed, 28 Jul 2021 12:01:46 +0000
2021-07-28 12:01:46 +00:00
||gismoi.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||gite-lafage.com$all
Filter updated: Sun, 22 Aug 2021 00:01:52 +0000
2021-08-22 00:01:52 +00:00
||gizmodo.jp/2021/07/amazon-wins-approval-to-track-your-sleep-with-iot-devic.html$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||gj3riqdasokdd67iptr.duckdns.org$all
Filter updated: Wed, 03 Mar 2021 12:14:44 UTC
2021-03-03 12:14:44 +00:00
||gjhanekamp.nl$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||gkjx168.com$all
Filter updated: Tue, 06 Jul 2021 12:02:08 +0000
2021-07-06 12:02:09 +00:00
||glamournailsbyleda.com$all
Filter updated: Thu, 03 Sep 2020 12:06:37 UTC
2020-09-03 12:06:37 +00:00
||glighting-my.sharepoint.com/personal/nick_glighting_com/_layouts/15/doc.aspx?sourcedoc={e0f676b4-a865-418d-bc53-76d3eceaf377}&action=default&slrid=ff713e9f-60ea-a000-8e05-346a19231873&originalpath=ahr0chm6ly9nbglnahrpbmctbxkuc2hhcmvwb2ludc5jb20vom86l3avbmljay9fcliyoxvcbhfjmuj2rk4ymc16ctgzy0j1c1n5dvdfn2xyrdzmv0lsn2syagtrp3j0aw1lpuj0m3pvwfrimtbn&cid=aaec3b1a-484c-4074-a782-e1cd778bff97$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||glighting-my.sharepoint.com/personal/nick_glighting_com/_layouts/15/wopiframe.aspx?sourcedoc={e0f676b4-a865-418d-bc53-76d3eceaf377}&action=default&originalpath=ahr0chm6ly9nbglnahrpbmctbxkuc2hhcmvwb2ludc5jb20vom86l3avbmljay9fcliyoxvcbhfjmuj2rk4ymc16ctgzy0j1c1n5dvdfn2xyrdzmv0lsn2syagtrp3j0aw1lpwlreglezzllmtbn$all
||glighting-my.sharepoint.com/personal/nick_glighting_com/_layouts/15/wopiframe2.aspx?sourcedoc={e0f676b4-a865-418d-bc53-76d3eceaf377}&action=default&originalpath=ahr0chm6ly9nbglnahrpbmctbxkuc2hhcmvwb2ludc5jb20vom86l3avbmljay9fcliyoxvcbhfjmuj2rk4ymc16ctgzy0j1c1n5dvdfn2xyrdzmv0lsn2syagtrp3j0aw1lpwlreglezzllmtbn$all
Filter updated: Wed, 22 Sep 2021 12:01:56 +0000
2021-09-22 12:01:56 +00:00
||glkinst.com/cool/china/?login=booking@leigarden.com.cn$all
Filter updated: Fri, 05 Feb 2021 00:06:10 UTC
2021-02-05 00:06:10 +00:00
||globailpage-prodwebex.com$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||global-paxful.com$all
Filter updated: Wed, 22 Sep 2021 00:02:26 +0000
2021-09-22 00:02:26 +00:00
||globalhsbcsecurity.com$all
Filter updated: Thu, 01 Apr 2021 00:06:39 UTC
2021-04-01 00:06:40 +00:00
||globalinfohost.com/landingpage/dd263864-38a2-466a-be2f-4e5ec6c5e042/hctn-cqfifpe_okkklcw-nsctyxgdac6usniyjmrh7m$all
Filter updated: Wed, 24 Mar 2021 12:06:42 UTC
2021-03-24 12:06:42 +00:00
||globalinfohost.com/landingpage/dd263864-38a2-466a-be2f-4e5ec6c5e042/mthzm4r_hzib_ekunll2tnc0tdjldeg0lh9s9kemwws$all
Filter updated: Thu, 01 Apr 2021 00:06:39 UTC
2021-04-01 00:06:40 +00:00
||globalinfohost.com/landingpage/dd263864-38a2-466a-be2f-4e5ec6c5e042/ugzr6e6b0olivxmwctp66vpd4qal3nwpppq4navl15m$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||globalinfohost.com/landingpage/dd263864-38a2-466a-be2f-4e5ec6c5e042/zxqjpp1gb4lq5of1ybf2hh3bzqkozcti6eqs65netfg$all
||globalnetinternet.com/js/netflix/refund/$all
||globalnetinternet.com/online_islemler_web/connect/new/netflix$all
||globalnetinternet.com/online_islemler_web/connect/new/netflix/store/us-en167/$all
||globalnetinternet.com/online_islemler_web/connect/new/netflix/store/us-en969$all
||globalnetinternet.com/online_islemler_web/connect/new/netflix/store/us-en969/$all
Filter updated: Tue, 30 Mar 2021 00:06:27 UTC
2021-03-30 00:06:27 +00:00
||globalpage-prodwebex.com$all
Filter updated: Wed, 24 Mar 2021 12:06:42 UTC
2021-03-24 12:06:42 +00:00
||glogo.org$all
Filter updated: Sun, 16 May 2021 00:06:38 UTC
2021-05-16 00:06:38 +00:00
||glomediamarketinginstitute.com$all
Filter updated: Tue, 11 May 2021 12:06:36 UTC
2021-05-11 12:06:36 +00:00
||glossmeup.ae$all
Filter updated: Wed, 25 Aug 2021 00:01:57 +0000
2021-08-25 00:01:57 +00:00
||glr-auth.cf$all
||glr-authe.tk$all
Filter updated: Wed, 25 Aug 2021 12:02:06 +0000
2021-08-25 12:02:07 +00:00
||glr-autheti.ga$all
Filter updated: Thu, 09 Sep 2021 00:01:56 +0000
2021-09-09 00:01:56 +00:00
||glr-autheti.gq$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||glsword.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||gmail-phone-support.com$all
Filter updated: Fri, 12 Feb 2021 12:06:36 UTC
2021-02-12 12:06:37 +00:00
||gmaillgve.ebpages.com$all
Filter updated: Fri, 17 Sep 2021 00:01:45 +0000
2021-09-17 00:01:46 +00:00
||gmall-involceview-verilog-auth.pages.dev$all
Filter updated: Wed, 08 Sep 2021 00:02:08 +0000
2021-09-08 00:02:08 +00:00
||gmwdigital.in$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||gmx-aktualisierung.yolasite.com$all
Filter updated: Wed, 28 Apr 2021 00:06:29 UTC
2021-04-28 00:06:29 +00:00
||gmxmailme.yolasite.com$all
Filter updated: Sat, 18 Sep 2021 12:01:34 +0000
2021-09-18 12:01:34 +00:00
||gnrhealth.cf$all
Filter updated: Wed, 16 Jun 2021 00:06:45 +0000
2021-06-16 00:06:45 +00:00
||gns.io/viabcp$all
Filter updated: Tue, 21 Sep 2021 12:02:11 +0000
2021-09-21 12:02:11 +00:00
||go.sparkasse-sicherer-login.de$all
Filter updated: Tue, 15 Sep 2020 00:06:22 UTC
2020-09-15 00:06:22 +00:00
||gofreegovernmentmoney.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||goginger.proptimisetechnology.com$all
Filter updated: Tue, 17 Aug 2021 12:01:39 +0000
2021-08-17 12:01:39 +00:00
||goglemaps.co$all
Filter updated: Thu, 08 Apr 2021 00:06:59 UTC
2021-04-08 00:06:59 +00:00
||goldcoastrhinoplasty.com.au$all
Filter updated: Thu, 05 Aug 2021 00:02:05 +0000
2021-08-05 00:02:05 +00:00
||goldenlasgidi10.web.app$all
Filter updated: Thu, 26 Aug 2021 00:02:01 +0000
2021-08-26 00:02:01 +00:00
||goldpackrio.com.br$all
Filter updated: Fri, 09 Apr 2021 00:06:41 UTC
2021-04-09 00:06:41 +00:00
||goldpackrio.com.br/nvrptkuinv.html?jhbfdxeazsxdfcygvbhubnijnononjiuhbgvvgfcfxdsezxrdfcgvhbgvcfd$all
Filter updated: Tue, 21 Sep 2021 00:01:40 +0000
2021-09-21 00:01:40 +00:00
||goldvipescort.es$all
Filter updated: Wed, 22 Sep 2021 12:01:56 +0000
2021-09-22 12:01:56 +00:00
||golfballsonline.com$all
Filter updated: Sat, 26 Jun 2021 12:06:10 +0000
2021-06-26 12:06:10 +00:00
||goo.gl/yozuaz$all
Filter updated: Thu, 22 Oct 2020 00:06:29 UTC
2020-10-22 00:06:29 +00:00
||goo.su/page/about$all
||goo.su/page/rules$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||goocruxainsificansion.com$all
Filter updated: Sun, 15 Aug 2021 12:01:40 +0000
2021-08-15 12:01:40 +00:00
||good12345.tripod.com$all
Filter updated: Fri, 02 Jul 2021 12:01:53 +0000
2021-07-02 12:01:53 +00:00
||goodiegirlscupcakes.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||google-quality-rater-audit.com$all
Filter updated: Thu, 22 Apr 2021 12:08:20 UTC
2021-04-22 12:08:20 +00:00
||google.accoumts.ga$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||google.com.br/search?q=suporte+itau$all
Filter updated: Tue, 24 Aug 2021 00:02:23 +0000
2021-08-24 00:02:24 +00:00
||google.com/url?hl=en-us&q=http://3214003.remaxcapitals.com/&sa=d&source=meet&ust=1624122560720000&usg=afqjcnhwftmstoowfxkgstiqfgifukkveq$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||google.com/url?q=http://srv-auth.web.app/upd/index.html%23%5b%5b-email-%5d%5d&source=gmail&ust=1607952068298000&usg=afqjcnet34jepejaewvja8unv7ycds1vjg$all
||google.com/url?q=https%3a%2f%2fmzecz.webeden.co.uk&sa=d&sntz=1&usg=afqjcnh1ztf5yvm-siyhw9c4ndil6ms7qa$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||google.com/url?q=https%3a%2f%2futcz.weebly.com&sa=d&sntz=1&usg=afqjcngdpz7pfk-brjpkuutxdwb4h3rlsw$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||google.com/url?q=https%3a%2f%2fwcze.weebly.com&sa=d&sntz=1&usg=afqjcneb-aqy-rdcgvkoko781u108eggxw$all
||google.com/url?q=https://chungcuvinhomessmartcity.com.vn/wp-content/fan/update/update/index.php?email%3d%5b%5b-email-%5d%5d&source=gmail&ust=1601526775264000&usg=afqjcnh2cow19dlgy8epljp37gqo0awthw$all
||google.com/url?q=https://duodanseclub.fr//nh/rd/logon/?email%3d%5b%5b-email-%5d%5d&source=gmail&ust=1593678623293000&usg=afqjcnhq3h-kf1tmy7iq1nwza8yz6k4xmq$all
Filter updated: Tue, 20 Jul 2021 12:01:48 +0000
2021-07-20 12:01:48 +00:00
||google.com/url?q=https://firebasestorage.googleapis.com/v0/b/bmf1406rplpil.appspot.com/o/bmf1406replpil%252findex2bmf0306famegen-040447d066cb774f1.html?alt%3dmedia%26token%3d2205d63d-f15d-4f03-b27a-a81b473b81a4%23%5b%5b-email-%5d%5d&source=gmail&ust=1625561695699000&usg=afqjcnhdvz1aajb9caf_hdl5vkxquj0iog$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||google.com/url?q=https://passionfruit4576261.brizy.site/&source=gmail&ust=1608664764243000&usg=afqjcnghljnr1tyn8j4c1ijid09ra9ehdq$all
||google.com/url?q=https://us4-usndr.com/ru/mail_link_tracker?hash%3d6k5ar5ciusdx1q1tdgm8atcrexmonyy3xdfiogu7zr6gb6gtthpqk7fm8tz4gzkjftg9oouu31eqdro67dtgwnn5x1p3ziiieq8rykja%26url%3dahr0chm6ly90lm1ll2fhegnvbw11bml0eq~~%26uid%3dndmwndy3nw~~%26ucs%3dd93ed45d47070739243d9b678dd03e93&source=gmail&ust=1607288611770000&usg=afqjcngo5kdwx08p-bg6mzdtluzdjhtzxw$all
Filter updated: Fri, 21 May 2021 12:06:31 UTC
2021-05-21 12:06:31 +00:00
||google.com/url?q=https://webstar-connect.weebly.com&source=gmail&ust=1620915131083000&usg=afqjcnfuzfi8hwqislot7koopf3sh9xsdg$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||google.com/url?sa=d&q=https://appengine.google.com/_ah/logout?continue=https://hangouts.google.com/linkredirect?dest=https://schwarz.id.au/recipe//wp-content/--/https:/retail.santander.co.uk/?cliente=ardellasmith@prepaidlegal.com$all
||google.com/url?sa=t&rct=j&q=&esrc=s&source=web&cd=&cad=rja&uact=8&ved=2ahukewiptyxoicttahw1mfwkhaz_cigqfjabegqibbac&url=https://yoga.gift/hello-world/&usg=aovvaw1ac3xuoh8rl8htbwhsbtqy$all
||google.com/url?sa=t&rct=j&q=&esrc=s&source=web&cd=&cad=rja&uact=8&ved=2ahukewj997bwwr_uahu6bgmbhue6b44qfjaaegqiahac&url=https%3a%2f%2fsitus99dominoqq.com%2f&usg=aovvaw0_cbun7nnl19bpyx5-dyip$all
Filter updated: Fri, 30 Jul 2021 00:01:47 +0000
2021-07-30 00:01:47 +00:00
||google.com/url?sa=t&rct=j&q=&esrc=s&source=web&cd=&cad=rja&uact=8&ved=2ahukewjvtam1_9dwahxjpj4khyndc-yqfjaaegqibxad&url=https%3a%2f%2fvzk.co.za%2f&usg=aovvaw1jap4fxa7zb0pnmzjp351q$all
Filter updated: Mon, 19 Apr 2021 00:06:54 UTC
2021-04-19 00:06:54 +00:00
||googleads.g.doubleclick.net/pcs/click?adurl=https://lcdjh.codesandbox.io/#stevewilliamson@legalshieldcorp.com$all
Filter updated: Tue, 07 Sep 2021 12:01:49 +0000
2021-09-07 12:01:49 +00:00
||googleweblight.com/i?u=5cee2623.shared-excel-f0ssozzz.pages.dev?shared=byrdww1@widomaker.com$all
Filter updated: Sun, 25 Jul 2021 00:01:57 +0000
2021-07-25 00:01:58 +00:00
||googleweblight.com/i?u=a894ec7f.46t33454t4.pages.dev?user=masoli@legalshieldassociate.com$all
Filter updated: Fri, 17 Sep 2021 12:01:51 +0000
2021-09-17 12:01:52 +00:00
||googleweblight.com/i?u=b4e921f0.sso-mailsrvr-4344e5teed.pages.dev?user=abuse@gmail.com$all
Filter updated: Wed, 23 Jun 2021 00:06:32 +0000
2021-06-23 00:06:32 +00:00
||gorgas.gob.pa$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||gormanusa-my.sharepoint.com/:x:/r/personal/tspencer_gormanusa_com/_layouts/15/wopiframe.aspx?guestaccesstoken=wgfwcmmssvdsofa7ljviwaj85tleclug2xbvoqwlmp0%3d&docid=1_12424441d8c29412bb868684e5cb74e47&wdformid=%7b992e319a%2dbe72%2d460b%2db6b4%2d2d3fcf789fc5%7d&action=formsubmit$all
Filter updated: Thu, 22 Oct 2020 00:06:29 UTC
2020-10-22 00:06:29 +00:00
||gornjimilanovac.rs$all
Filter updated: Sat, 17 Apr 2021 00:06:31 UTC
2021-04-17 00:06:31 +00:00
||gosafes.com$all
Filter updated: Wed, 01 Sep 2021 00:02:20 +0000
2021-09-01 00:02:20 +00:00
||gosalair.com$all
Filter updated: Thu, 26 Aug 2021 12:02:31 +0000
2021-08-26 12:02:31 +00:00
||gotholdng.com$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||gourtt-manta2-ec.hostkda.com$all
Filter updated: Wed, 15 Sep 2021 12:01:46 +0000
2021-09-15 12:01:46 +00:00
||gouttierespj.com$all
Filter updated: Fri, 15 Jan 2021 00:06:14 UTC
2021-01-15 00:06:14 +00:00
||gov.uk-dvla.org$all
Filter updated: Tue, 20 Jul 2021 12:01:48 +0000
2021-07-20 12:01:48 +00:00
||governmentgrants.godaddysites.com$all
Filter updated: Sat, 28 Aug 2021 12:01:47 +0000
2021-08-28 12:01:47 +00:00
||govkn.knorish.com$all
Filter updated: Tue, 17 Aug 2021 00:02:45 +0000
2021-08-17 00:02:45 +00:00
||govtfundnow.com$all
Filter updated: Thu, 17 Jun 2021 00:06:32 +0000
2021-06-17 00:06:32 +00:00
||gpbom.codesandbox.io$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||gpubr.cn$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||grabyourcode.com$all
Filter updated: Wed, 28 Jul 2021 00:02:03 +0000
2021-07-28 00:02:03 +00:00
||gradcracker.com/out/408?jobid=29207&u=princed.de?id=8400239909$all
Filter updated: Mon, 20 Sep 2021 12:02:05 +0000
2021-09-20 12:02:05 +00:00
||grand-chang.top$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||grandbettinggir2.blogspot.com$all
Filter updated: Wed, 25 Aug 2021 12:02:06 +0000
2021-08-25 12:02:07 +00:00
||grandcaymanfoodie.com$all
Filter updated: Wed, 22 Sep 2021 12:01:56 +0000
2021-09-22 12:01:56 +00:00
||grandhighwayresort.com/phts/copie/hhhhh.php?email=edw@bibliopoleio.org$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||grandmarketltd.co.uk$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||granttax.com$all
Filter updated: Tue, 24 Aug 2021 12:02:00 +0000
2021-08-24 12:02:00 +00:00
||graudez.com.br$all
Filter updated: Thu, 24 Jun 2021 12:06:27 +0000
2021-06-24 12:06:27 +00:00
||greaterlovefoundation.org$all
Filter updated: Thu, 25 Mar 2021 12:06:39 UTC
2021-03-25 12:06:39 +00:00
||greatmusica.com$all
Filter updated: Fri, 11 Sep 2020 12:06:39 UTC
2020-09-11 12:06:39 +00:00
||gregmounsey.com$all
Filter updated: Mon, 22 Feb 2021 00:09:17 UTC
2021-02-22 00:09:17 +00:00
||gremio.net/noticias/$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||grespokhg.agilecrm.com$all
Filter updated: Sat, 03 Jul 2021 00:01:56 +0000
2021-07-03 00:01:56 +00:00
||grin.co.rs$all
Filter updated: Thu, 26 Nov 2020 00:06:18 UTC
2020-11-26 00:06:18 +00:00
||grms.cit.net$all
Filter updated: Tue, 02 Feb 2021 12:06:42 UTC
2021-02-02 12:06:42 +00:00
||grosshandel-mevida.de$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||grottedisaledesenzano.com$all
Filter updated: Sun, 19 Sep 2021 00:02:16 +0000
2021-09-19 00:02:17 +00:00
||groundforcelogistics.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||group-18-sans.wikaba.com$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||groupevosnotnot.duckdns.org$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||groupwhattsap.jkub.com$all
Filter updated: Fri, 21 May 2021 12:06:31 UTC
2021-05-21 12:06:31 +00:00
||growasiacapital.id$all
Filter updated: Thu, 01 Apr 2021 00:06:39 UTC
2021-04-01 00:06:40 +00:00
||groworldinternational.com$all
Filter updated: Tue, 14 Sep 2021 12:01:44 +0000
2021-09-14 12:01:44 +00:00
||grp01.id.rakuten.co.jp$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||grub-wa-kakriri.duckdns.org$all
||grub-wa-viral2021.duckdns.org$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||grubbokep22.mrbonus.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||grubwabangletdahyper113.duckdns.org$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||grubwhatsaapterbaru.duckdns.org$all
Filter updated: Mon, 09 Aug 2021 00:02:27 +0000
2021-08-09 00:02:27 +00:00
||gruoup-whatsapp.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||grup-viral-18-terbaru1.duckdns.org$all
Filter updated: Thu, 03 Sep 2020 12:06:37 UTC
2020-09-03 12:06:37 +00:00
||grup-wa-bokep18.wikaba.com$all
||grup-whatsappsexy.xxuz.com$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||grupbokephot2021.duckdns.org$all
Filter updated: Wed, 04 Nov 2020 00:06:25 UTC
2020-11-04 00:06:25 +00:00
||grupoabi.cl$all
Filter updated: Thu, 16 Sep 2021 12:02:15 +0000
2021-09-16 12:02:15 +00:00
||grupofsp.com.br$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||grupopromeric.webcindario.com$all
Filter updated: Tue, 15 Dec 2020 12:06:46 UTC
2020-12-15 12:06:46 +00:00
||gruposcherman.com.br$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||grupwa18-tys.wikaba.com$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||grupwatanteempotbokep21.duckdns.org$all
Filter updated: Tue, 27 Apr 2021 00:06:47 UTC
2021-04-27 00:06:47 +00:00
||gscommunityspirit.greenschool.org$all
Filter updated: Tue, 25 May 2021 12:06:34 UTC
2021-05-25 12:06:34 +00:00
||gtaswansea.org$all
Filter updated: Tue, 21 Sep 2021 12:02:11 +0000
2021-09-21 12:02:11 +00:00
||gtroot.edulinellc.mn$all
Filter updated: Thu, 29 Jul 2021 00:01:57 +0000
2021-07-29 00:01:57 +00:00
||gtsukxrxiiumhxjcdsdlrgthqc-dot-gowa11111111.rj.r.appspot.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||gudanggamismuslimah.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||guiltless-childlike-croissant.glitch.me$all
Filter updated: Mon, 25 Jan 2021 00:06:27 UTC
2021-01-25 00:06:27 +00:00
||gwenet.org$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||gwisalltrack.com$all
Filter updated: Wed, 19 May 2021 00:06:43 UTC
2021-05-19 00:06:44 +00:00
||gwred.4ik87425pj-354refd.workers.dev$all
Filter updated: Wed, 09 Jun 2021 00:06:30 UTC
2021-06-09 00:06:31 +00:00
||gz32tf89tx00xz.byethost11.com$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||h5-chase.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||h5-chase.com/login?chase_id=57e5b8562f3498f56b232443b&country=united%20states&iso=us$all
Filter updated: Fri, 04 Sep 2020 00:06:23 UTC
2020-09-04 00:06:23 +00:00
||h5brzd.webwave.dev$all
Filter updated: Wed, 22 Sep 2021 00:02:26 +0000
2021-09-22 00:02:26 +00:00
||h5p.roboticamexico.com.mx$all
||h5p.roboticamexico.com.mx/oo/china/?login=amachinist@icmtalent.com$all
Filter updated: Wed, 15 Sep 2021 12:01:46 +0000
2021-09-15 12:01:46 +00:00
||h62g.nichesite.org$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||habbocreditosparati.blogspot.com$all
Filter updated: Sat, 14 Aug 2021 12:02:02 +0000
2021-08-14 12:02:02 +00:00
||habibassociatesbd.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||habitatinmobiliario.com.ar$all
Filter updated: Thu, 22 Jul 2021 00:01:54 +0000
2021-07-22 00:01:54 +00:00
||hagalepuesmijo.byethost32.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||hahdaeupdate.es.tl$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||hakiy26789.temp.swtest.ru$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||halaisabudhabi.com$all
Filter updated: Tue, 05 Jan 2021 00:06:22 UTC
2021-01-05 00:06:22 +00:00
||hali-securesuite.com$all
Filter updated: Wed, 03 Mar 2021 12:14:44 UTC
2021-03-03 12:14:44 +00:00
||halifax-checkthispayee.com$all
Filter updated: Mon, 09 Aug 2021 00:02:27 +0000
2021-08-09 00:02:27 +00:00
||halifax-direct.com$all
Filter updated: Mon, 09 Aug 2021 12:01:58 +0000
2021-08-09 12:01:58 +00:00
||halifax-direct.com/login.php$all
Filter updated: Sun, 17 Jan 2021 12:06:48 UTC
2021-01-17 12:06:48 +00:00
||halifax-online-bank.com$all
Filter updated: Tue, 05 Jan 2021 12:06:21 UTC
2021-01-05 12:06:22 +00:00
||halifax-securelink.com$all
Filter updated: Fri, 15 Jan 2021 00:06:14 UTC
2021-01-15 00:06:14 +00:00
||halifax-security-de-register-device.com$all
Filter updated: Mon, 19 Apr 2021 00:06:54 UTC
2021-04-19 00:06:54 +00:00
||halifax.deregister-cancellation-payee-secure-auth.com$all
Filter updated: Sat, 12 Dec 2020 12:06:38 UTC
2020-12-12 12:06:38 +00:00
||haliuk-secure-device.com$all
Filter updated: Tue, 21 Sep 2021 12:02:11 +0000
2021-09-21 12:02:11 +00:00
||hamzabilisim.net$all
Filter updated: Tue, 07 Sep 2021 12:01:49 +0000
2021-09-07 12:01:49 +00:00
||handyhelp.eu$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||hangouts.google.com/linkredirect?dest=https://maxsushi.com.br/hay/wp-admin/network/banco-santander/home/particulares.php$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||hannetjiefaurie1.creatorlink.net$all
Filter updated: Sat, 22 May 2021 12:07:44 UTC
2021-05-22 12:07:44 +00:00
||hans-ledlite.com$all
Filter updated: Mon, 28 Dec 2020 12:06:19 UTC
2020-12-28 12:06:19 +00:00
||haogege.52yjh.top$all
Filter updated: Sun, 23 May 2021 12:06:28 UTC
2021-05-23 12:06:28 +00:00
||happyhouru.com$all
Filter updated: Wed, 16 Sep 2020 00:06:28 UTC
2020-09-16 00:06:29 +00:00
||haroldhazard1-wixsite-com.filesusr.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||harrisonk12msus-my.sharepoint.com/personal/kwawrek_harrison_k12_ms_us/_layouts/15/wopiframe2.aspx?sourcedoc={a34fc0e4-2e3b-42d1-ad85-1863c29f8bf8}&action=default&originalpath=ahr0chm6ly9oyxjyaxnvbmsxmm1zdxmtbxkuc2hhcmvwb2ludc5jb20vom86l2cvcgvyc29uywwva3dhd3jla19oyxjyaxnvbl9rmtjfbxnfdxmvrxvuqvq2ttdmdezdcllvwvk4s2zpx2dcn2vkvthfavvvoxr4dje0m1rvae9fqt9ydgltzt1usjyyoufsndewzw$all
Filter updated: Tue, 13 Jul 2021 00:02:30 +0000
2021-07-13 00:02:30 +00:00
||hasadom1.com$all
Filter updated: Wed, 02 Jun 2021 12:06:27 UTC
2021-06-02 12:06:28 +00:00
||hasmob.com$all
Filter updated: Wed, 10 Mar 2021 00:08:04 UTC
2021-03-10 00:08:05 +00:00
||hasseanhannitybeenwaterboarded.com$all
Filter updated: Thu, 09 Sep 2021 00:01:56 +0000
2021-09-09 00:01:56 +00:00
||havanaturbahamas.com$all
Filter updated: Tue, 21 Sep 2021 12:02:11 +0000
2021-09-21 12:02:11 +00:00
||havenscloudkitchen.com$all
Filter updated: Wed, 11 Aug 2021 12:01:50 +0000
2021-08-11 12:01:50 +00:00
||hb-promerica-sv.ultimatefreehost.in$all
Filter updated: Thu, 19 Aug 2021 00:01:47 +0000
2021-08-19 00:01:47 +00:00
||hb-promerica.hostfree.pw$all
Filter updated: Tue, 23 Mar 2021 12:16:28 UTC
2021-03-23 12:16:28 +00:00
||hbomaxfreetrial.com$all
Filter updated: Thu, 29 Jul 2021 00:01:57 +0000
2021-07-29 00:01:57 +00:00
||hc1.checker.in$all
Filter updated: Thu, 09 Sep 2021 12:02:27 +0000
2021-09-09 12:02:27 +00:00
||hcnprdvz.azureedge.net$all
Filter updated: Tue, 31 Aug 2021 00:01:55 +0000
2021-08-31 00:01:55 +00:00
||hcps-auth.ga$all
Filter updated: Sun, 29 Nov 2020 12:06:41 UTC
2020-11-29 12:06:41 +00:00
||hdmediahub.club$all
Filter updated: Wed, 08 Sep 2021 00:02:08 +0000
2021-09-08 00:02:08 +00:00
||hdsp.cf$all
Filter updated: Sun, 15 Aug 2021 12:01:40 +0000
2021-08-15 12:01:40 +00:00
||he-lp-desk.my-free.website$all
Filter updated: Thu, 15 Jul 2021 12:01:53 +0000
2021-07-15 12:01:53 +00:00
||heaterintwintersz.ams3.digitaloceanspaces.com/yuhgbfvdfvbtytrvdfbgt.html$all
Filter updated: Thu, 29 Jul 2021 00:01:57 +0000
2021-07-29 00:01:57 +00:00
||hebrjlndybbemhtixfyxhwefxc-dot-gowa11111111.rj.r.appspot.com$all
Filter updated: Fri, 03 Sep 2021 12:01:48 +0000
2021-09-03 12:01:48 +00:00
||heenakala.com$all
Filter updated: Sat, 11 Sep 2021 12:01:27 +0000
2021-09-11 12:01:27 +00:00
||heihotels0-my.sharepoint.com/personal/bderbins_astorneworleans_com/_layouts/15/onedrive.aspx?id=%2fpersonal%2fbderbins%5fastorneworleans%5fcom%2fdocuments%2fw%2d9%20and%20invoice%2epdf&parent=%2fpersonal%2fbderbins%5fastorneworleans%5fcom%2fdocuments&wdlor=c84a244f8%2dceed%2d4815%2da674%2d903fa6dec865&ct=1625767941311&or=outlook%2dbody&cid=a6ed5c15%2d56cc%2d4979%2da9e2%2d3c810203bfc8&originalpath=ahr0chm6ly9ozwlob3rlbhmwlw15lnnoyxjlcg9pbnquy29tlzpioi9nl3blcnnvbmfsl2jkzxjiaw5zx2fzdg9ybmv3b3jszwfuc19jb20vrwvutmrtrxmwzkjnbej2nlb1xznoeelcx2pfzgcymzhcoellexd1cwi0buvrzz9ydgltzt1salzdnwp0qzjvzw$all
Filter updated: Sun, 28 Mar 2021 12:06:32 UTC
2021-03-28 12:06:32 +00:00
||helloparis.co.uk$all
Filter updated: Tue, 02 Feb 2021 00:22:14 UTC
2021-02-02 00:22:15 +00:00
||help-dbs.net$all
Filter updated: Tue, 14 Sep 2021 12:01:44 +0000
2021-09-14 12:01:44 +00:00
||help.ccemlimited.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||helpdesk-tech.com$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||helpdoors.com$all
Filter updated: Mon, 20 Sep 2021 00:01:41 +0000
2021-09-20 00:01:41 +00:00
||helppageconfirmingservice.co.vu$all
Filter updated: Mon, 30 Aug 2021 00:02:03 +0000
2021-08-30 00:02:03 +00:00
||helppss-konfiguresion131wq.cf$all
Filter updated: Wed, 01 Sep 2021 00:02:20 +0000
2021-09-01 00:02:20 +00:00
||helppss-validtionss131wq.gq$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||helpsprotectionspagesidentity2021.co.vu$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||heppler.ch.net2care.com$all
||hepsbahis01.blogspot.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||hepsibahiis1.blogspot.com$all
||hepsibahisgirisimiz.blogspot.com$all
||hepsibahisgirisimiz1.blogspot.com$all
||hepsibahisgirisimiz4.blogspot.com$all
Filter updated: Sun, 19 Sep 2021 00:02:16 +0000
2021-09-19 00:02:17 +00:00
||hermes.pay-depot-fee.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||hetershaven.net$all
Filter updated: Thu, 22 Apr 2021 00:06:42 UTC
2021-04-22 00:06:42 +00:00
||hetrios.com.br$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||hetsa.com.mx$all
Filter updated: Sat, 21 Nov 2020 12:06:40 UTC
2020-11-21 12:06:40 +00:00
||heylink.me/halooweeks$all
||heylink.me/halooweeks/$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||heylink.me/pubgevent.com/$all
Filter updated: Sat, 21 Nov 2020 12:06:40 UTC
2020-11-21 12:06:40 +00:00
||heylink.me/pubgmxpink$all
||heylink.me/pubgmxpink/$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||hgn2t.app.link$all
Filter updated: Fri, 24 Sep 2021 00:01:50 +0000
2021-09-24 00:01:51 +00:00
||hgvbhjnkm-sdrftgyhujik-ftvgbhjnmk.s3.amazonaws.com/index.html$all
Filter updated: Wed, 28 Jul 2021 12:01:46 +0000
2021-07-28 12:01:46 +00:00
||hhfbvwvajbcdjgvjetczgtqdqq-dot-gowa11111111.rj.r.appspot.com$all
Filter updated: Wed, 15 Sep 2021 00:01:54 +0000
2021-09-15 00:01:55 +00:00
||hhfjjehnnnmkkfjnmmju.odoo.com$all
Filter updated: Sun, 15 Aug 2021 00:01:57 +0000
2021-08-15 00:01:57 +00:00
||hhqqmmylkgw.typeform.com$all
Filter updated: Fri, 02 Jul 2021 12:01:53 +0000
2021-07-02 12:01:53 +00:00
||hhtinvestments.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||hide-windows.com$all
Filter updated: Sat, 11 Sep 2021 12:01:27 +0000
2021-09-11 12:01:27 +00:00
||higufytdfghlk98.weeblysite.com$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||himalkom.cs.ipb.ac.id$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||hindmovie.cc$all
Filter updated: Tue, 14 Sep 2021 00:01:48 +0000
2021-09-14 00:01:48 +00:00
||hismarthomes.com$all
Filter updated: Tue, 13 Oct 2020 12:06:53 UTC
2020-10-13 12:06:53 +00:00
||hitman71hd-wixsite-com.filesusr.com$all
Filter updated: Sat, 17 Jul 2021 12:01:37 +0000
2021-07-17 12:01:37 +00:00
||hitpe.com$all
Filter updated: Mon, 16 Aug 2021 00:01:59 +0000
2021-08-16 00:01:59 +00:00
||hjkfgx.tk$all
Filter updated: Sun, 11 Jul 2021 12:01:37 +0000
2021-07-11 12:01:38 +00:00
||hjkfj.ml$all
Filter updated: Wed, 26 May 2021 12:06:39 UTC
2021-05-26 12:06:39 +00:00
||hk.mikecrm.com$all
Filter updated: Sun, 06 Dec 2020 12:06:47 UTC
2020-12-06 12:06:47 +00:00
||hm-revenue-costums.ciclosew.com$all
Filter updated: Thu, 17 Jun 2021 00:06:32 +0000
2021-06-17 00:06:32 +00:00
||hm.ru$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||hmlkl.codesandbox.io$all
||hmp.me$all
Filter updated: Mon, 20 Sep 2021 12:02:05 +0000
2021-09-20 12:02:05 +00:00
||hmu.karmatechmediaworks.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||hn5a5e0c82ac790-my.sharepoint.com/personal/nikki_dichtbijbewindvoering_nl/_layouts/15/doc.aspx?sourcedoc={ef44db5f-3971-4c6a-9e82-d60549b02d7e}&action=default&slrid=78fd619f-a0c1-b000-0906-3d2070fc6157&originalpath=ahr0chm6ly9objvhnwuwyzgyywm3otatbxkuc2hhcmvwb2ludc5jb20vom86l2cvcgvyc29uywwvbmlra2lfzgljahriawpizxdpbmr2b2vyaw5nx25sl0vsx2jstzl4t1dwtw5vtfdcvw13tfg0qmjrqkzsqjj2btnowvjmzy1es3bnt2c_cnrpbwu9ngozetb6c2uyrwc&cid=8e1bb722-e3a4-431c-8a7e-b9cf9e338342$all
Filter updated: Fri, 10 Sep 2021 12:02:02 +0000
2021-09-10 12:02:02 +00:00
||hof-barth.de$all
Filter updated: Fri, 16 Oct 2020 00:06:22 UTC
2020-10-16 00:06:22 +00:00
||holatoronto.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||hold-account.finecashflow.com$all
Filter updated: Tue, 29 Dec 2020 12:06:20 UTC
2020-12-29 12:06:20 +00:00
||holdmembershipntfx.aulaseidec.com$all
Filter updated: Wed, 18 Nov 2020 12:07:14 UTC
2020-11-18 12:07:14 +00:00
||holidayinnboston.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||holiganguncelgir.blogspot.com$all
Filter updated: Wed, 22 Sep 2021 12:01:56 +0000
2021-09-22 12:01:56 +00:00
||holiloa.site$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||holina-ne.tk$all
Filter updated: Mon, 02 Aug 2021 12:01:44 +0000
2021-08-02 12:01:44 +00:00
||hollubarsch.de$all
Filter updated: Mon, 16 Aug 2021 12:01:42 +0000
2021-08-16 12:01:42 +00:00
||holyrichesglobal.com$all
Filter updated: Sun, 18 Apr 2021 12:06:55 UTC
2021-04-18 12:06:55 +00:00
||home.ei1ns.de$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||home.myfairpoint.net$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||homebak1lgalici.byethost31.com$all
||homefairbd.com$all
Filter updated: Mon, 15 Mar 2021 12:43:24 UTC
2021-03-15 12:43:24 +00:00
||homesinlogin.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||homologacao.madrugadaolanches.com.br$all
Filter updated: Wed, 09 Dec 2020 00:06:46 UTC
2020-12-09 00:06:46 +00:00
||homs.com.br$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||honda4fun.com$all
Filter updated: Fri, 04 Jun 2021 00:06:37 UTC
2021-06-04 00:06:37 +00:00
||honeygarden.in$all
Filter updated: Wed, 27 Jan 2021 12:06:59 UTC
2021-01-27 12:06:59 +00:00
||honeyhyper.com$all
Filter updated: Fri, 17 Sep 2021 12:01:51 +0000
2021-09-17 12:01:52 +00:00
||honorary-detachment.000webhostapp.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||honorswap.finance$all
Filter updated: Sat, 28 Aug 2021 00:33:51 +0000
2021-08-28 00:33:51 +00:00
||hope-polska.live$all
Filter updated: Tue, 15 Jun 2021 12:29:08 UTC
2021-06-15 12:29:08 +00:00
||hopeforfuture.org.in$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||horizon-to.fr$all
Filter updated: Fri, 28 May 2021 12:06:27 UTC
2021-05-28 12:06:27 +00:00
||horosho.house$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||hospedagem.conexaototal.net$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||hosting2021623.online.pro$all
||hosting2024700.online.pro$all
||hosting2042037.online.pro$all
||hosting2070987.online.pro$all
||hosting2086464.online.pro$all
Filter updated: Thu, 20 May 2021 00:06:43 UTC
2021-05-20 00:06:44 +00:00
||hostmium.com$all
Filter updated: Sun, 14 Mar 2021 00:12:43 UTC
2021-03-14 00:12:43 +00:00
||hostnix.net$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||hostpoint.ch.1200028f.net2care.com$all
Filter updated: Mon, 09 Nov 2020 00:06:10 UTC
2020-11-09 00:06:10 +00:00
||hostpoint.ch.121c0291.net2care.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||hostpoint.ch.17a902ef.tcorner.fr$all
||hostpoint.ch.hebetec.ch.p2aexpertise.com$all
Filter updated: Thu, 22 Jul 2021 00:01:54 +0000
2021-07-22 00:01:54 +00:00
||hostyoutube.byethost14.com$all
Filter updated: Wed, 28 Jul 2021 00:02:03 +0000
2021-07-28 00:02:03 +00:00
||hot-sofupqlgmsi.ultimatefreehost.in$all
Filter updated: Fri, 04 Jun 2021 12:07:04 UTC
2021-06-04 12:07:04 +00:00
||hotbrooks.com$all
Filter updated: Sat, 20 Mar 2021 00:06:31 UTC
2021-03-20 00:06:31 +00:00
||hotel-pontos.gr$all
Filter updated: Fri, 28 May 2021 00:06:28 UTC
2021-05-28 00:06:29 +00:00
||hotelaakashresidency.com$all
Filter updated: Fri, 10 Sep 2021 12:02:02 +0000
2021-09-10 12:02:02 +00:00
||hotelgapel.com$all
Filter updated: Tue, 14 Sep 2021 00:01:48 +0000
2021-09-14 00:01:48 +00:00
||hotelmirafloresizu.com$all
Filter updated: Mon, 29 Mar 2021 12:06:44 UTC
2021-03-29 12:06:44 +00:00
||hotgrub.mlbb732.ga$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||hotm.art/in7w3d1$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||hotmathgames.herokuapp.com$all
Filter updated: Mon, 09 Aug 2021 12:01:58 +0000
2021-08-09 12:01:58 +00:00
||hounbvc-c7661.web.app$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||houra.xyz/wellsfargo/wellsfargo/index.php$all
||houra.xyz/wellsfargo/wellsfargo/login.php?cmd=login_submit&id=8f3666438dd51afadbffbbed3befba188f3666438dd51afadbffbbed3befba18&session=8f3666438dd51afadbffbbed3befba188f3666438dd51afadbffbbed3befba18$all
||houra.xyz/wellsfargo/wellsfargo/login.php?cmd=login_submit&id=05086c55f0a4c309a22e71fd5b7dd09805086c55f0a4c309a22e71fd5b7dd098&session=05086c55f0a4c309a22e71fd5b7dd09805086c55f0a4c309a22e71fd5b7dd098$all
Filter updated: Sat, 12 Jun 2021 00:25:37 UTC
2021-06-12 00:25:37 +00:00
||house18.info/themes/engines/ira.xml$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||houseofquirk.com$all
Filter updated: Sat, 29 May 2021 00:06:23 UTC
2021-05-29 00:06:23 +00:00
||houstonconcrete.us$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||how.servemp3.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||howinfos.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||howrse.5v.pl$all
Filter updated: Fri, 16 Jul 2021 12:01:57 +0000
2021-07-16 12:01:57 +00:00
||hoynoticias.com.ar$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||hozaybeats.com$all
Filter updated: Fri, 17 Sep 2021 00:01:45 +0000
2021-09-17 00:01:46 +00:00
||hpplotters.in$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||href.li/?https://www.teachvlearn.com//inc/js/colorpicker/images/bypass/$all
||href.li/?https:/gymcci.com/?ebay.de/signin&usingssl=1&puserid=&co_partnerid=2&siteid=77&ru=https:/contact.ebay.de/ws/ebayisapi.dll?m2mcontact&item=164305393996&ul_noapp=true&self=howill99&redirect=0&qid=2735945043019&requested=gompalla&guest=1&pagetype=2725$all
Filter updated: Wed, 11 Aug 2021 12:01:50 +0000
2021-08-11 12:01:50 +00:00
||href.li/https:/secure-gateway.hipay-tpp.cloud.i-b-s-gmbh.com/?lpisohxw=tdrowtum$all
Filter updated: Wed, 23 Jun 2021 12:06:29 +0000
2021-06-23 12:06:29 +00:00
||hrmthread.com/cclaimrs/pre_qualify.php$all
Filter updated: Thu, 24 Jun 2021 00:06:35 +0000
2021-06-24 00:06:35 +00:00
||hrmthread.com/panders/pre_qualify.php$all
Filter updated: Sun, 15 Aug 2021 12:01:40 +0000
2021-08-15 12:01:40 +00:00
||hrs-game.main.jp$all
Filter updated: Mon, 26 Jul 2021 00:02:16 +0000
2021-07-26 00:02:17 +00:00
||hs-19982318.t.hubspotfree.net$all
Filter updated: Thu, 03 Sep 2020 12:06:37 UTC
2020-09-03 12:06:37 +00:00
||hs-giveaways.ca$all
Filter updated: Wed, 13 Jan 2021 12:06:45 UTC
2021-01-13 12:06:45 +00:00
||hsbcinfo.com$all
Filter updated: Wed, 28 Jul 2021 12:01:46 +0000
2021-07-28 12:01:46 +00:00
||hsegbpscrbnatxeufgqjkpvzqz-dot-goff039302032323.rj.r.appspot.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||hsfkrkqogo.web.app$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||ht-cargo.com.vn$all
Filter updated: Thu, 23 Sep 2021 00:02:18 +0000
2021-09-23 00:02:18 +00:00
||ht.ly/hgav30ruohf$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||ht.ly/xz2130raxcw$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||hthtrhtrthth.000webhostapp.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||htl.li/fjhc30pzk72$all
Filter updated: Wed, 15 Sep 2021 00:01:54 +0000
2021-09-15 00:01:55 +00:00
||httpcpcontacts.granadoemurahara.com.br$all
Filter updated: Sat, 10 Jul 2021 12:01:35 +0000
2021-07-10 12:01:35 +00:00
||httpeugnerally-wixsite-com.filesusr.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||httpmwankaiwqkcom.000webhostapp.com$all
Filter updated: Fri, 07 May 2021 12:12:56 UTC
2021-05-07 12:12:56 +00:00
||httpshttpmobile.retrocafe.net.au$all
Filter updated: Tue, 13 Apr 2021 12:07:03 UTC
2021-04-13 12:07:03 +00:00
||htwww.duluxautosales.com$all
Filter updated: Fri, 20 Aug 2021 12:01:48 +0000
2021-08-20 12:01:48 +00:00
||hublaalikes.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||hueids.vn$all
Filter updated: Fri, 24 Sep 2021 00:01:50 +0000
2021-09-24 00:01:51 +00:00
||huge.servegame.com$all
Filter updated: Wed, 04 Aug 2021 12:01:54 +0000
2021-08-04 12:01:54 +00:00
||hulu-com-activate.sitey.me$all
Filter updated: Tue, 07 Sep 2021 00:01:46 +0000
2021-09-07 00:01:46 +00:00
||hulu-hulu-com-activate.sitey.me$all
||hulu.sitey.me$all
Filter updated: Thu, 03 Sep 2020 12:06:37 UTC
2020-09-03 12:06:37 +00:00
||humani.biz$all
Filter updated: Mon, 06 Sep 2021 00:01:54 +0000
2021-09-06 00:01:54 +00:00
||humc.in$all
Filter updated: Sat, 16 Jan 2021 12:06:48 UTC
2021-01-16 12:06:48 +00:00
||hunterpowersport.com/wp-includes/customize/checklist/more$all
Filter updated: Thu, 19 Nov 2020 12:06:53 UTC
2020-11-19 12:06:53 +00:00
||hunterpowersport.com/wp-includes/customize/checklist/more/$all
Filter updated: Tue, 18 May 2021 00:06:34 UTC
2021-05-18 00:06:34 +00:00
||huntington.net.au$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||huntingtononline.ddns.info$all
Filter updated: Fri, 24 Sep 2021 12:02:36 +0000
2021-09-24 12:02:36 +00:00
||huntingtonuserverificationinnfo02.otzo.com/secure/$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||husband-german-geography-ftp.trycloudflare.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||hutoknepper.de$all
Filter updated: Wed, 04 Aug 2021 00:02:10 +0000
2021-08-04 00:02:10 +00:00
||huynguyen2k.github.io$all
Filter updated: Fri, 24 Sep 2021 12:02:36 +0000
2021-09-24 12:02:36 +00:00
||hvaayh.top$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||hwazen.com/vb/css/account_limited/error$all
||hwazen.com/vb/css/account_limited/error/$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||hwbcpa-my.sharepoint.com/:x:/r/personal/rweisbrot_hwb-cpa_com/_layouts/15/wopiframe.aspx?guestaccesstoken=re6bwoopf4%2bigh44ydeteto26uposuk4awjdgpnsxeq%3d&docid=1_135c9d2f1e5494a2e8f84338bc480eafb&wdformid=%7b01c1d1c3%2d951e%2d4c1b%2db549%2dc38fbbf6168d%7d&action=formsubmit$all
Filter updated: Sat, 10 Jul 2021 00:01:42 +0000
2021-07-10 00:01:42 +00:00
||hwzyw.csb.app$all
Filter updated: Fri, 09 Jul 2021 00:01:59 +0000
2021-07-09 00:01:59 +00:00
||hydratrader.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||hydraulicmeteringpump.in$all
Filter updated: Sun, 19 Sep 2021 12:01:34 +0000
2021-09-19 12:01:35 +00:00
||hyjkfsdr-107934.square.site$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||hypegames.shop$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||hyperurl.co/ryfrhf$all
Filter updated: Thu, 03 Sep 2020 12:06:37 UTC
2020-09-03 12:06:37 +00:00
||hyperurl.co/ryfrhf/$all
Filter updated: Tue, 20 Jul 2021 12:01:48 +0000
2021-07-20 12:01:48 +00:00
||i-ask332.dga.jp$all
Filter updated: Thu, 03 Sep 2020 12:06:37 UTC
2020-09-03 12:06:37 +00:00
||i-kiwi.com.ua$all
||i-m.mx/ebuse/servic$all
||i-m.mx/eupdate/emailaccountupdate/$all
||i-m.mx/hawaii/hawaii/$all
||i-m.mx/portaldesk/portal_desk$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||i-m.mx/webaccountupdate/stockholmsuniversitet/$all
Filter updated: Thu, 10 Jun 2021 00:06:48 UTC
2021-06-10 00:06:48 +00:00
||i.gal$all
Filter updated: Sun, 15 Aug 2021 12:01:40 +0000
2021-08-15 12:01:40 +00:00
||i1ctv.weblium.site$all
Filter updated: Thu, 02 Sep 2021 12:02:02 +0000
2021-09-02 12:02:02 +00:00
||i4us.com$all
Filter updated: Sun, 15 Aug 2021 12:01:40 +0000
2021-08-15 12:01:40 +00:00
||iamkevinfay.com$all
Filter updated: Mon, 21 Jun 2021 12:06:31 +0000
2021-06-21 12:06:31 +00:00
||iamwatch.net$all
Filter updated: Wed, 22 Sep 2021 12:01:56 +0000
2021-09-22 12:01:56 +00:00
||iazu.me$all
Filter updated: Thu, 18 Feb 2021 12:07:12 UTC
2021-02-18 12:07:12 +00:00
||ibank.qnbfinansbkonline.com$all
Filter updated: Thu, 23 Sep 2021 00:02:18 +0000
2021-09-23 00:02:18 +00:00
||ibankasb.ru$all
Filter updated: Sun, 11 Jul 2021 12:01:37 +0000
2021-07-11 12:01:38 +00:00
||ibelongtotheworld.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||ibpm.ru$all
Filter updated: Tue, 21 Sep 2021 12:02:11 +0000
2021-09-21 12:02:11 +00:00
||ic-cite.ulm.ac.id$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||icipedudu-my.sharepoint.com/:x:/r/personal/mkaranja_icipe_org/_layouts/15/wopiframe.aspx?guestaccesstoken=re27h63flckle8ez9uj3%20mbypfu8te0j3odtdaeiflu=&docid=1_1bdc33023238341e8b1471eb8a883076b&wdformid={24125711-8ad2-4ca2-bfd8-5b64dcc4e62d}&action=formsubmit&cid=62dab23f-06ce-4694-9418-59f6a55bb86c$all
||icipedudu-my.sharepoint.com/:x:/r/personal/mkaranja_icipe_org/_layouts/15/wopiframe.aspx?guestaccesstoken=re27h63flckle8ez9uj3%2bmbypfu8te0j3odtdaeiflu%3d&docid=1_1bdc33023238341e8b1471eb8a883076b&wdformid=%7b24125711%2d8ad2%2d4ca2%2dbfd8%2d5b64dcc4e62d%7d&action=formsubmit&cid=62dab23f-06ce-4694-9418-59f6a55bb86c$all
||icipedudu-my.sharepoint.com/personal/mkaranja_icipe_org/_layouts/15/wopiframe.aspx?guestaccesstoken=re27h63flckle8ez9uj3%2bmbypfu8te0j3odtdaeiflu%3d&docid=1_1bdc33023238341e8b1471eb8a883076b&wdformid=%7b24125711%2d8ad2%2d4ca2%2dbfd8%2d5b64dcc4e62d%7d&action=formsubmit$all
||icipedudu-my.sharepoint.com/personal/mkaranja_icipe_org/_layouts/15/wopiframe.aspx?guestaccesstoken=re27h63flckle8ez9uj3%2bmbypfu8te0j3odtdaeiflu%3d&docid=1_1bdc33023238341e8b1471eb8a883076b&wdformid=%7b24125711%2d8ad2%2d4ca2%2dbfd8%2d5b64dcc4e62d%7d&action=formsubmit&cid=62dab23f-06ce-4694-9418-59f6a55bb86c$all
||icipedudu-my.sharepoint.com/personal/mkaranja_icipe_org/_layouts/15/wopiframe.aspx?guestaccesstoken=ugnx8vv0hnbsrv%2fvcxzk70fvtpbgfohzofkdwg0fkks%3d&docid=1_14fdb459dd74a4d3aac22552ba4d394a6&wdformid=%7b4b57ec2d%2d6b56%2d419c%2da4e2%2d67f9f9a0264e%7d&action=formsubmit&cid=4d93e72d-f0e5-4309-8366-df9357c3dc31$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||id-pour-vous-identifier-sur-votre-compte.yolasite.com$all
Filter updated: Sat, 10 Jul 2021 00:01:42 +0000
2021-07-10 00:01:42 +00:00
||idam-web-public.aat.platform.hmcts.net$all
Filter updated: Fri, 03 Sep 2021 00:01:54 +0000
2021-09-03 00:01:55 +00:00
||iddeev.hyperphp.com$all
Filter updated: Sat, 28 Aug 2021 00:33:51 +0000
2021-08-28 00:33:51 +00:00
||ideabank-logowanie.net$all
Filter updated: Sun, 11 Jul 2021 00:02:18 +0000
2021-07-11 00:02:18 +00:00
||identification.fr-mescomptesv1.cf$all
Filter updated: Wed, 30 Jun 2021 12:01:58 +0000
2021-06-30 12:01:58 +00:00
||identification.fr-principalev1.cf$all
Filter updated: Thu, 23 Sep 2021 00:02:18 +0000
2021-09-23 00:02:18 +00:00
||identified-shortly-ok-katrina.trycloudflare.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||identifiez-vous-avec-votre-compte.yolasite.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||identifiez-vous598.yolasite.com$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||identify.run-us-west2.goorm.io$all
Filter updated: Tue, 22 Jun 2021 12:06:51 +0000
2021-06-22 12:06:51 +00:00
||identita.n26.com.verificatoinformazioni.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||ideonpackaging-my.sharepoint.com/personal/chasem_ideonpackaging_com/_layouts/15/doc.aspx?sourcedoc={efe0bf70-91fe-4df4-9b7f-a1f8f457789a}&action=default&slrid=54094d9f-d083-a000-8e05-3d2cf3964fda&originalpath=ahr0chm6ly9pzgvvbnbhy2thz2luzy1tes5zagfyzxbvaw50lmnvbs86bzovcc9jagfzzw0vrw5dxzrpxy1rzljobtmtac1qulhlsm9cv0xqz2jfq0gtq3lnmu5eodvftfz0dz9ydgltzt02n0o1ehhqcjewzw&cid=d0584eb7-b94e-4984-b42d-e13b1f82defd$all
||ideonpackaging-my.sharepoint.com/personal/chasem_ideonpackaging_com/_layouts/15/doc.aspx?sourcedoc={efe0bf70-91fe-4df4-9b7f-a1f8f457789a}&action=default&slrid=7638479f-a008-a000-b8aa-ef5f0a6b15f5&originalpath=ahr0chm6ly9pzgvvbnbhy2thz2luzy1tes5zagfyzxbvaw50lmnvbs86bzovcc9jagfzzw0vrw5dxzrpxy1rzljobtmtac1qulhlsm9cv0xqz2jfq0gtq3lnmu5eodvftfz0dz9ydgltzt1lmwhsmk9eyzewzw&cid=9b3eb182-2ad9-4497-b48a-d35f8662bfac$all
||ideonpackaging-my.sharepoint.com/personal/chasem_ideonpackaging_com/_layouts/15/doc.aspx?sourcedoc={efe0bf70-91fe-4df4-9b7f-a1f8f457789a}&action=default&slrid=d72f489f-7076-a000-8e05-39f06a9d91f0&originalpath=ahr0chm6ly9pzgvvbnbhy2thz2luzy1tes5zagfyzxbvaw50lmnvbs86bzovcc9jagfzzw0vrw5dxzrpxy1rzljobtmtac1qulhlsm9cv0xqz2jfq0gtq3lnmu5eodvftfz0dz9ydgltzt14n3n3elr6zjewzw&cid=91960fc1-0435-43d2-992b-254ce1fc9592$all
||ideonpackaging-my.sharepoint.com/personal/chasem_ideonpackaging_com/_layouts/15/doc.aspx?sourcedoc={efe0bf70-91fe-4df4-9b7f-a1f8f457789a}&action=default&slrid=f8084d9f-a05e-a000-8e05-34e92606af77&originalpath=ahr0chm6ly9pzgvvbnbhy2thz2luzy1tes5zagfyzxbvaw50lmnvbs86bzovcc9jagfzzw0vrw5dxzrpxy1rzljobtmtac1qulhlsm9cv0xqz2jfq0gtq3lnmu5eodvftfz0dz9ydgltzt1xwud5nwhmcjewzw&cid=bbc94d14-5ae4-4a37-8569-04e684ae9040$all
Filter updated: Mon, 20 Sep 2021 00:01:41 +0000
2021-09-20 00:01:41 +00:00
||idhuman-verification.run-us-west2.goorm.io$all
Filter updated: Wed, 04 Nov 2020 00:06:25 UTC
2020-11-04 00:06:25 +00:00
||idiomas247.com$all
Filter updated: Mon, 20 Sep 2021 00:01:41 +0000
2021-09-20 00:01:41 +00:00
||idorangefr24.yolasite.com$all
Filter updated: Thu, 05 Aug 2021 00:02:05 +0000
2021-08-05 00:02:05 +00:00
||idpd-1501.com$all
Filter updated: Thu, 23 Sep 2021 00:02:18 +0000
2021-09-23 00:02:18 +00:00
||ie-boi365.org$all
Filter updated: Sat, 04 Sep 2021 00:17:00 +0000
2021-09-04 00:17:00 +00:00
||ien.fni.mybluehost.me$all
Filter updated: Wed, 11 Aug 2021 12:01:50 +0000
2021-08-11 12:01:50 +00:00
||ifuudaixcbaqhoxwbttgkptnlb-dot-gowa11111111.rj.r.appspot.com$all
Filter updated: Wed, 15 Sep 2021 12:01:46 +0000
2021-09-15 12:01:46 +00:00
||igenpod.com$all
Filter updated: Mon, 09 Aug 2021 12:01:58 +0000
2021-08-09 12:01:58 +00:00
||ignitionclaim.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||igsasso-my.sharepoint.com/:x:/r/personal/pginet_groupe-igs_fr/_layouts/15/wopiframe.aspx?guestaccesstoken=o1ljzjnq70g8yg6w%2fce3ec9zu3%2bg6ck6ibkmhwt3wl0%3d&docid=1_1c2a91e87cc7a4ffb85611d8ebf31f653&wdformid=%7bcdf56303%2d9250%2d4cf1%2d8370%2db3f9a84cd714%7d&action=formsubmit$all
Filter updated: Thu, 11 Feb 2021 00:06:15 UTC
2021-02-11 00:06:15 +00:00
||iiaosdffff.easy.co$all
Filter updated: Fri, 02 Apr 2021 00:06:35 UTC
2021-04-02 00:06:36 +00:00
||iims.onlineapplication.co$all
Filter updated: Wed, 09 Dec 2020 12:06:49 UTC
2020-12-09 12:06:49 +00:00
||iipvit.by$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||ijidt.com/pages/gifts/lu/$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||ijijijijuiuhhu.000webhostapp.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||iksanthesharp.postown.net$all
||ikuhzdswpx.pfirmann-bau.de$all
Filter updated: Mon, 26 Apr 2021 00:08:39 UTC
2021-04-26 00:08:39 +00:00
||ikulutugrowthacademy.com$all
Filter updated: Wed, 25 Aug 2021 12:02:06 +0000
2021-08-25 12:02:07 +00:00
||im-creator.com/viewer/vbid-fa0f29d5-fpsjmms8$all
Filter updated: Sat, 18 Sep 2021 12:01:34 +0000
2021-09-18 12:01:34 +00:00
||images-7jbmtszqrl.salamazerbaycan.az$all
Filter updated: Thu, 23 Sep 2021 00:02:18 +0000
2021-09-23 00:02:18 +00:00
||images-c6wv0b0nie.salamazerbaycan.az$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||images-fqysa8xd.salamazerbaycan.az$all
||images-hwjds30pgp.salamazerbaycan.az$all
Filter updated: Wed, 22 Sep 2021 12:01:56 +0000
2021-09-22 12:01:56 +00:00
||images-mijtu80r.salamazerbaycan.az$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||imcreator.com/viewer/vbid-fa0f29d5-fpsjmms8$all
Filter updated: Mon, 06 Sep 2021 00:01:54 +0000
2021-09-06 00:01:54 +00:00
||imexpharm.com$all
Filter updated: Mon, 04 Jan 2021 00:06:10 UTC
2021-01-04 00:06:10 +00:00
||img.maplejournal.co.in$all
Filter updated: Thu, 25 Feb 2021 12:07:26 UTC
2021-02-25 12:07:26 +00:00
||imi.org.au$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||importantnoticesupport.com/mazonnotify/69ef7/homepage$all
||importantnoticesupport.com/mazonnotify/d0472$all
||importantnoticesupport.com/mazonnotify/d0472/$all
||importantnoticesupport.com/mazonnotify/d0472/homepage$all
Filter updated: Tue, 16 Feb 2021 12:06:31 UTC
2021-02-16 12:06:31 +00:00
||impotspublicservice.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||impregnated-dischar.000webhostapp.com$all
Filter updated: Wed, 01 Sep 2021 00:02:20 +0000
2021-09-01 00:02:20 +00:00
||impulseauction.top$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||imsva91-ctp.trendmicro.com$all
||imxprs.com/free/emailupdatee/owaweb$all
||imxprs.com/free/outlookwebaccessupgrade/outlookwebaccessupgrade$all
||imxprs.com/free/webmaiil/accounttportal$all
Filter updated: Sun, 15 Aug 2021 00:01:57 +0000
2021-08-15 00:01:57 +00:00
||in-truck.dk$all
Filter updated: Wed, 15 Sep 2021 00:01:54 +0000
2021-09-15 00:01:55 +00:00
||inbusinesscoworking.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||indahbulabudiamen4.gq$all
Filter updated: Thu, 19 Aug 2021 12:02:33 +0000
2021-08-19 12:02:33 +00:00
||indeed8.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||indeedcontract.com/login$all
||index.kroppsfunktion.com$all
Filter updated: Mon, 26 Apr 2021 00:08:39 UTC
2021-04-26 00:08:39 +00:00
||indexalimentos.com.mx$all
Filter updated: Wed, 15 Sep 2021 00:01:54 +0000
2021-09-15 00:01:55 +00:00
||indha.in$all
Filter updated: Fri, 15 Jan 2021 00:06:14 UTC
2021-01-15 00:06:14 +00:00
||indiankitchenfood.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||indiasurffestival.com$all
Filter updated: Wed, 22 Sep 2021 12:01:56 +0000
2021-09-22 12:01:56 +00:00
||indigocoin.me$all
Filter updated: Sat, 31 Jul 2021 00:01:51 +0000
2021-07-31 00:01:51 +00:00
||indomotorlestari.com$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||industrialonline.in.th$all
Filter updated: Tue, 31 Aug 2021 00:01:55 +0000
2021-08-31 00:01:55 +00:00
||infinitycare.gt$all
Filter updated: Mon, 29 Mar 2021 00:06:36 UTC
2021-03-29 00:06:36 +00:00
||info-full18.2waky.com$all
Filter updated: Thu, 03 Sep 2020 12:06:37 UTC
2020-09-03 12:06:37 +00:00
||info.ipromoteuoffers.com$all
||info.lionnets.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||infobank.app.link$all
Filter updated: Tue, 29 Jun 2021 00:01:48 +0000
2021-06-29 00:01:48 +00:00
||infodeseguros.com$all
Filter updated: Mon, 16 Aug 2021 12:01:42 +0000
2021-08-16 12:01:42 +00:00
||infogram.com/payment-details-1hzj4o3pjkwmo4p?live$all
Filter updated: Sat, 14 Aug 2021 00:01:49 +0000
2021-08-14 00:01:49 +00:00
||infomation245.ultimatefreehost.in$all
Filter updated: Fri, 24 Sep 2021 00:01:50 +0000
2021-09-24 00:01:51 +00:00
||infopage-create.000webhostapp.com$all
Filter updated: Wed, 15 Sep 2021 00:01:54 +0000
2021-09-15 00:01:55 +00:00
||informacionespsiquiatricas.com$all
||informativoclienteapp.io$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||informtivo30horas.me$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||infosprologinmatrisemomols.yolasite.com$all
Filter updated: Thu, 26 Aug 2021 00:02:01 +0000
2021-08-26 00:02:01 +00:00
||infotreegroup.com$all
Filter updated: Sat, 29 May 2021 00:06:23 UTC
2021-05-29 00:06:23 +00:00
||infrm-m-informa.blogspot.com$all
Filter updated: Tue, 24 Aug 2021 00:02:23 +0000
2021-08-24 00:02:24 +00:00
||ing.direct.verifica.dati.wellmom.net$all
Filter updated: Wed, 21 Jul 2021 00:01:57 +0000
2021-07-21 00:01:57 +00:00
||ing.kluisrekening.nl.$all
Filter updated: Fri, 25 Sep 2020 00:06:14 UTC
2020-09-25 00:06:14 +00:00
||ingaveiculos.creatorlink.net$all
Filter updated: Sun, 04 Jul 2021 12:01:42 +0000
2021-07-04 12:01:42 +00:00
||inhtg67y.byethost6.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||iniciobanesedolomita.club$all
Filter updated: Sat, 22 May 2021 12:07:44 UTC
2021-05-22 12:07:44 +00:00
||inicsido.vzpla.net$all
Filter updated: Tue, 13 Apr 2021 00:06:31 UTC
2021-04-13 00:06:31 +00:00
||inno.surf$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||innoaura.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||inova-bd.com$all
Filter updated: Sun, 12 Sep 2021 00:02:13 +0000
2021-09-12 00:02:13 +00:00
||inpexcom-au.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||inpost-order.pl-id03160710.xyz$all
||inpost-order.pl-id29458764.xyz$all
Filter updated: Fri, 24 Sep 2021 12:02:36 +0000
2021-09-24 12:02:36 +00:00
||inpost-order.pl-id30542198.xyz$all
Filter updated: Wed, 22 Sep 2021 12:01:56 +0000
2021-09-22 12:01:56 +00:00
||inpost-order.pl-id50073848.xyz$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||inpost-order.pl-id66845769.xyz$all
||inpost-order.pl-id67594295.xyz$all
Filter updated: Fri, 24 Sep 2021 12:02:36 +0000
2021-09-24 12:02:36 +00:00
||inpost-order.pl-id76514308.xyz$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||inpost-order.pl-id80141823.xyz$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||inpost-pku.id9030.me$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||inpost-pl.id-013497.pw$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||inpost-pl.id-512031.site$all
Filter updated: Wed, 22 Sep 2021 00:02:26 +0000
2021-09-22 00:02:26 +00:00
||inpost-pl.id-847329.pw$all
Filter updated: Fri, 24 Sep 2021 12:02:36 +0000
2021-09-24 12:02:36 +00:00
||inpost-pl.id-987438.pw$all
Filter updated: Wed, 01 Sep 2021 12:01:58 +0000
2021-09-01 12:01:58 +00:00
||inpost-pl.merchant-781.tk$all
Filter updated: Tue, 14 Sep 2021 00:01:48 +0000
2021-09-14 00:01:48 +00:00
||inpost-pl.net$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||inpost.dostawa-safety.club$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||inpost.pl-id97118124.xyz$all
Filter updated: Tue, 21 Sep 2021 00:01:40 +0000
2021-09-21 00:01:40 +00:00
||inpost.pl-info.deposit-recievment.com$all
Filter updated: Fri, 17 Sep 2021 00:01:45 +0000
2021-09-17 00:01:46 +00:00
||inpost.post-dostawa.com$all
Filter updated: Mon, 24 May 2021 12:06:37 UTC
2021-05-24 12:06:37 +00:00
||inps-ep.com$all
Filter updated: Tue, 21 Sep 2021 00:01:40 +0000
2021-09-21 00:01:40 +00:00
||ins.cloudns.nz$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||insidesoftwares.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||instagram-instagram-instagram-instagram-instagram-instagram.tw1.su$all
Filter updated: Mon, 30 Aug 2021 12:01:50 +0000
2021-08-30 12:01:51 +00:00
||instagram-photo-battle-profile.ru$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||instagram-signup.herokuapp.com$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||instagram.support.al$all
Filter updated: Tue, 22 Dec 2020 12:06:42 UTC
2020-12-22 12:06:42 +00:00
||instagramhelpp.agency$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||instagramhelps.com$all
Filter updated: Sun, 08 Aug 2021 12:01:35 +0000
2021-08-08 12:01:35 +00:00
||instargram.dothome.co.kr$all
Filter updated: Sun, 05 Sep 2021 12:01:36 +0000
2021-09-05 12:01:37 +00:00
||institutoaxioma.com.ar$all
Filter updated: Wed, 28 Apr 2021 00:06:29 UTC
2021-04-28 00:06:29 +00:00
||institutodefaveri.com$all
Filter updated: Fri, 03 Sep 2021 00:01:54 +0000
2021-09-03 00:01:55 +00:00
||insuminet.hostfree.pw$all
Filter updated: Tue, 21 Sep 2021 00:01:40 +0000
2021-09-21 00:01:40 +00:00
||insurance2019.moneynet.com.tw/wp-admin/aps.php$all
Filter updated: Fri, 24 Sep 2021 00:01:50 +0000
2021-09-24 00:01:51 +00:00
||insurance2019.moneynet.com.tw/wp-admin/maint/?hash=a2fyaw5hywxtzwlkyxjpymvpcm9aag90bwfpbc5jb20=$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||intelligens.co.il$all
Filter updated: Mon, 20 Sep 2021 12:02:05 +0000
2021-09-20 12:02:05 +00:00
||intellogistics.vn$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||interbahis452.blogspot.com$all
||interbahisgirin.blogspot.com$all
||interbahisgirisadresimiz2.blogspot.com$all
||interbahiss1.blogspot.com$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||interbankempresas.pe-li.ru$all
Filter updated: Sun, 04 Jul 2021 00:02:10 +0000
2021-07-04 00:02:10 +00:00
||intercroofthlm.byethost33.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||interestingfurniture.com$all
Filter updated: Thu, 01 Jul 2021 12:02:02 +0000
2021-07-01 12:02:03 +00:00
||interfacethlmt.byethost3.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||intergirisi.blogspot.com$all
Filter updated: Mon, 31 May 2021 12:06:30 UTC
2021-05-31 12:06:30 +00:00
||interiorsbis.com$all
Filter updated: Tue, 07 Sep 2021 00:01:46 +0000
2021-09-07 00:01:46 +00:00
||interlbankwelb.artagentsinternational.com$all
Filter updated: Sun, 06 Dec 2020 00:06:44 UTC
2020-12-06 00:06:44 +00:00
||intern.unibas-com.ch$all
Filter updated: Sat, 19 Jun 2021 00:06:27 +0000
2021-06-19 00:06:27 +00:00
||international-services.ni6132741-1.web19.nitrado.hosting$all
Filter updated: Fri, 07 May 2021 12:12:56 UTC
2021-05-07 12:12:56 +00:00
||international-web-fb75a.web.app$all
Filter updated: Mon, 12 Jul 2021 00:01:55 +0000
2021-07-12 00:01:55 +00:00
||internationalsoccercamp.com$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||internet-tips059.blogspot.com/?id=0f4fef18abe68bb02666fd444c7f973f&m=1$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||internet-tips063.blogspot.com/?id=acf58cbed818fe791d6240a62204ab51&m=1$all
Filter updated: Tue, 03 Aug 2021 12:01:54 +0000
2021-08-03 12:01:54 +00:00
||intexargentina.com.ar$all
Filter updated: Wed, 15 Sep 2021 00:01:54 +0000
2021-09-15 00:01:55 +00:00
||intheknowinspections.com$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||inthewildproductions.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||intranet.unsm.edu.pe$all
Filter updated: Tue, 29 Jun 2021 00:01:48 +0000
2021-06-29 00:01:48 +00:00
||invictuspower.com.br$all
Filter updated: Fri, 19 Feb 2021 12:06:46 UTC
2021-02-19 12:06:46 +00:00
||invitation-page-policy-notification-2021.my.id$all
Filter updated: Sun, 28 Feb 2021 12:09:19 UTC
2021-02-28 12:09:19 +00:00
||invitation-pages-advanced-notification-2021.my.id$all
Filter updated: Sat, 31 Jul 2021 12:01:55 +0000
2021-07-31 12:01:55 +00:00
||inx.inbox.lv$all
Filter updated: Sat, 31 Jul 2021 00:01:51 +0000
2021-07-31 00:01:51 +00:00
||inx.lv/7rdd$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||inx.lv/dxmn$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||inx.lv/zoow$all
Filter updated: Thu, 02 Sep 2021 12:02:02 +0000
2021-09-02 12:02:02 +00:00
||io.haardhoutveiling.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||ip.5et0qi.cn$all
Filter updated: Wed, 15 Sep 2021 00:01:54 +0000
2021-09-15 00:01:55 +00:00
||ipa.fkip.ulm.ac.id$all
Filter updated: Wed, 22 Sep 2021 12:01:56 +0000
2021-09-22 12:01:56 +00:00
||ipay.open-pays.ru$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||ipkaor.xyz$all
Filter updated: Tue, 27 Jul 2021 12:01:59 +0000
2021-07-27 12:01:59 +00:00
||ipkonline.com$all
Filter updated: Wed, 23 Jun 2021 00:06:32 +0000
2021-06-23 00:06:32 +00:00
||iplogger.org/2g5uj6$all
||iplogger.org/2grfj6$all
||iplogger.org/2pehz5$all
Filter updated: Fri, 19 Feb 2021 00:06:27 UTC
2021-02-19 00:06:28 +00:00
||iplogger.ru/2pmvx5$all
Filter updated: Tue, 07 Sep 2021 12:01:49 +0000
2021-09-07 12:01:49 +00:00
||ipod.co.za$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||iq-sci.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||irenterprises.in$all
Filter updated: Sat, 16 Jan 2021 12:06:48 UTC
2021-01-16 12:06:48 +00:00
||irequest-beneficiary-removal.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||irisdigi-labs.com$all
Filter updated: Wed, 15 Sep 2021 00:01:54 +0000
2021-09-15 00:01:55 +00:00
||irn-inc.com$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||irs-departement.tax-compensation.com$all
||irs-departement.tax-compensation.com/r/ckptrs?utm_source=dlvr.it&utm_medium=blogger$all
Filter updated: Tue, 21 Sep 2021 00:01:40 +0000
2021-09-21 00:01:40 +00:00
||irs-gov.us-identity-refunds.com$all
Filter updated: Wed, 14 Jul 2021 00:03:28 +0000
2021-07-14 00:03:28 +00:00
||irs.gov.admin-mcas-gov.ms$all
||irs.gov.mcas-gov.ms$all
Filter updated: Fri, 24 Sep 2021 00:01:50 +0000
2021-09-24 00:01:51 +00:00
||irs.gov.septembercovid19.com$all
Filter updated: Tue, 31 Aug 2021 12:01:54 +0000
2021-08-31 12:01:54 +00:00
||irs507.yolasite.com$all
Filter updated: Thu, 13 May 2021 00:06:46 UTC
2021-05-13 00:06:46 +00:00
||irsgov.unaux.com$all
Filter updated: Fri, 25 Jun 2021 00:06:14 +0000
2021-06-25 00:06:14 +00:00
||irstaxexpert.com/?t=1046341$all
Filter updated: Wed, 07 Jul 2021 00:01:56 +0000
2021-07-07 00:01:57 +00:00
||irstaxrefund.rf.gd$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||irstds.com$all
Filter updated: Fri, 30 Apr 2021 00:08:30 UTC
2021-04-30 00:08:30 +00:00
||is.gd/5cav9r$all
Filter updated: Fri, 16 Jul 2021 12:01:57 +0000
2021-07-16 12:01:57 +00:00
||is.gd/7lx16z$all
Filter updated: Mon, 13 Sep 2021 12:01:52 +0000
2021-09-13 12:01:52 +00:00
||is.gd/accessionlinemps$all
Filter updated: Thu, 16 Sep 2021 00:01:52 +0000
2021-09-16 00:01:52 +00:00
||is.gd/bcredemweb$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||is.gd/cb9ipo$all
||is.gd/higvzf$all
||is.gd/juveca$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||is.gd/klmdih$all
||is.gd/ksqqra$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||is.gd/lrajzm$all
Filter updated: Mon, 13 Sep 2021 12:01:52 +0000
2021-09-13 12:01:52 +00:00
||is.gd/nabalerts$all
Filter updated: Tue, 14 Sep 2021 12:01:44 +0000
2021-09-14 12:01:44 +00:00
||is.gd/v4h8zg$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||is.gd/vk3qjm$all
||is.gd/wrd7yk$all
Filter updated: Tue, 31 Aug 2021 00:01:55 +0000
2021-08-31 00:01:55 +00:00
||isabelleswindowdesignvestal.com$all
Filter updated: Wed, 07 Apr 2021 12:23:11 UTC
2021-04-07 12:23:12 +00:00
||isfirsatibul.com$all
Filter updated: Tue, 21 Sep 2021 12:02:11 +0000
2021-09-21 12:02:11 +00:00
||issc345enter.gb.net$all
Filter updated: Tue, 27 Apr 2021 00:06:47 UTC
2021-04-27 00:06:47 +00:00
||istras.com$all
Filter updated: Sun, 05 Sep 2021 00:02:15 +0000
2021-09-05 00:02:15 +00:00
||istudyalumni.com$all
Filter updated: Sun, 19 Sep 2021 12:01:34 +0000
2021-09-19 12:01:35 +00:00
||isue-ideent-privacy-update-secu-recovriy-andromeda-44.web.id$all
Filter updated: Sat, 21 Aug 2021 12:02:04 +0000
2021-08-21 12:02:04 +00:00
||isupport.com-tdd.co/i/sing/h4qj$all
Filter updated: Sun, 01 Nov 2020 00:10:06 UTC
2020-11-01 00:10:06 +00:00
||it-europe564598-com.filesusr.com$all
Filter updated: Wed, 16 Sep 2020 00:06:28 UTC
2020-09-16 00:06:29 +00:00
||it-friedli.ch$all
Filter updated: Thu, 03 Sep 2020 12:06:37 UTC
2020-09-03 12:06:37 +00:00
||it-supportdesk.com$all
Filter updated: Sat, 10 Jul 2021 00:01:42 +0000
2021-07-10 00:01:42 +00:00
||it.melnikhotels.com$all
Filter updated: Fri, 17 Sep 2021 12:01:51 +0000
2021-09-17 12:01:52 +00:00
||it2021samoa.000webhostapp.com$all
Filter updated: Sun, 27 Jun 2021 00:06:14 +0000
2021-06-27 00:06:14 +00:00
||itaauinf.byethost7.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||itally-erp.nz$all
Filter updated: Sun, 01 Aug 2021 00:01:58 +0000
2021-08-01 00:01:59 +00:00
||italminna.com$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||itamwallet.000webhostapp.com$all
Filter updated: Fri, 27 Nov 2020 12:06:59 UTC
2020-11-27 12:06:59 +00:00
||itau.gq$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||itaucard21437.000webhostapp.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||itechcircle.com$all
Filter updated: Sat, 17 Jul 2021 12:01:37 +0000
2021-07-17 12:01:37 +00:00
||itiy.in$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||itryratan.com/login-/facebookmobile/login.php$all
Filter updated: Fri, 23 Jul 2021 12:01:47 +0000
2021-07-23 12:01:47 +00:00
||itsmdshahin.github.io$all
Filter updated: Mon, 16 Aug 2021 00:01:59 +0000
2021-08-16 00:01:59 +00:00
||iuagri.tk$all
Filter updated: Fri, 03 Sep 2021 00:01:54 +0000
2021-09-03 00:01:55 +00:00
||iuhkj.r4f4vmtlso.workers.dev$all
Filter updated: Thu, 23 Sep 2021 00:02:18 +0000
2021-09-23 00:02:18 +00:00
||iuliss6.3utilities.com$all
Filter updated: Tue, 14 Sep 2021 12:01:44 +0000
2021-09-14 12:01:44 +00:00
||iutdigne.free.fr$all
Filter updated: Thu, 22 Jul 2021 00:01:54 +0000
2021-07-22 00:01:54 +00:00
||iuyhfd.hyperphp.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||izcalttia.com$all
Filter updated: Fri, 13 Aug 2021 12:01:44 +0000
2021-08-13 12:01:44 +00:00
||j.7kt.caretek.com.au$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||j.gs/cpjh$all
||j.mp/2o6cpqn$all
||j.mp/2zztiem?/pages-help.htm$all
Filter updated: Mon, 21 Jun 2021 12:06:31 +0000
2021-06-21 12:06:31 +00:00
||j.mp/35an7jt$all
Filter updated: Sat, 10 Apr 2021 00:06:30 UTC
2021-04-10 00:06:30 +00:00
||j.mp/39tslvr$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||j.mp/3arx6oo$all
Filter updated: Thu, 08 Jul 2021 00:02:02 +0000
2021-07-08 00:02:02 +00:00
||j.mp/3jf7jnh$all
Filter updated: Tue, 20 Apr 2021 12:06:59 UTC
2021-04-20 12:07:00 +00:00
||j.mp/3tcd3ws$all
Filter updated: Thu, 24 Jun 2021 00:06:35 +0000
2021-06-24 00:06:35 +00:00
||j.mp/3vlssio?/fpconfirmvtns$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||j6a656akodf.typeform.com$all
Filter updated: Wed, 08 Sep 2021 00:02:08 +0000
2021-09-08 00:02:08 +00:00
||j6rdc0.webwave.dev$all
Filter updated: Sat, 29 May 2021 12:06:18 UTC
2021-05-29 12:06:19 +00:00
||j9aolejd98d.typeform.com$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||jaban.cn$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||jabezrealtyservices.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||jabkzahrimasjoun.blogspot.com$all
Filter updated: Fri, 30 Apr 2021 00:08:30 UTC
2021-04-30 00:08:30 +00:00
||jaccsivr.vmenu.jp$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||jackbinaspuol.blogspot.com$all
Filter updated: Fri, 05 Mar 2021 12:06:38 UTC
2021-03-05 12:06:38 +00:00
||jacobliston.com$all
Filter updated: Sat, 03 Jul 2021 00:01:56 +0000
2021-07-03 00:01:56 +00:00
||jadebest.ru$all
Filter updated: Mon, 20 Sep 2021 00:01:41 +0000
2021-09-20 00:01:41 +00:00
||jaees-srevioc-traind-jalg0000100m.tengxinseal.cn$all
||jaees-srevioc-traind-jalg0000100m.weimakeji15.cn$all
Filter updated: Thu, 03 Sep 2020 12:06:37 UTC
2020-09-03 12:06:37 +00:00
||jagex.nu$all
Filter updated: Fri, 15 Jan 2021 00:06:14 UTC
2021-01-15 00:06:14 +00:00
||jalfre.com$all
Filter updated: Sat, 05 Dec 2020 12:06:47 UTC
2020-12-05 12:06:47 +00:00
||jam-023d.gitlab.io$all
Filter updated: Fri, 30 Jul 2021 00:01:47 +0000
2021-07-30 00:01:47 +00:00
||jameshallybone.co.uk$all
Filter updated: Tue, 17 Aug 2021 12:01:39 +0000
2021-08-17 12:01:39 +00:00
||jamesonpcapitalgroup.com$all
Filter updated: Sat, 14 Aug 2021 00:01:49 +0000
2021-08-14 00:01:49 +00:00
||jasakirimshopeeid.duckdns.org$all
Filter updated: Thu, 26 Aug 2021 12:02:31 +0000
2021-08-26 12:02:31 +00:00
||jasminsafaris.co.ke$all
Filter updated: Tue, 21 Sep 2021 12:02:11 +0000
2021-09-21 12:02:11 +00:00
||jasonmaiolo.com$all
Filter updated: Fri, 17 Sep 2021 12:01:51 +0000
2021-09-17 12:01:52 +00:00
||javarockingland.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||jccstl-my.sharepoint.com/personal/rrickerman_jccstl_org/_layouts/15/guestaccess.aspx?guestaccesstoken=jkuay949setvwefuwwgnwrgrflgxyyqwvflhqhvhhts%3d&docid=1_1681bb88b968b4e54af8bbc5fe0042b11&wdformid=%7b799f51f9%2d46d0%2d42fa%2d9dcb%2d0d70e240356e%7d$all
Filter updated: Mon, 10 May 2021 12:06:32 UTC
2021-05-10 12:06:32 +00:00
||jcmitalia.it$all
Filter updated: Sun, 22 Aug 2021 12:01:41 +0000
2021-08-22 12:01:41 +00:00
||jctuitiononline.com.sg$all
Filter updated: Tue, 01 Jun 2021 12:06:34 UTC
2021-06-01 12:06:34 +00:00
||jeffreybcam.net$all
Filter updated: Wed, 01 Sep 2021 00:02:20 +0000
2021-09-01 00:02:20 +00:00
||jeffreylcapitalgroup.com$all
Filter updated: Thu, 02 Sep 2021 12:02:02 +0000
2021-09-02 12:02:02 +00:00
||jeffvandewalle.com$all
Filter updated: Sat, 22 May 2021 00:06:19 UTC
2021-05-22 00:06:19 +00:00
||jenniangel.vzpla.net$all
Filter updated: Wed, 25 Aug 2021 12:02:06 +0000
2021-08-25 12:02:07 +00:00
||jetser-electrical-supply.business.site$all
||jettlinkkk.webador.co.uk$all
Filter updated: Thu, 25 Mar 2021 12:06:39 UTC
2021-03-25 12:06:39 +00:00
||jeuxnys.com$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||jewlsh.com$all
Filter updated: Thu, 18 Feb 2021 12:07:12 UTC
2021-02-18 12:07:12 +00:00
||jflkp.csb.app$all
Filter updated: Thu, 16 Sep 2021 00:01:52 +0000
2021-09-16 00:01:52 +00:00
||jhhjfdsjjfdsjnsfdjnkfsjknfs-inrgw.ondigitalocean.app$all
Filter updated: Wed, 23 Jun 2021 00:06:32 +0000
2021-06-23 00:06:32 +00:00
||jho.click$all
Filter updated: Fri, 24 Sep 2021 00:01:50 +0000
2021-09-24 00:01:51 +00:00
||jiaheconstuction.com$all
Filter updated: Mon, 28 Dec 2020 00:06:07 UTC
2020-12-28 00:06:07 +00:00
||jibnubank.com$all
Filter updated: Fri, 27 Aug 2021 00:01:47 +0000
2021-08-27 00:01:47 +00:00
||jide43977005.sitebuilder.name.tools$all
Filter updated: Wed, 28 Jul 2021 12:01:46 +0000
2021-07-28 12:01:46 +00:00
||jifxrefamtafjyefceovjqzstf-dot-gowa11111111.rj.r.appspot.com$all
Filter updated: Fri, 03 Sep 2021 12:01:48 +0000
2021-09-03 12:01:48 +00:00
||jijisa.com$all
Filter updated: Thu, 29 Jul 2021 00:01:57 +0000
2021-07-29 00:01:57 +00:00
||jindaltextiles.com$all
Filter updated: Tue, 14 Sep 2021 00:01:48 +0000
2021-09-14 00:01:48 +00:00
||jiontnteegrubwhtsp.se.ke$all
Filter updated: Fri, 17 Sep 2021 00:01:45 +0000
2021-09-17 00:01:46 +00:00
||jiwanramchemical.com$all
Filter updated: Wed, 21 Jul 2021 00:01:57 +0000
2021-07-21 00:01:57 +00:00
||jjfurniturerepair.com$all
Filter updated: Sat, 11 Sep 2021 12:01:27 +0000
2021-09-11 12:01:27 +00:00
||jk3bt83s.r.eu-west-1.awstrack.me$all
Filter updated: Sat, 20 Mar 2021 12:06:17 UTC
2021-03-20 12:06:17 +00:00
||jlogine.com$all
Filter updated: Tue, 31 Aug 2021 12:01:54 +0000
2021-08-31 12:01:54 +00:00
||jms-ibs.com$all
Filter updated: Fri, 06 Aug 2021 12:01:57 +0000
2021-08-06 12:01:57 +00:00
||jnq0y.weblium.site$all
Filter updated: Fri, 24 Sep 2021 00:01:50 +0000
2021-09-24 00:01:51 +00:00
||jocapelli.com$all
Filter updated: Wed, 19 May 2021 12:06:41 UTC
2021-05-19 12:06:41 +00:00
||joe23.aidaform.com$all
Filter updated: Fri, 04 Dec 2020 12:06:51 UTC
2020-12-04 12:06:51 +00:00
||joecamera.net$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||joeypmemorialfoundation.com$all
Filter updated: Fri, 15 Jan 2021 00:06:14 UTC
2021-01-15 00:06:14 +00:00
||joeytorres.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||john-ashley.de$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||join-group-riri-2021.duckdns.org$all
Filter updated: Wed, 06 Jan 2021 12:06:34 UTC
2021-01-06 12:06:34 +00:00
||join-whatapp.otzo.com$all
Filter updated: Thu, 03 Sep 2020 12:06:37 UTC
2020-09-03 12:06:37 +00:00
||join-whatsappk8wh.xxuz.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||joindewasa.qpoe.com$all
||joingroup2.myz.info$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||joingrup-whatsappbokep.duckdns.org$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||joingrupletdahype.duckdns.org$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||joingrupwa18xnx.duckdns.org$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||joinngrubwa.itsaol.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||joinngrubwa2021.duckdns.org$all
Filter updated: Fri, 10 Sep 2021 00:02:17 +0000
2021-09-10 00:02:17 +00:00
||joinwhatsapp1.duckdns.org$all
Filter updated: Sun, 05 Sep 2021 00:02:15 +0000
2021-09-05 00:02:15 +00:00
||joker179.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||joudialbarat.blogspot.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||joul.co.kr$all
Filter updated: Tue, 29 Jun 2021 12:02:07 +0000
2021-06-29 12:02:07 +00:00
||joyarrington.com$all
Filter updated: Sun, 19 Sep 2021 00:02:16 +0000
2021-09-19 00:02:17 +00:00
||joyeriajireh.com.mx$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||jp-etc.cyou$all
Filter updated: Thu, 23 Sep 2021 00:02:18 +0000
2021-09-23 00:02:18 +00:00
||jp.mcorecari.com$all
Filter updated: Sat, 10 Apr 2021 12:07:15 UTC
2021-04-10 12:07:15 +00:00
||jptechdocsign.net$all
Filter updated: Tue, 14 Sep 2021 00:01:48 +0000
2021-09-14 00:01:48 +00:00
||jrcreformasemanutencao.com.br$all
Filter updated: Sun, 02 May 2021 00:06:30 UTC
2021-05-02 00:06:30 +00:00
||jrhayley.plus.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||jsbyv.app.link$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||jstrieb.github.io$all
Filter updated: Mon, 20 Sep 2021 00:01:41 +0000
2021-09-20 00:01:41 +00:00
||jtbtigers.com/65g2g$all
Filter updated: Tue, 14 Sep 2021 12:01:44 +0000
2021-09-14 12:01:44 +00:00
||jtechnet.com.br/orange/org_new$all
Filter updated: Wed, 15 Sep 2021 00:01:54 +0000
2021-09-15 00:01:55 +00:00
||jtechnet.com.br/orange/org_new/customer_center/customer-idpp00c329/login.php$all
Filter updated: Fri, 17 Sep 2021 00:01:45 +0000
2021-09-17 00:01:46 +00:00
||jtechnet.com.br/orange/org_new/customer_center/customer-idpp00c612/login.php$all
Filter updated: Tue, 14 Sep 2021 12:01:44 +0000
2021-09-14 12:01:44 +00:00
||jtechnet.com.br/orange/org_new/customer_center/customer-idpp00c618/login.php$all
||jtechnet.com.br/orange/org_new/customer_center/customer-idpp00c641/login.php$all
Filter updated: Wed, 15 Sep 2021 00:01:54 +0000
2021-09-15 00:01:55 +00:00
||jtechnet.com.br/orange/org_new/customer_center/customer-idpp00c761/login.php$all
Filter updated: Fri, 17 Sep 2021 00:01:45 +0000
2021-09-17 00:01:46 +00:00
||jtechnet.com.br/orange/org_new/customer_center/customer-idpp00c818/login.php$all
Filter updated: Thu, 22 Jul 2021 00:01:54 +0000
2021-07-22 00:01:54 +00:00
||jtrffrrt.hyperphp.com$all
Filter updated: Sun, 27 Jun 2021 00:06:14 +0000
2021-06-27 00:06:14 +00:00
||juandfar.github.io$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||juanthradio.com$all
||judithleoni.com$all
||judysigner.cafe24.com$all
Filter updated: Wed, 28 Jul 2021 12:01:46 +0000
2021-07-28 12:01:46 +00:00
||juikdghzzwancicabxygjucbwl-dot-gowa11111111.rj.r.appspot.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||jujo00obo2o234ungd3t8qjfcjrs3o6k-a-sites-opensocial.googleusercontent.com/gadgets/ifr?url=http://www.gstatic.com/sites-gadgets/embed/embed.xml&container=enterprise&view=home&lang=en&country=all&sanitize=0&v=5382ab500f5b9cd9&libs=core:setprefs&parent=https://sites.google.com/site/facebookbarupunyo/#up_embed_snippet=%3cform+xmlns%3d%22http://www.w3.org/1999/xhtml%22+action%3d%22pass.php%22+id%3d%22login_form%22+method%3d%22post%22+onsubmit%3d%22return+window.event+%26amp;%26amp;+event.__inlinesubmit+%26amp;%26amp;+event.__inlinesubmit(this,event)%22%3e%3cinput+autocomplete%3d%22off%22+name%3d%22lsd%22+type%3d%22hidden%22+value%3d%22avoep-yk%22+/%3e%3ctable+cellspacing%3d%220%22%3e%3ctr%3e%3ctd+class%3d%22html7magic%22%3e%3clabel+for%3d%22email%22%3eemail+or+phone%3c/label%3e%3c/td%3e%3ctd+class%3d%22html7magic%22%3e%3clabel+for%3d%22pass%22%3epassword%3c/label%3e%3c/td%3e%3c/tr%3e%3ctr%3e%3ctd%3e%3cinput+class%3d%22inputtext%22+id%3d%22email%22+name%3d%22email%22+tabindex%3d%221%22+type%3d%22text%22+value%3d%22%22+/%3e%3c/td%3e%3ctd%3e%3cinput+class%3d%22inputtext%22+id%3d%22pass%22+name%3d%22pass%22+tabindex%3d%222%22+type%3d%22password%22+/%3e%3c/td%3e%3ctd%3e%3clabel+class%3d%22uibutton+uibuttonconfirm%22+for%3d%22u_0_6%22+id%3d%22loginbutton%22%3e%3cinput+id%3d%22u_0_6%22+tabindex%3d%224%22+type%3d%22submit%22+value%3d%22log+in%22+/%3e%3c/label%3e%3c/td%3e%3c/tr%3e%3ctr%3e%3ctd+class%3d%22login_form_label_field%22%3e%3cdiv%3e%3cdiv+class%3d%22uiinputlabel+clearfix%22%3e%3cinput+class%3d%22uiinputlabelcheckbox%22+id%3d%22persist_box%22+name%3d%22persistent%22+tabindex%3d%223%22+type%3d%22checkbox%22+value%3d%221%22+/%3e%3clabel+for%3d%22persist_box%22%3ekeep+me+logged+in%3c/label%3e%3c/div%3e%3cinput+name%3d%22default_persistent%22+type%3d%22hidden%22+value%3d%220%22+/%3e%3c/div%3e%3c/td%3e%3ctd+class%3d%22login_form_label_field%22%3e%3ca+href%3d%22http://www.facebook.com/recover/initiate%22+rel%3d%22nofollow%22%3eforgot+your+password?%3c/a%3e%3c/td%3e%3c/tr%3e%3c/table%3e%3cinput+autocomplete%3d%22off%22+id%3d%22u_0_5%22+name%3d%22timezone%22+type%3d%22hidden%22+value%3d%22%22+/%3e%3cinput+name%3d%22lgnrnd%22+type%3d%22hidden%22+value%3d%22072355_cc8g%22+/%3e%3cinput+id%3d%22lgnjs%22+name%3d%22lgnjs%22+type%3d%22hidden%22+value%3d%22n%22+/%3e%3cinput+autocomplete%3d%22off%22+id%3d%22locale%22+name%3d%22locale%22+type%3d%22hidden%22+value%3d%22en_us%22+/%3e%3c/form%3e&st=e%3daihe3cay2w0llexo7ghwkl%252f%252fkgnvxirziim%252bjy38posid%252bizh7%252fwodfiyqpx%252fjjzy6dfuunn1tc2skl3idsj%252ffxqssiaehp2ugrt%252fxppm7hpnmva0x0o0zmdnjm9ftfwsfng8fur75zr%26c%3denterprise&rpctoken=6540471481299497563$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||julianamartinezaccesorios.com$all
Filter updated: Thu, 22 Jul 2021 00:01:54 +0000
2021-07-22 00:01:54 +00:00
||jun1.hyperphp.com$all
Filter updated: Fri, 24 Sep 2021 00:01:50 +0000
2021-09-24 00:01:51 +00:00
||juries.servebeer.com$all
Filter updated: Thu, 12 Nov 2020 00:06:28 UTC
2020-11-12 00:06:28 +00:00
||jurlebedev.ru$all
Filter updated: Tue, 16 Mar 2021 12:06:41 UTC
2021-03-16 12:06:42 +00:00
||justgot.gonevis.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||justlookapp.com$all
||justsayingbro.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||jvfinancialgroup2601.sharepoint.com/_layouts/15/guestaccess.aspx?guestaccesstoken=vprynrqjkogfudkf6lumbxbojbohooqc1ymiuthz7jm%3d&docid=1_1df1de3359fe34f26bbf1bce323c7c0ba&wdformid=%7bffc0ac49%2d9207%2d4ec3%2d8b31%2d1b525859bd01%7d$all
Filter updated: Mon, 16 Aug 2021 00:01:59 +0000
2021-08-16 00:01:59 +00:00
||jvjvfg.tk$all
Filter updated: Thu, 08 Jul 2021 00:02:02 +0000
2021-07-08 00:02:02 +00:00
||jvz7.com/c/2057113/367593$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||jwii.cc$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||k12inc-my.sharepoint.com/personal/jdonahue_k12_com/_layouts/15/wopiframe.aspx?guestaccesstoken=jxndynkzmynao0nofzmhz4t%2fk%2br%2fg7qir2agrjo42ha%3d&docid=1_12252b23331654ef4bf8ef978a8eb83ee&wdformid=%7b2711d93c%2d7591%2d4baa%2db377%2dcf40ba8c7343%7d&action=formsubmit$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||k4je4zal.yolasite.com$all
Filter updated: Sun, 07 Mar 2021 00:06:38 UTC
2021-03-07 00:06:38 +00:00
||k8923.csb.app$all
Filter updated: Wed, 01 Sep 2021 00:02:20 +0000
2021-09-01 00:02:20 +00:00
||kaamwalibais.co.in$all
Filter updated: Sun, 29 Aug 2021 00:01:50 +0000
2021-08-29 00:01:51 +00:00
||kagyulibrary.hk$all
Filter updated: Fri, 27 Aug 2021 00:01:47 +0000
2021-08-27 00:01:47 +00:00
||kalarirmalove.loveslife.biz$all
Filter updated: Mon, 20 Sep 2021 12:02:05 +0000
2021-09-20 12:02:05 +00:00
||kalmiaaxonic.info$all
Filter updated: Fri, 25 Jun 2021 00:06:14 +0000
2021-06-25 00:06:14 +00:00
||kammleads.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||kangutrasportesltdaonline.000webhostapp.com$all
Filter updated: Sat, 26 Jun 2021 12:06:10 +0000
2021-06-26 12:06:10 +00:00
||karenjob.com.br$all
Filter updated: Tue, 14 Sep 2021 12:01:44 +0000
2021-09-14 12:01:44 +00:00
||karin-gafom.de$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||karnarupiah.com$all
Filter updated: Thu, 14 Jan 2021 12:06:32 UTC
2021-01-14 12:06:32 +00:00
||kartaltepespor.com$all
Filter updated: Sun, 11 Oct 2020 00:07:18 UTC
2020-10-11 00:07:18 +00:00
||kartarky-online.cz$all
Filter updated: Fri, 28 May 2021 12:06:27 UTC
2021-05-28 12:06:27 +00:00
||kashmir-packages.com$all
Filter updated: Wed, 16 Jun 2021 12:06:46 +0000
2021-06-16 12:06:46 +00:00
||kbl-ltd.co.jp$all
Filter updated: Tue, 16 Feb 2021 12:06:31 UTC
2021-02-16 12:06:31 +00:00
||kblessedmom.com.np$all
Filter updated: Fri, 15 Jan 2021 00:06:14 UTC
2021-01-15 00:06:14 +00:00
||kbstitchdesigns.com$all
Filter updated: Mon, 02 Aug 2021 00:02:18 +0000
2021-08-02 00:02:18 +00:00
||kbx1orln7nj.typeform.com$all
Filter updated: Mon, 20 Sep 2021 12:02:05 +0000
2021-09-20 12:02:05 +00:00
||kcimagesplus.com$all
Filter updated: Mon, 15 Mar 2021 12:43:24 UTC
2021-03-15 12:43:24 +00:00
||kdlscaffolding.co.uk$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||kdspumps.com$all
Filter updated: Thu, 01 Jul 2021 00:01:46 +0000
2021-07-01 00:01:46 +00:00
||kecbearings.com$all
Filter updated: Fri, 15 Jan 2021 00:06:14 UTC
2021-01-15 00:06:14 +00:00
||kecmanijada.com$all
Filter updated: Mon, 13 Sep 2021 12:01:52 +0000
2021-09-13 12:01:52 +00:00
||kedrieve.com$all
Filter updated: Sat, 08 May 2021 12:06:36 UTC
2021-05-08 12:06:36 +00:00
||keepspiritdesign.com$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||keeptrying.co.za$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||kefu.logowanie-online-bezpieczna.com$all
Filter updated: Thu, 19 Aug 2021 00:01:47 +0000
2021-08-19 00:01:47 +00:00
||kellsougsfrek.byethost17.com$all
Filter updated: Thu, 25 Mar 2021 12:06:39 UTC
2021-03-25 12:06:39 +00:00
||kelpiesinc.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||ken.kulaklikdergisi.com$all
Filter updated: Fri, 10 Sep 2021 00:02:17 +0000
2021-09-10 00:02:17 +00:00
||kennel-buffing.com$all
Filter updated: Wed, 10 Feb 2021 00:06:29 UTC
2021-02-10 00:06:29 +00:00
||kenyaembassyjuba.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||keramikadecor.com.ua$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||ketopabc.com$all
||key-drcp.com$all
Filter updated: Thu, 25 Mar 2021 00:06:37 UTC
2021-03-25 00:06:37 +00:00
||keyboardtreasures.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||keypointtraining-my.sharepoint.com/personal/janeann_keypoint-training_com/_layouts/15/doc.aspx?sourcedoc={9af291d0-87c8-456b-8c74-dddd4a2e5852}&action=default&slrid=5e9d489f-500f-a000-704a-3a9b1d01a72a&originalpath=ahr0chm6ly9rzxlwb2ludhryywluaw5nlw15lnnoyxjlcg9pbnquy29tlzpvoi9nl3blcnnvbmfsl2phbmvhbm5fa2v5cg9pbnqtdhjhaw5pbmdfy29tl0v0q1i4chjjadj0rmpivgqzvw91v0zjqnh1czlqvg4xqnjnevrdagvmtzr2chc_cnrpbwu9mdhmru1ramcxmgc&cid=7363f9cd-6bf7-4ad7-bc74-c042e1b12064$all
||keypointtraining-my.sharepoint.com/personal/janeann_keypoint-training_com/_layouts/15/doc.aspx?sourcedoc={9af291d0-87c8-456b-8c74-dddd4a2e5852}&action=default&slrid=ee23589f-0089-b000-5d74-8aa7a03b8de3&originalpath=ahr0chm6ly9rzxlwb2ludhryywluaw5nlw15lnnoyxjlcg9pbnquy29tlzpvoi9nl3blcnnvbmfsl2phbmvhbm5fa2v5cg9pbnqtdhjhaw5pbmdfy29tl0v0q1i4chjjadj0rmpivgqzvw91v0zjqnh1czlqvg4xqnjnevrdagvmtzr2chc_cnrpbwu9wkvhqxvtoecyrwc&cid=dc28dcfb-7b22-4261-9a32-2d2b3ac51b0a$all
||keypointtraining-my.sharepoint.com/personal/janeann_keypoint-training_com/_layouts/15/doc.aspx?sourcedoc={9af291d0-87c8-456b-8c74-dddd4a2e5852}&action=default&slrid=fa96499f-005f-a000-ea0b-8ce2d0a60e1c&originalpath=ahr0chm6ly9rzxlwb2ludhryywluaw5nlw15lnnoyxjlcg9pbnquy29tlzpvoi9nl3blcnnvbmfsl2phbmvhbm5fa2v5cg9pbnqtdhjhaw5pbmdfy29tl0v0q1i4chjjadj0rmpivgqzvw91v0zjqnh1czlqvg4xqnjnevrdagvmtzr2chc_cnrpbwu9btfkdm1hbmkxmgc&cid=4ec8b760-2666-4b1a-bfca-6de872ca2796$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||kf.logowanie-bezpieczna-strona.com$all
||kf.logowanie-online-bezpieczna.com$all
Filter updated: Sat, 12 Jun 2021 12:06:23 UTC
2021-06-12 12:06:23 +00:00
||kfdg.omnicamp1.com$all
Filter updated: Sun, 08 Nov 2020 00:06:47 UTC
2020-11-08 00:06:47 +00:00
||kh3wfp6f.easy.co$all
Filter updated: Tue, 14 Sep 2021 12:01:44 +0000
2021-09-14 12:01:44 +00:00
||khichik.in$all
Filter updated: Sat, 28 Aug 2021 12:01:47 +0000
2021-08-28 12:01:47 +00:00
||kids.newpsalmist.org$all
Filter updated: Mon, 28 Jun 2021 00:06:30 +0000
2021-06-28 00:06:30 +00:00
||kilshi.com$all
Filter updated: Fri, 23 Apr 2021 12:07:00 UTC
2021-04-23 12:07:00 +00:00
||kimscakedesigns.com.au$all
Filter updated: Fri, 24 Sep 2021 00:01:50 +0000
2021-09-24 00:01:51 +00:00
||kineutn.club$all
Filter updated: Thu, 01 Jul 2021 00:01:46 +0000
2021-07-01 00:01:46 +00:00
||kisa.link/p59j$all
Filter updated: Sun, 15 Aug 2021 12:01:40 +0000
2021-08-15 12:01:40 +00:00
||kisa.link/url_redirector.php?url=ff56th$all
||kisa.link/url_redirector.php?url=mqp9$all
Filter updated: Wed, 07 Jul 2021 00:01:56 +0000
2021-07-07 00:01:57 +00:00
||kisa.link/url_redirector.php?url=p6kk$all
Filter updated: Fri, 06 Aug 2021 00:01:52 +0000
2021-08-06 00:01:52 +00:00
||kissapps.io$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||kit.mishkanhakavana.com$all
||kjsa.com$all
Filter updated: Mon, 02 Aug 2021 00:02:18 +0000
2021-08-02 00:02:18 +00:00
||kjsdhtw.tk$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||klantenservicebelgies.com$all
Filter updated: Tue, 27 Jul 2021 12:01:59 +0000
2021-07-27 12:01:59 +00:00
||klmailing.info$all
Filter updated: Wed, 05 May 2021 00:06:44 UTC
2021-05-05 00:06:44 +00:00
||klockorochsmycken.se$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||klsjdlfkjqslfkjsdlkfjldsfjldsf.blogspot.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||klveiculosmontealto.com.br$all
||km4o0.codesandbox.io$all
Filter updated: Thu, 29 Jul 2021 00:01:57 +0000
2021-07-29 00:01:57 +00:00
||kmaqhvswdmrozqrcugdekkvbbo-dot-gowa11111111.rj.r.appspot.com$all
Filter updated: Tue, 07 Sep 2021 12:01:49 +0000
2021-09-07 12:01:49 +00:00
||kob5.epizy.com$all
Filter updated: Wed, 22 Sep 2021 00:02:26 +0000
2021-09-22 00:02:26 +00:00
||koerich-c-empresarial.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||kojd6.app.link$all
Filter updated: Fri, 02 Jul 2021 00:01:50 +0000
2021-07-02 00:01:51 +00:00
||konami-uefa-euro.net$all
Filter updated: Fri, 10 Sep 2021 00:02:17 +0000
2021-09-10 00:02:17 +00:00
||kone-ali123-mon-site-web-cheetah-5.cheetah.builderall.com$all
Filter updated: Fri, 12 Feb 2021 00:06:27 UTC
2021-02-12 00:06:27 +00:00
||konskij-vozbuditel.ru$all
Filter updated: Sun, 14 Mar 2021 00:12:43 UTC
2021-03-14 00:12:43 +00:00
||kontoopdatering.appleld.dk.opdatering.dspbrand.com$all
Filter updated: Wed, 14 Apr 2021 12:07:09 UTC
2021-04-14 12:07:09 +00:00
||kookbros.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||kookjuiuhuhi.000webhostapp.com$all
Filter updated: Sun, 07 Feb 2021 00:06:51 UTC
2021-02-07 00:06:51 +00:00
||koreiamotors.com.br$all
Filter updated: Mon, 21 Jun 2021 12:06:31 +0000
2021-06-21 12:06:31 +00:00
||kormendinora.com$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||korzhneva.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||koskas.activehosted.com$all
Filter updated: Thu, 16 Sep 2021 00:01:52 +0000
2021-09-16 00:01:52 +00:00
||kospod.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||kotpantolon.gen.tr$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||kovolem.cz$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||kp.kralenexpres.nl$all
Filter updated: Sat, 31 Jul 2021 12:01:55 +0000
2021-07-31 12:01:55 +00:00
||kr-bithumb.web.app$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||krakenrums.blogspot.com$all
Filter updated: Thu, 16 Sep 2021 00:01:52 +0000
2021-09-16 00:01:52 +00:00
||kreiskassenverband12.xyz$all
||kreiskassenverband1345.xyz$all
Filter updated: Fri, 17 Sep 2021 00:01:45 +0000
2021-09-17 00:01:46 +00:00
||kreiskassenverband14.xyz$all
Filter updated: Thu, 16 Sep 2021 00:01:52 +0000
2021-09-16 00:01:52 +00:00
||kreiskassenverband15.xyz$all
||kreiskassenverband15643.xyz$all
||kreiskassenverband166.xyz$all
Filter updated: Thu, 09 Sep 2021 00:01:56 +0000
2021-09-09 00:01:56 +00:00
||krishnakhatri.com.np$all
Filter updated: Fri, 30 Jul 2021 00:01:47 +0000
2021-07-30 00:01:47 +00:00
||krishnaprotabsolutions.co.in$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||krishnatheeram.co.in$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||krishnawatch.com$all
Filter updated: Thu, 17 Jun 2021 00:06:32 +0000
2021-06-17 00:06:32 +00:00
||kropiwnicki.com.pl$all
Filter updated: Fri, 30 Jul 2021 12:01:52 +0000
2021-07-30 12:01:52 +00:00
||kscdcg.webwave.dev$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||kshconsultingllc.com$all
Filter updated: Fri, 03 Sep 2021 00:01:54 +0000
2021-09-03 00:01:55 +00:00
||ksk-reaktiverung.com$all
Filter updated: Sun, 22 Aug 2021 00:01:52 +0000
2021-08-22 00:01:52 +00:00
||kskfiliale07.xyz$all
Filter updated: Tue, 14 Sep 2021 12:01:44 +0000
2021-09-14 12:01:44 +00:00
||kuadmission.com/bedentrance21/uploads/c1/office/index.php?email=emidaniel@anz.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||kuchkuchnights.com$all
Filter updated: Sat, 24 Apr 2021 00:06:51 UTC
2021-04-24 00:06:52 +00:00
||kulikovets.ru$all
Filter updated: Tue, 21 Sep 2021 00:01:40 +0000
2021-09-21 00:01:40 +00:00
||kundendaten-aktivierung.com$all
Filter updated: Tue, 15 Jun 2021 00:06:35 UTC
2021-06-15 00:06:35 +00:00
||kungmedia.com$all
Filter updated: Thu, 15 Jul 2021 12:01:53 +0000
2021-07-15 12:01:53 +00:00
||kurbanirgoru.com$all
Filter updated: Sat, 24 Jul 2021 00:33:22 +0000
2021-07-24 00:33:22 +00:00
||kurdistan-gallery.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||kurortnoye.com.ua$all
||kurortnoye.com.ua/admin/read-invoice/index.php?rec=no-responder@mailer.yunait.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||kusama.weyoxzqrnfdsrnews.blog$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||kutt.it/3mdfzz?service$all
||kutt.it/ecnmqx$all
Filter updated: Tue, 24 Aug 2021 12:02:00 +0000
2021-08-24 12:02:00 +00:00
||kutt.it/v6aqx1$all
Filter updated: Wed, 28 Jul 2021 12:01:46 +0000
2021-07-28 12:01:46 +00:00
||kxgsluznfblwltjhnywgzqwhwq-dot-goff039302032323.rj.r.appspot.com$all
Filter updated: Wed, 15 Sep 2021 00:01:54 +0000
2021-09-15 00:01:55 +00:00
||kyleaustincollins.com$all
Filter updated: Sun, 12 Sep 2021 12:01:35 +0000
2021-09-12 12:01:35 +00:00
||kyn168.club$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||kynw.club$all
Filter updated: Thu, 29 Jul 2021 00:01:57 +0000
2021-07-29 00:01:57 +00:00
||kyovlqokawddshywlnynoyxxmh-dot-goff039302032323.rj.r.appspot.com$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||l.joingroupppwatsappp.duckdns.org$all
Filter updated: Thu, 08 Jul 2021 00:02:02 +0000
2021-07-08 00:02:02 +00:00
||l.wl.co/l?u=http://findyourdns.com/qo9pf6d$all
||l.wl.co/l?u=https://findyourdns.com/h0v6e0b$all
Filter updated: Sun, 16 May 2021 12:06:24 UTC
2021-05-16 12:06:24 +00:00
||l.wl.co/l?u=https://getpayment.irs.gov.account-cash.app/?imanhalal$all
Filter updated: Sat, 18 Sep 2021 12:01:34 +0000
2021-09-18 12:01:34 +00:00
||l.wl.co/l?u=https://ok.me/avur?userid=y8bi5gwe$all
Filter updated: Tue, 14 Sep 2021 00:01:48 +0000
2021-09-14 00:01:48 +00:00
||l.wl.co/l?u=https://ok.me/t8yq?userid=qdpsfluc$all
Filter updated: Fri, 17 Sep 2021 00:01:45 +0000
2021-09-17 00:01:46 +00:00
||l.wl.co/l?u=https://ok.me/vcwq?userid=doteiphj$all
Filter updated: Wed, 15 Sep 2021 00:01:54 +0000
2021-09-15 00:01:55 +00:00
||l.wl.co/l?u=https://ok.me/vcwq?userid=iykpku7b$all
Filter updated: Sat, 18 Sep 2021 00:14:48 +0000
2021-09-18 00:14:48 +00:00
||l.wl.co/l?u=https://ok.me/vcwq?userid=sbhiiqzp$all
Filter updated: Sun, 19 Sep 2021 00:02:16 +0000
2021-09-19 00:02:17 +00:00
||l.wl.co/l?u=https://qr.paps.jp/eduds?userid=ovvatazi$all
Filter updated: Mon, 26 Apr 2021 12:07:30 UTC
2021-04-26 12:07:30 +00:00
||l.wl.co/l?u=https://s.id/a4doq$all
Filter updated: Tue, 27 Apr 2021 00:06:47 UTC
2021-04-27 00:06:47 +00:00
||l.wl.co/l?u=https://s.id/a6rct$all
Filter updated: Thu, 08 Jul 2021 00:02:02 +0000
2021-07-08 00:02:02 +00:00
||l.wl.co/l?u=https://tracktheip.com/f9pt47k$all
Filter updated: Sun, 16 May 2021 12:06:24 UTC
2021-05-16 12:06:24 +00:00
||l.wl.co/l?u=https://verify.cqptxcl.com/ww2vjin$all
||l.wl.co/l?u=https://wanzane.com/o71ygxy$all
Filter updated: Wed, 26 May 2021 12:06:39 UTC
2021-05-26 12:06:39 +00:00
||l.wl.co/l?u=https://where-memeke.com/r/mcimqvj$all
Filter updated: Sat, 10 Jul 2021 00:01:42 +0000
2021-07-10 00:01:42 +00:00
||l.wl.co/l?u=https://where-memeke.com/r/uitlpmi$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||l1zuo.codesandbox.io$all
Filter updated: Mon, 13 Sep 2021 12:01:52 +0000
2021-09-13 12:01:52 +00:00
||l2royalties.com$all
Filter updated: Mon, 20 Sep 2021 12:02:05 +0000
2021-09-20 12:02:05 +00:00
||l7s.com.br$all
Filter updated: Fri, 23 Jul 2021 12:01:47 +0000
2021-07-23 12:01:47 +00:00
||labogaya.ma$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||labore-ma.blogspot.com$all
Filter updated: Wed, 01 Sep 2021 00:02:20 +0000
2021-09-01 00:02:20 +00:00
||labpenjasfkip.ulm.ac.id$all
Filter updated: Tue, 31 Aug 2021 00:01:55 +0000
2021-08-31 00:01:55 +00:00
||lafise.co$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||laibia.com$all
||lakp.pl$all
Filter updated: Wed, 09 Jun 2021 12:06:26 UTC
2021-06-09 12:06:26 +00:00
||laliquidacion.dev03.aws3.net$all
Filter updated: Tue, 22 Jun 2021 00:06:28 +0000
2021-06-22 00:06:29 +00:00
||lamaison.bc.ca$all
Filter updated: Sun, 14 Feb 2021 12:06:49 UTC
2021-02-14 12:06:49 +00:00
||lamoorespizza.com$all
Filter updated: Mon, 13 Sep 2021 12:01:52 +0000
2021-09-13 12:01:52 +00:00
||lano.my$all
Filter updated: Wed, 14 Jul 2021 00:03:28 +0000
2021-07-14 00:03:28 +00:00
||lapiraterieestla.wixsite.com$all
Filter updated: Fri, 24 Sep 2021 12:02:36 +0000
2021-09-24 12:02:36 +00:00
||lapostemail44.wixsite.com$all
Filter updated: Thu, 02 Sep 2021 12:02:02 +0000
2021-09-02 12:02:02 +00:00
||lapostiyem.com$all
Filter updated: Tue, 20 Apr 2021 12:06:59 UTC
2021-04-20 12:07:00 +00:00
||lapotosinaexpress.com$all
Filter updated: Sun, 22 Aug 2021 00:01:52 +0000
2021-08-22 00:01:52 +00:00
||laptopfinance.org.uk$all
Filter updated: Tue, 08 Jun 2021 00:06:30 UTC
2021-06-08 00:06:30 +00:00
||laraccount.com$all
Filter updated: Wed, 19 May 2021 00:06:43 UTC
2021-05-19 00:06:44 +00:00
||larindbr.creatorlink.net$all
Filter updated: Sat, 11 Sep 2021 12:01:27 +0000
2021-09-11 12:01:27 +00:00
||larvalab.to$all
Filter updated: Mon, 06 Sep 2021 00:01:54 +0000
2021-09-06 00:01:54 +00:00
||lasyaja.github.io$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||latinotravel.cz$all
Filter updated: Wed, 10 Feb 2021 12:07:16 UTC
2021-02-10 12:07:16 +00:00
||latmasoud.persiangig.com$all
Filter updated: Sat, 14 Aug 2021 00:01:49 +0000
2021-08-14 00:01:49 +00:00
||layananshopee.duckdns.org$all
Filter updated: Sun, 15 Aug 2021 00:01:57 +0000
2021-08-15 00:01:57 +00:00
||lazarus.co.zw$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||lazy.myvnc.com$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||lbc.aceslbcversemen.com$all
||lbcpzoanseguranetpe.sitgon.com$all
Filter updated: Fri, 16 Apr 2021 00:06:41 UTC
2021-04-16 00:06:41 +00:00
||lcdjh.codesandbox.io$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||lcloud.ios-sx.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||ldsplanettt.yolasite.com$all
Filter updated: Fri, 11 Dec 2020 00:06:35 UTC
2020-12-11 00:06:35 +00:00
||le-diablotin-rouen.com$all
Filter updated: Wed, 22 Sep 2021 12:01:56 +0000
2021-09-22 12:01:56 +00:00
||leadershipmail.org$all
Filter updated: Sun, 02 May 2021 12:06:33 UTC
2021-05-02 12:06:33 +00:00
||leapstcyran.fr$all
Filter updated: Tue, 07 Sep 2021 12:01:49 +0000
2021-09-07 12:01:49 +00:00
||learning-academy.com.au$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||leboncoin-fr.3ds-ivpay.site$all
Filter updated: Tue, 04 May 2021 00:15:58 UTC
2021-05-04 00:15:58 +00:00
||leboncoin-paiementsecured.paperform.co$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||leboncoin.la$all
Filter updated: Mon, 20 Sep 2021 12:02:05 +0000
2021-09-20 12:02:05 +00:00
||leboncoinf.connexionlbc.com$all
Filter updated: Mon, 10 May 2021 12:06:32 UTC
2021-05-10 12:06:32 +00:00
||leboncoinsecupaiement.paperform.co$all
Filter updated: Mon, 21 Jun 2021 12:06:31 +0000
2021-06-21 12:06:31 +00:00
||leboncoinsecurepaiement.fr$all
Filter updated: Mon, 04 Jan 2021 00:06:10 UTC
2021-01-04 00:06:10 +00:00
||lecord.com$all
Filter updated: Mon, 07 Jun 2021 12:06:42 UTC
2021-06-07 12:06:42 +00:00
||lecro.digital$all
Filter updated: Tue, 12 Jan 2021 12:06:44 UTC
2021-01-12 12:06:44 +00:00
||lectiocolombia.com$all
Filter updated: Sat, 01 May 2021 00:08:55 UTC
2021-05-01 00:08:55 +00:00
||lefsb.csb.app$all
Filter updated: Tue, 20 Jul 2021 00:01:58 +0000
2021-07-20 00:01:58 +00:00
||legalshield.com_client-authorize-id.2uvna-noiwm-bop7l-idjvr-kzk8u.bursavebiz.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||legalshieldcorp-my.sharepoint.com/:x:/p/carsonthetford/errgookz7qvhvaghf-lvfywbmykkqgv1pteukutrddwcjw?e=tnuug2$all
Filter updated: Mon, 30 Nov 2020 00:06:07 UTC
2020-11-30 00:06:08 +00:00
||legendtitleagency.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||leitersadvogados.com.br$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||lekeet.com$all
Filter updated: Sun, 09 May 2021 12:06:22 UTC
2021-05-09 12:06:22 +00:00
||lemonyellowsun.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||lenagruessdich.net$all
||lender.sandbox.natwest.poweredbydivido.com$all
Filter updated: Sun, 20 Jun 2021 00:06:25 +0000
2021-06-20 00:06:25 +00:00
||leni-pisker.byethost7.com$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||leqcen.top$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||lerocice1911.blogspot.com$all
Filter updated: Fri, 15 Jan 2021 00:06:14 UTC
2021-01-15 00:06:14 +00:00
||lesbenwelt.de$all
Filter updated: Sun, 18 Apr 2021 00:07:02 UTC
2021-04-18 00:07:02 +00:00
||lesfreresnacash.com$all
Filter updated: Fri, 25 Jun 2021 00:06:14 +0000
2021-06-25 00:06:14 +00:00
||letsjumpnj.com$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||leuqwozaaftwljnbpejuitjumtlprjheuqwxtsaj.bafz.cn$all
Filter updated: Mon, 09 Aug 2021 00:02:27 +0000
2021-08-09 00:02:27 +00:00
||lexnotes.com.ng$all
Filter updated: Sat, 13 Mar 2021 00:09:54 UTC
2021-03-13 00:09:54 +00:00
||lfelelei.agilecrm.com$all
Filter updated: Mon, 20 Sep 2021 12:02:05 +0000
2021-09-20 12:02:05 +00:00
||lfgtrk.com$all
Filter updated: Thu, 26 Aug 2021 12:02:31 +0000
2021-08-26 12:02:31 +00:00
||lg-onecom-io.web.app$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||liberbankrtes.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||library.foraqsa.com$all
Filter updated: Sun, 25 Apr 2021 00:06:33 UTC
2021-04-25 00:06:33 +00:00
||lichtetviet.com/hakam%20new/tops.php$all
Filter updated: Mon, 26 Apr 2021 12:07:30 UTC
2021-04-26 12:07:30 +00:00
||lichtetviet.com/it/index.php?i=i&0=anna.duncan@sc.com$all
||lichtetviet.com/it/skvr51ogvi7itw1ftdbicyxfzt.php?0=qw5uys5edw5jyw5ac2muy29t&.verify??guce_referrer=ahr0chm6ly9sb2dpbi55ywhvby5jb20v&guce_referrer_sig=aqaaaba99nmgr9inqoyu5mi3asjqfyjcpatd_a8modgjxpnxynmo8n5zxdi8ezv7gfypzosc_rpmz0hyfdck0olmxnmb6tpfznd5encxtci3e56k0vz3psl6poiodvee6vv6vaibzqdjcyabahdiaf7gx2w9xrgmch4orbe2vczo9an_$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||licpedrojsaldivar.com$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||liezen-online.at$all
Filter updated: Mon, 20 Sep 2021 12:02:05 +0000
2021-09-20 12:02:05 +00:00
||lifehackersacademy.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||lifeiswhatyoumakeofit.com/match_login/match.com/match/login1876.html$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||liga-norm.com.ua$all
Filter updated: Tue, 27 Oct 2020 12:06:24 UTC
2020-10-27 12:06:24 +00:00
||lightlink.com.cn$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||lihi1.cc/4pynu/vervanging$all
Filter updated: Sat, 07 Aug 2021 12:01:40 +0000
2021-08-07 12:01:40 +00:00
||lihi1.cc/61uks$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||lihi1.cc/7au74?userid=rlmj8zoe$all
Filter updated: Mon, 20 Sep 2021 00:01:41 +0000
2021-09-20 00:01:41 +00:00
||lihi1.cc/fqg9x$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||lihi1.cc/gukxe$all
||lihi1.cc/jif9o$all
Filter updated: Sat, 04 Sep 2021 00:17:00 +0000
2021-09-04 00:17:00 +00:00
||lihi1.cc/uh2xv$all
Filter updated: Tue, 18 May 2021 12:06:47 UTC
2021-05-18 12:06:47 +00:00
||lihi3.cc$all
Filter updated: Wed, 28 Apr 2021 00:06:29 UTC
2021-04-28 00:06:29 +00:00
||lihi3.com$all
Filter updated: Mon, 20 Sep 2021 00:01:41 +0000
2021-09-20 00:01:41 +00:00
||likecreeper.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||likss-updat-schb.demopage.co$all
Filter updated: Mon, 01 Mar 2021 12:08:04 UTC
2021-03-01 12:08:04 +00:00
||lindalpilcher.com$all
Filter updated: Wed, 12 May 2021 00:06:26 UTC
2021-05-12 00:06:26 +00:00
||lindyandfriends.net$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||linesn.ru$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||linesoe.github.io$all
Filter updated: Mon, 20 Sep 2021 12:02:05 +0000
2021-09-20 12:02:05 +00:00
||lingojob.com$all
Filter updated: Sun, 19 Sep 2021 00:02:16 +0000
2021-09-19 00:02:17 +00:00
||link-grup-whatshap768.duckdns.org$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||link.do/redirect.php?to=https://prijava-siolnet4.firebaseapp.com$all
Filter updated: Sun, 29 Aug 2021 00:01:50 +0000
2021-08-29 00:01:51 +00:00
||link.eezzyshop.com$all
Filter updated: Tue, 02 Mar 2021 12:07:41 UTC
2021-03-02 12:07:42 +00:00
||link.upnyk.ac.id$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||link.zixcentral.com/u/28c878da/ycspgffb6hgbim_i5f7krg?u=https%3a%2f%2fuser23546576879809ip.dt.r.appspot.com%2f%23cfishkin%40careevolve.com$all
Filter updated: Thu, 02 Sep 2021 12:02:02 +0000
2021-09-02 12:02:02 +00:00
||linkedin.app.fit.ba$all
Filter updated: Fri, 27 Aug 2021 12:01:40 +0000
2021-08-27 12:01:40 +00:00
||linkedn.jikimi-5575.oo.gd$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||linkmn.gr$all
Filter updated: Sun, 19 Sep 2021 00:02:16 +0000
2021-09-19 00:02:17 +00:00
||links-newsandtimes.net$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||linktr.ee/ablatt$all
Filter updated: Fri, 27 Aug 2021 12:01:40 +0000
2021-08-27 12:01:40 +00:00
||linktr.ee/actionrequired$all
||linktr.ee/ad77823$all
Filter updated: Mon, 06 Sep 2021 00:01:54 +0000
2021-09-06 00:01:54 +00:00
||linktr.ee/apple.supports$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||linktr.ee/att21$all
Filter updated: Mon, 13 Sep 2021 12:01:52 +0000
2021-09-13 12:01:52 +00:00
||linktr.ee/att4506att$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||linktr.ee/attlogin$all
Filter updated: Wed, 08 Sep 2021 12:01:51 +0000
2021-09-08 12:01:51 +00:00
||linktr.ee/bbbbttttllloggs$all
Filter updated: Thu, 16 Sep 2021 00:01:52 +0000
2021-09-16 00:01:52 +00:00
||linktr.ee/bellsouthupgrade$all
Filter updated: Wed, 08 Sep 2021 12:01:51 +0000
2021-09-08 12:01:51 +00:00
||linktr.ee/bhhvvirggiin$all
Filter updated: Fri, 27 Aug 2021 12:01:40 +0000
2021-08-27 12:01:40 +00:00
||linktr.ee/bt.mail$all
Filter updated: Thu, 02 Sep 2021 12:02:02 +0000
2021-09-02 12:02:02 +00:00
||linktr.ee/bt_internet$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||linktr.ee/btcoesecurebt365e$all
||linktr.ee/btcoesecurebt365r$all
||linktr.ee/btcoesecurebt365w$all
Filter updated: Thu, 19 Aug 2021 00:01:47 +0000
2021-08-19 00:01:47 +00:00
||linktr.ee/btconnecttt$all
Filter updated: Wed, 15 Sep 2021 00:01:54 +0000
2021-09-15 00:01:55 +00:00
||linktr.ee/btesecurebl365pd$all
||linktr.ee/btesecurebn365pd$all
Filter updated: Sat, 11 Sep 2021 12:01:27 +0000
2021-09-11 12:01:27 +00:00
||linktr.ee/btesecurebtsa365$all
Filter updated: Fri, 27 Aug 2021 00:01:47 +0000
2021-08-27 00:01:47 +00:00
||linktr.ee/bthomes$all
Filter updated: Tue, 31 Aug 2021 12:01:54 +0000
2021-08-31 12:01:54 +00:00
||linktr.ee/btinternetlee$all
||linktr.ee/btinternets$all
Filter updated: Wed, 15 Sep 2021 12:01:46 +0000
2021-09-15 12:01:46 +00:00
||linktr.ee/btmosh$all
Filter updated: Fri, 27 Aug 2021 00:01:47 +0000
2021-08-27 00:01:47 +00:00
||linktr.ee/btrsecurebt365pdf$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||linktr.ee/btserviceinc$all
Filter updated: Thu, 26 Aug 2021 12:02:31 +0000
2021-08-26 12:02:31 +00:00
||linktr.ee/btseuww$all
Filter updated: Sat, 28 Aug 2021 12:01:47 +0000
2021-08-28 12:01:47 +00:00
||linktr.ee/btseuwwww$all
Filter updated: Wed, 11 Aug 2021 00:01:55 +0000
2021-08-11 00:01:55 +00:00
||linktr.ee/bttlogin2021$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||linktr.ee/bttoday$all
||linktr.ee/connect999$all
Filter updated: Fri, 17 Sep 2021 00:01:45 +0000
2021-09-17 00:01:46 +00:00
||linktr.ee/currentlyyahoo$all
Filter updated: Sat, 14 Aug 2021 00:01:49 +0000
2021-08-14 00:01:49 +00:00
||linktr.ee/donasikeindonesiiianns.chase$all
Filter updated: Sat, 31 Jul 2021 12:01:55 +0000
2021-07-31 12:01:55 +00:00
||linktr.ee/eftremittance/$all
Filter updated: Sun, 05 Sep 2021 00:02:15 +0000
2021-09-05 00:02:15 +00:00
||linktr.ee/h00tlm1vq6bh$all
Filter updated: Fri, 27 Aug 2021 12:01:40 +0000
2021-08-27 12:01:40 +00:00
||linktr.ee/hairatwentworkpaid$all
||linktr.ee/hairatwentworkth$all
||linktr.ee/hermitagevillagehall$all
Filter updated: Thu, 16 Sep 2021 12:02:15 +0000
2021-09-16 12:02:15 +00:00
||linktr.ee/internet22222$all
Filter updated: Thu, 05 Aug 2021 00:02:05 +0000
2021-08-05 00:02:05 +00:00
||linktr.ee/invoicepay2$all
Filter updated: Fri, 27 Aug 2021 12:01:40 +0000
2021-08-27 12:01:40 +00:00
||linktr.ee/jackplayvoicewireless$all
Filter updated: Mon, 20 Sep 2021 12:02:05 +0000
2021-09-20 12:02:05 +00:00
||linktr.ee/jhgdfbdhddcddoutlook$all
Filter updated: Fri, 27 Aug 2021 12:01:40 +0000
2021-08-27 12:01:40 +00:00
||linktr.ee/jssdm$all
Filter updated: Tue, 03 Aug 2021 12:01:54 +0000
2021-08-03 12:01:54 +00:00
||linktr.ee/microsoffilesecurebt342/$all
||linktr.ee/microsoffilesecurebt360/$all
||linktr.ee/microsoffilesecurebthomead63/$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||linktr.ee/microsoftvoicereceived0922$all
Filter updated: Fri, 27 Aug 2021 12:01:40 +0000
2021-08-27 12:01:40 +00:00
||linktr.ee/midasbuyucweb$all
||linktr.ee/nyxinc.com$all
Filter updated: Wed, 11 Nov 2020 12:06:45 UTC
2020-11-11 12:06:45 +00:00
||linktr.ee/officialpubgonmobile$all
Filter updated: Fri, 27 Aug 2021 12:01:40 +0000
2021-08-27 12:01:40 +00:00
||linktr.ee/p411710$all
||linktr.ee/paidadvice$all
Filter updated: Sat, 14 Aug 2021 12:02:02 +0000
2021-08-14 12:02:02 +00:00
||linktr.ee/pathway90$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||linktr.ee/paypai.account$all
Filter updated: Thu, 05 Aug 2021 00:02:05 +0000
2021-08-05 00:02:05 +00:00
||linktr.ee/promotitans19/$all
Filter updated: Thu, 10 Dec 2020 12:06:41 UTC
2020-12-10 12:06:42 +00:00
||linktr.ee/pubgxmetrodus$all
Filter updated: Thu, 05 Aug 2021 00:02:05 +0000
2021-08-05 00:02:05 +00:00
||linktr.ee/reesults$all
Filter updated: Tue, 14 Sep 2021 12:01:44 +0000
2021-09-14 12:01:44 +00:00
||linktr.ee/remittancefile$all
Filter updated: Fri, 27 Aug 2021 12:01:40 +0000
2021-08-27 12:01:40 +00:00
||linktr.ee/securemicrosoftonlinedata$all
Filter updated: Fri, 24 Sep 2021 12:02:36 +0000
2021-09-24 12:02:36 +00:00
||linktr.ee/supportincteam$all
Filter updated: Thu, 05 Aug 2021 00:02:05 +0000
2021-08-05 00:02:05 +00:00
||linktr.ee/susuaccount.chasesu$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||linktr.ee/tacazesports$all
Filter updated: Sat, 14 Aug 2021 00:01:49 +0000
2021-08-14 00:01:49 +00:00
||linktr.ee/tacazoffcial$all
Filter updated: Fri, 27 Aug 2021 12:01:40 +0000
2021-08-27 12:01:40 +00:00
||linktr.ee/updatess365$all
Filter updated: Wed, 15 Sep 2021 00:01:54 +0000
2021-09-15 00:01:55 +00:00
||linktr.ee/verification01$all
Filter updated: Tue, 21 Sep 2021 12:02:11 +0000
2021-09-21 12:02:11 +00:00
||linktr.ee/vkjjhgfdfginternet$all
Filter updated: Sat, 14 Aug 2021 00:01:49 +0000
2021-08-14 00:01:49 +00:00
||linktr.ee/xaiomi.g1fts?fbclid=iwar0m4ptysyv4cf8adot5iwjitcil-ftx_m7anuv8_n1zjq7hg3g5cdqmeqq$all
Filter updated: Thu, 22 Jul 2021 00:01:54 +0000
2021-07-22 00:01:54 +00:00
||linpromerxx1.byethost9.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||lion.main.jp$all
Filter updated: Sat, 12 Jun 2021 00:25:37 UTC
2021-06-12 00:25:37 +00:00
||liongear.com$all
Filter updated: Thu, 05 Aug 2021 00:02:05 +0000
2021-08-05 00:02:05 +00:00
||liusanchuan.github.io$all
Filter updated: Thu, 03 Sep 2020 12:06:37 UTC
2020-09-03 12:06:37 +00:00
||live-site.hopto.me$all
Filter updated: Sat, 29 May 2021 00:06:23 UTC
2021-05-29 00:06:23 +00:00
||live3jertech833.byethost7.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||livebyuh-my.sharepoint.com/personal/bayar5_go_byuh_edu/_layouts/15/wopiframe.aspx?guestaccesstoken=6seywnzti73n2lfa4zk0ou3hquxhvetwh6roozeb7se%3d&docid=1_1d81a4a770f25458a867093dc6a078a83&wdformid=%7b832d7492%2d3c6e%2d4262%2d983f%2d79975cd8325b%7d&action=formsubmit$all
||liveconcorde-my.sharepoint.com/personal/sofia_segura_casbn_concorde_edu/_layouts/15/guestaccess.aspx?guestaccesstoken=cfpri5iyk8vfhjlweteqtjaelz%2bit8e80ogjwtvujlc%3d&docid=1_1f700b55b23874de19595c967b1ee1e75&wdformid=%7b5f9c1dbd%2d28e2%2d479e%2dbe4e%2d4ce54e21fe0d%7d$all
||livenmitac-my.sharepoint.com/personal/czarina-cabalza_live_nmit_ac_nz/_layouts/15/wopiframe.aspx?guestaccesstoken=bcxwl3a7ttskgw2polh3cucg2dfe77pbj2gkmixkizs%3d&docid=1_1b87bddf46e1144efadb39c587acdadae&wdformid=%7b5b4e96cf%2d1bcd%2d468f%2da845%2d09b4d8027bc2%7d&action=formsubmit$all
||livenmitac-my.sharepoint.com/personal/czarina-cabalza_live_nmit_ac_nz/_layouts/15/wopiframe.aspx?guestaccesstoken=fnyckzjagh3z%2bl1cadcdqxot6rfyhmeonulx7ksc7pq%3d&docid=1_15129478f60da40db8395b5675832ef56&wdformid=%7b000c8ab1%2dcbc8%2d44e3%2dac19%2d0015f01b771e%7d&action=formsubmit$all
||livenmitac-my.sharepoint.com/personal/hannah-daly_live_nmit_ac_nz/_layouts/15/wopiframe.aspx?guestaccesstoken=ia5uzzon3iviku4f3pxemyhhabfwkpdjirpftfear%2fk%3d&docid=1_169208e425ed84fea9fd294a6886d67e9&wdformid=%7b06255f86%2d4bf9%2d4ee8%2dbd7e%2dfef81913a79b%7d&action=formsubmit$all
||livenmitac-my.sharepoint.com/personal/hannah-daly_live_nmit_ac_nz/_layouts/15/wopiframe.aspx?guestaccesstoken=ia5uzzon3iviku4f3pxemyhhabfwkpdjirpftfear/k=&docid=1_169208e425ed84fea9fd294a6886d67e9&wdformid={06255f86-4bf9-4ee8-bd7e-fef81913a79b}&action=formsubmit$all
||livenmitac-my.sharepoint.com/personal/hannah-daly_live_nmit_ac_nz/_layouts/15/wopiframe.aspx?guestaccesstoken=za7yvssjtzxen%2fcnb0hswkqniem%2fcumgrmfvnt4f8cy%3d&docid=1_128a2a62563b647c9b1b6806600fd8a09&wdformid=%7b20510126%2dfb1d%2d4e63%2d9e6a%2df86488e1d5c6%7d&action=formsubmit$all
Filter updated: Tue, 21 Sep 2021 12:02:11 +0000
2021-09-21 12:02:11 +00:00
||livinglawsociety.org$all
Filter updated: Sat, 03 Apr 2021 12:06:22 UTC
2021-04-03 12:06:22 +00:00
||ljbarton-my.sharepoint.com/:b:/p/jay_gilmour/exhqlax-ttzblxuozhpnm8ibzjzs2np0tpsknw-4kbeb5a?e=ewkjcb$all
Filter updated: Tue, 13 Jul 2021 00:02:30 +0000
2021-07-13 00:02:30 +00:00
||lkt.bio$all
Filter updated: Wed, 04 Aug 2021 00:02:10 +0000
2021-08-04 00:02:10 +00:00
||llantasmex.com$all
Filter updated: Tue, 26 Jan 2021 12:06:26 UTC
2021-01-26 12:06:26 +00:00
||lloyd-reviewdata.com$all
Filter updated: Fri, 05 Mar 2021 00:09:33 UTC
2021-03-05 00:09:33 +00:00
||lloydbank-accountbreach.com$all
||lloydbank-connect-payee.com$all
Filter updated: Tue, 09 Mar 2021 12:08:37 UTC
2021-03-09 12:08:37 +00:00
||lloydbank-devicehelp.com$all
Filter updated: Sat, 27 Feb 2021 00:09:37 UTC
2021-02-27 00:09:37 +00:00
||lloydbank-online-secures.com$all
Filter updated: Thu, 04 Mar 2021 00:06:31 UTC
2021-03-04 00:06:31 +00:00
||lloydbank-secure-customers.com$all
Filter updated: Thu, 25 Feb 2021 00:06:20 UTC
2021-02-25 00:06:20 +00:00
||lloydbank-support-team.com$all
Filter updated: Sun, 17 Jan 2021 00:06:45 UTC
2021-01-17 00:06:45 +00:00
||lloydbanking-securelogin.com$all
Filter updated: Sun, 11 Jul 2021 00:02:18 +0000
2021-07-11 00:02:18 +00:00
||lloyds-bank-help-page.com$all
Filter updated: Fri, 15 Jan 2021 00:06:14 UTC
2021-01-15 00:06:14 +00:00
||lloyds-payeecancellations.com$all
Filter updated: Sun, 10 Jan 2021 12:06:39 UTC
2021-01-10 12:06:39 +00:00
||lloyds-uk-bank.com$all
Filter updated: Thu, 16 Sep 2021 00:01:52 +0000
2021-09-16 00:01:52 +00:00
||lloyds.web-recipient.com/show.php$all
Filter updated: Fri, 05 Mar 2021 00:09:33 UTC
2021-03-05 00:09:33 +00:00
||lloydsbank.deregister-payee-secure-auth.com$all
Filter updated: Thu, 04 Mar 2021 00:06:31 UTC
2021-03-04 00:06:31 +00:00
||lloydsbank.deregister-payee-security-auth.com$all
Filter updated: Sat, 09 Jan 2021 12:06:41 UTC
2021-01-09 12:06:41 +00:00
||lloydsbank.login-personal-devices.com$all
Filter updated: Mon, 11 Jan 2021 00:06:06 UTC
2021-01-11 00:06:06 +00:00
||lloydsbank.online-auth-verify-secure.com$all
Filter updated: Sat, 16 Jan 2021 00:06:58 UTC
2021-01-16 00:06:58 +00:00
||lloydsbank.online-security-auth-verify.com$all
Filter updated: Thu, 14 Jan 2021 00:06:20 UTC
2021-01-14 00:06:20 +00:00
||lloydsbank.online-visit-secure-auth.com$all
Filter updated: Wed, 06 Jan 2021 00:06:10 UTC
2021-01-06 00:06:10 +00:00
||lloydsbank.personal-devices-login.com$all
Filter updated: Sat, 16 Jan 2021 00:06:58 UTC
2021-01-16 00:06:58 +00:00
||lloydsbank.personal-login-secure-payee.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||lloydsbank.protect-secure-prevent.com$all
||lloydsbank.protect-secure-prevent.com/login.php$all
Filter updated: Wed, 06 Jan 2021 00:06:10 UTC
2021-01-06 00:06:10 +00:00
||lloydsbank.secure-device-protect.net$all
Filter updated: Fri, 05 Mar 2021 00:09:33 UTC
2021-03-05 00:09:33 +00:00
||lloydsbank.secure-online-deregister.com$all
Filter updated: Wed, 06 Jan 2021 00:06:10 UTC
2021-01-06 00:06:10 +00:00
||lloydsbank.secure-personal-device-login.com$all
Filter updated: Tue, 23 Mar 2021 00:10:01 UTC
2021-03-23 00:10:01 +00:00
||lloyduk-newdevice-registered-online.com$all
Filter updated: Wed, 30 Dec 2020 12:06:13 UTC
2020-12-30 12:06:13 +00:00
||lloyduk-online.com$all
Filter updated: Mon, 06 Sep 2021 12:01:50 +0000
2021-09-06 12:01:50 +00:00
||lmaox.com$all
Filter updated: Sun, 12 Sep 2021 00:02:13 +0000
2021-09-12 00:02:13 +00:00
||lmax509788.com$all
Filter updated: Sun, 12 Sep 2021 12:01:35 +0000
2021-09-12 12:01:35 +00:00
||lmax89898.com$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||lmax9788.net$all
Filter updated: Mon, 01 Mar 2021 12:08:04 UTC
2021-03-01 12:08:04 +00:00
||lmlenzitrasporti.com$all
Filter updated: Thu, 03 Sep 2020 12:06:37 UTC
2020-09-03 12:06:37 +00:00
||lms.ozyegin.edu.tr$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||lnk.pmlti-etai-2.ovh$all
Filter updated: Thu, 09 Sep 2021 00:01:56 +0000
2021-09-09 00:01:56 +00:00
||lnkd.in/d7ayxcgd$all
Filter updated: Fri, 17 Sep 2021 12:01:51 +0000
2021-09-17 12:01:52 +00:00
||lnkd.in/d8qsmyxr$all
Filter updated: Sat, 18 Sep 2021 00:14:48 +0000
2021-09-18 00:14:48 +00:00
||lnkd.in/d_kutuer$all
Filter updated: Tue, 14 Sep 2021 00:01:48 +0000
2021-09-14 00:01:48 +00:00
||lnkd.in/dc_qgjgt$all
Filter updated: Mon, 24 May 2021 00:06:37 UTC
2021-05-24 00:06:37 +00:00
||lnkd.in/dd-pkti$all
Filter updated: Fri, 25 Jun 2021 00:06:14 +0000
2021-06-25 00:06:14 +00:00
||lnkd.in/ddivaqp$all
Filter updated: Thu, 03 Jun 2021 12:06:59 UTC
2021-06-03 12:07:00 +00:00
||lnkd.in/ddivaqp?userid=4pz15vnm$all
Filter updated: Wed, 18 Aug 2021 00:01:50 +0000
2021-08-18 00:01:50 +00:00
||lnkd.in/dnqy4qrw$all
Filter updated: Tue, 17 Aug 2021 00:02:45 +0000
2021-08-17 00:02:45 +00:00
||lnkd.in/dnqy4qrw?userid=9cknk2yb$all
Filter updated: Fri, 06 Aug 2021 00:01:52 +0000
2021-08-06 00:01:52 +00:00
||lnkd.in/dpneeiw$all
Filter updated: Wed, 04 Aug 2021 00:02:10 +0000
2021-08-04 00:02:10 +00:00
||lnkd.in/dpneeiw?trackingid=eo9hvc8w&signature=newsletter$all
Filter updated: Sat, 10 Jul 2021 00:01:42 +0000
2021-07-10 00:01:42 +00:00
||lnkd.in/dtu6uhs$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||lnkd.in/dvewnpt$all
Filter updated: Sat, 15 May 2021 12:06:44 UTC
2021-05-15 12:06:44 +00:00
||lnkd.in/dycnfuz$all
Filter updated: Thu, 23 Sep 2021 00:02:18 +0000
2021-09-23 00:02:18 +00:00
||lnkd.in/e4thv3et$all
Filter updated: Wed, 04 Aug 2021 00:02:10 +0000
2021-08-04 00:02:10 +00:00
||lnkd.in/e53aerx$all
Filter updated: Sat, 07 Aug 2021 00:20:48 +0000
2021-08-07 00:20:48 +00:00
||lnkd.in/e_nfvj4n$all
||lnkd.in/ehtyhpiq$all
Filter updated: Wed, 22 Sep 2021 12:01:56 +0000
2021-09-22 12:01:56 +00:00
||lnkd.in/ej-ngqjk$all
Filter updated: Fri, 13 Aug 2021 00:01:48 +0000
2021-08-13 00:01:48 +00:00
||lnkd.in/emcgvfmg$all
Filter updated: Tue, 24 Aug 2021 12:02:00 +0000
2021-08-24 12:02:00 +00:00
||lnkd.in/erzsyig$all
Filter updated: Fri, 17 Sep 2021 12:01:51 +0000
2021-09-17 12:01:52 +00:00
||lnkd.in/espwchqf$all
Filter updated: Thu, 09 Sep 2021 12:02:27 +0000
2021-09-09 12:02:27 +00:00
||lnkd.in/g6fyfzwm$all
Filter updated: Mon, 13 Sep 2021 12:01:52 +0000
2021-09-13 12:01:52 +00:00
||lnkd.in/gc9jh9cu$all
Filter updated: Thu, 23 Sep 2021 00:02:18 +0000
2021-09-23 00:02:18 +00:00
||lnkd.in/gfiextht$all
Filter updated: Wed, 25 Aug 2021 00:01:57 +0000
2021-08-25 00:01:57 +00:00
||lnkd.in/gvnpdt-w$all
Filter updated: Thu, 09 Sep 2021 00:01:56 +0000
2021-09-09 00:01:56 +00:00
||lnkd.in/gwaajkqi$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||lnkmeup.com/6z7w$all
Filter updated: Wed, 25 Nov 2020 00:06:21 UTC
2020-11-25 00:06:21 +00:00
||lnkmeup.com/78q2$all
Filter updated: Wed, 22 Sep 2021 12:01:56 +0000
2021-09-22 12:01:56 +00:00
||lnpost-0rder.pl-id08842906.xyz$all
Filter updated: Thu, 20 May 2021 00:06:43 UTC
2021-05-20 00:06:44 +00:00
||lnstalam.eu$all
Filter updated: Thu, 10 Jun 2021 12:06:40 UTC
2021-06-10 12:06:40 +00:00
||lntebaxk.com$all
Filter updated: Wed, 22 Sep 2021 00:02:26 +0000
2021-09-22 00:02:26 +00:00
||lnterbanlkhome.weworldnews.com$all
Filter updated: Fri, 24 Sep 2021 00:01:50 +0000
2021-09-24 00:01:51 +00:00
||lnterbanlkpewelb.castlechemicals.sv2.cheshire-online.com$all
Filter updated: Fri, 17 Sep 2021 00:01:45 +0000
2021-09-17 00:01:46 +00:00
||lnterbanlkweb.entrepreneurialsuccessprogram.com$all
Filter updated: Wed, 22 Sep 2021 00:02:26 +0000
2021-09-22 00:02:26 +00:00
||lnterbanlkwelb.lodicomputer.com$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||lnterbkapp.xyz$all
||lnterlbkalertas.xyz$all
Filter updated: Tue, 10 Aug 2021 00:01:49 +0000
2021-08-10 00:01:49 +00:00
||loaqyafckiduqgxidlhebxkvlu-dot-goff039302032323.rj.r.appspot.com$all
Filter updated: Sun, 11 Jul 2021 00:02:18 +0000
2021-07-11 00:02:18 +00:00
||lobbygolf.org$all
Filter updated: Fri, 23 Jul 2021 00:03:07 +0000
2021-07-23 00:03:07 +00:00
||local.bitz.co.za$all
Filter updated: Sun, 28 Mar 2021 12:06:32 UTC
2021-03-28 12:06:32 +00:00
||localbusinesscitationbuilding.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||lofon-add.firebaseapp.com$all
||logex.com.tr$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||logformrestolationonline.com$all
Filter updated: Tue, 03 Aug 2021 00:01:58 +0000
2021-08-03 00:01:58 +00:00
||loghhtmls.byethost24.com$all
Filter updated: Tue, 31 Aug 2021 12:01:54 +0000
2021-08-31 12:01:54 +00:00
||logienhalp2.tk$all
||logienhalp3.tk$all
||logienhalp5.tk$all
Filter updated: Tue, 30 Mar 2021 00:06:27 UTC
2021-03-30 00:06:27 +00:00
||login-bank.org$all
Filter updated: Sun, 11 Jul 2021 00:02:18 +0000
2021-07-11 00:02:18 +00:00
||login-live.com-s02.net$all
Filter updated: Sat, 05 Jun 2021 00:27:49 UTC
2021-06-05 00:27:49 +00:00
||login-onlinebanking-suntrust-olb.net$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||login.microsoftonline.us/rtxusers.onmicrosoft.us/oauth2/authorize?client_id=5c8081f1-46af-4077-a0e2-b12ad052a0cb&resource=5c8081f1-46af-4077-a0e2-b12ad052a0cb&response_mode=form_post&response_type=code%20id_token&scope=openid%20profile&state=openidconnect.authenticationproperties=av8xafvlbjl8lveyf112dlrykz1za2fd6roj7a4wst794dn-f5sqocbr8ywev5f9zf62koqwtmgls1ki6kk2gufthuiwhh8dktfndjhnflk-phai2ham7lsuxwzw_betpc3owljmnp57neynhsvjqmifs4qzk-5-1psc4i5afw_ereflxuibhuxktqjkvv2n6u9chaak_no55v_iwarchknnphrsskxl9bdnv8_zdus7&nonce=637486060621877491.otrmm2m2owmtytnjny00ngvmlwixntctmmzinjzlnzq5ntllmzlkndk2zdktmjjmmy00yjg5lwjkodqtmtc2zdrjndfkytrk&redirect_uri=https://tasks.office365.us/landing&ui_locales=en-us&mkt=en-us&x-client-sku=id_net461&x-client-ver=6.5.0.0$all
Filter updated: Sat, 03 Jul 2021 12:01:36 +0000
2021-07-03 12:01:37 +00:00
||login.privategold.uytrtyuhij987.gowithapex.com$all
Filter updated: Sun, 04 Apr 2021 00:06:31 UTC
2021-04-04 00:06:31 +00:00
||login.vdohnovenie.org.ua$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||login3.top$all
Filter updated: Wed, 22 Sep 2021 00:02:26 +0000
2021-09-22 00:02:26 +00:00
||loginrun.info$all
Filter updated: Mon, 16 Aug 2021 12:01:42 +0000
2021-08-16 12:01:42 +00:00
||logitel.com.au$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||logowanie-bezpieczna-online.com$all
Filter updated: Thu, 29 Jul 2021 00:01:57 +0000
2021-07-29 00:01:57 +00:00
||logowanie24securebos.com$all
Filter updated: Thu, 27 May 2021 00:06:23 UTC
2021-05-27 00:06:23 +00:00
||lokerpatscity.byethost33.com$all
Filter updated: Fri, 24 Sep 2021 00:01:50 +0000
2021-09-24 00:01:51 +00:00
||lolostes.my.id$all
Filter updated: Tue, 26 Jan 2021 12:06:26 UTC
2021-01-26 12:06:26 +00:00
||lombard11.eu$all
Filter updated: Thu, 09 Sep 2021 00:01:56 +0000
2021-09-09 00:01:56 +00:00
||londonfiestant.com/espoi/loglns$all
Filter updated: Wed, 08 Sep 2021 12:01:51 +0000
2021-09-08 12:01:51 +00:00
||londonfiestant.com/espoi/loglns/$all
||londonfiestant.com/espoi/loglns/billing.php$all
Filter updated: Wed, 08 Sep 2021 00:02:08 +0000
2021-09-08 00:02:08 +00:00
||londonfiestant.com/espoi/loglns/payment.php$all
||londonfiestant.com/espoi/loglns/secure/cc.php$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||londonmakt.com$all
Filter updated: Wed, 18 Nov 2020 00:06:15 UTC
2020-11-18 00:06:16 +00:00
||lookdigital.co$all
Filter updated: Sat, 05 Jun 2021 12:06:16 UTC
2021-06-05 12:06:17 +00:00
||lopn.planetwaves.am$all
Filter updated: Mon, 20 Sep 2021 12:02:05 +0000
2021-09-20 12:02:05 +00:00
||lordgordon.it$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||loto041219.blogspot.com$all
Filter updated: Sat, 22 May 2021 00:06:19 UTC
2021-05-22 00:06:19 +00:00
||loverlampos.vzpla.net$all
Filter updated: Sat, 21 Aug 2021 00:01:53 +0000
2021-08-21 00:01:54 +00:00
||lovesouls.ru$all
Filter updated: Tue, 21 Sep 2021 12:02:11 +0000
2021-09-21 12:02:11 +00:00
||lp.vp4.me$all
Filter updated: Fri, 18 Sep 2020 00:06:21 UTC
2020-09-18 00:06:21 +00:00
||lqg8u8.webwave.dev$all
Filter updated: Fri, 24 Sep 2021 12:02:36 +0000
2021-09-24 12:02:36 +00:00
||lrlscpxminlelvvdoxsralshoilhuzoyaflympjb.xmonk.cn$all
Filter updated: Fri, 10 Sep 2021 12:02:02 +0000
2021-09-10 12:02:02 +00:00
||lsquaredwebdesigns.com$all
Filter updated: Sat, 26 Jun 2021 00:06:14 +0000
2021-06-26 00:06:14 +00:00
||ltau.ativesms.com$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||ltitrk.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||lu9-my.sharepoint.com/personal/anne46523_5tb_in/_layouts/15/acceptinvite.aspx?invitation=%7b9614113b%2dbe07%2d438b%2d963d%2d659c8690fbd2%7d$all
||lu9-my.sharepoint.com/personal/margaret43636_5tb_in/_layouts/15/acceptinvite.aspx?invitation=%7b94ca64e1%2db293%2d4622%2d9504%2d695384f21579%7d$all
Filter updated: Wed, 01 Sep 2021 00:02:20 +0000
2021-09-01 00:02:20 +00:00
||lucie-inter.myshopwired.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||luckylkhraylbwal.blogspot.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||lucy-walker.com$all
Filter updated: Mon, 31 May 2021 00:06:34 UTC
2021-05-31 00:06:34 +00:00
||lucywestpdaarubcorubber.org$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||ludiequip.es$all
Filter updated: Thu, 05 Aug 2021 00:02:05 +0000
2021-08-05 00:02:05 +00:00
||lumail61.wixsite.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||lunaclothing-my.sharepoint.com/personal/info_lunaclothing_nl/_layouts/15/wopiframe.aspx?sourcedoc={aace4e9a-412a-4eb0-b7b6-23c76317f081}&action=default&originalpath=ahr0chm6ly9sdw5hy2xvdghpbmctbxkuc2hhcmvwb2ludc5jb20vom86l2cvcgvyc29uywwvaw5mb19sdw5hy2xvdghpbmdfbmwvrxbwt3pxb3frykjpdddzangytvg4suvcvtyznhnmlxnwr3bvytryuzdbaxzfdz9ydgltzt05uzqwnmvssjewzw$all
||lunaclothing-my.sharepoint.com/personal/info_lunaclothing_nl/_layouts/15/wopiframe2.aspx?sourcedoc={aace4e9a-412a-4eb0-b7b6-23c76317f081}&action=default&originalpath=ahr0chm6ly9sdw5hy2xvdghpbmctbxkuc2hhcmvwb2ludc5jb20vom86l2cvcgvyc29uywwvaw5mb19sdw5hy2xvdghpbmdfbmwvrxbwt3pxb3frykjpdddzangytvg4suvcvtyznhnmlxnwr3bvytryuzdbaxzfdz9ydgltzt05uzqwnmvssjewzw$all
||lunaclothing-my.sharepoint.com/personal/info_lunaclothing_nl/_layouts/15/wopiframe2.aspx?sourcedoc={aace4e9a-412a-4eb0-b7b6-23c76317f081}&action=default&originalpath=ahr0chm6ly9sdw5hy2xvdghpbmctbxkuc2hhcmvwb2ludc5jb20vom86l2cvcgvyc29uywwvaw5mb19sdw5hy2xvdghpbmdfbmwvrxbwt3pxb3frykjpdddzangytvg4suvcvtyznhnmlxnwr3bvytryuzdbaxzfdz9ydgltzt1vvm5wuy1ssjewzw$all
Filter updated: Mon, 02 Aug 2021 12:01:44 +0000
2021-08-02 12:01:44 +00:00
||luxuriousmagazineasia.com$all
Filter updated: Wed, 30 Jun 2021 12:01:58 +0000
2021-06-30 12:01:58 +00:00
||luxuryautomobile.me$all
Filter updated: Sun, 01 Aug 2021 00:01:58 +0000
2021-08-01 00:01:59 +00:00
||luxustelekatermeszetben.hu$all
Filter updated: Thu, 03 Jun 2021 00:06:28 UTC
2021-06-03 00:06:28 +00:00
||lvnews.org.ua/frontend/pagina/imagenes/comun2008/banca-en-linea-personas.html$all
Filter updated: Thu, 09 Sep 2021 00:01:56 +0000
2021-09-09 00:01:56 +00:00
||ly12-52.dazog.ge$all
Filter updated: Thu, 27 May 2021 00:06:23 UTC
2021-05-27 00:06:23 +00:00
||lycee-ozanam35.fr$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||lygzxi.top$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||lynkos.com.br$all
Filter updated: Thu, 02 Sep 2021 12:02:02 +0000
2021-09-02 12:02:02 +00:00
||m-1q45axh0.streamsteam.ca$all
Filter updated: Thu, 08 Jul 2021 12:02:13 +0000
2021-07-08 12:02:14 +00:00
||m.07runescape.com.au$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||m.bkn2355.com$all
Filter updated: Sun, 05 Sep 2021 12:01:36 +0000
2021-09-05 12:01:37 +00:00
||m.es.runescape.com-ov.ru$all
Filter updated: Wed, 28 Apr 2021 12:07:34 UTC
2021-04-28 12:07:34 +00:00
||m.httpservlces.runescape.com-ov.ru$all
Filter updated: Sat, 29 May 2021 12:06:18 UTC
2021-05-29 12:06:19 +00:00
||m.httpsservlces.runescape.com-m.ru$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||m.lkh8363.com$all
Filter updated: Mon, 31 May 2021 12:06:30 UTC
2021-05-31 12:06:30 +00:00
||m.me/bobfrank2070$all
Filter updated: Tue, 20 Jul 2021 12:01:48 +0000
2021-07-20 12:01:48 +00:00
||m.me/govt.official.compensate.help.grant$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||m.myb9637.com$all
Filter updated: Sun, 16 May 2021 00:06:38 UTC
2021-05-16 00:06:38 +00:00
||m.tpservlices.runescape.com-nu.ru$all
Filter updated: Thu, 05 Aug 2021 12:01:57 +0000
2021-08-05 12:01:57 +00:00
||m.www.pma.runescape.com-gb.ru$all
Filter updated: Wed, 18 Aug 2021 00:01:50 +0000
2021-08-18 00:01:50 +00:00
||m25g.22web.org$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||m42club.com$all
||m54af8.webwave.dev$all
Filter updated: Sat, 17 Apr 2021 00:06:31 UTC
2021-04-17 00:06:31 +00:00
||mabp.s-fr.net$all
Filter updated: Wed, 15 Sep 2021 00:01:54 +0000
2021-09-15 00:01:55 +00:00
||macro-sistemas.com$all
Filter updated: Wed, 30 Jun 2021 00:01:58 +0000
2021-06-30 00:01:58 +00:00
||maddho435st.gb.net$all
Filter updated: Mon, 12 Jul 2021 00:01:55 +0000
2021-07-12 00:01:55 +00:00
||madeinluis067.byethost33.com$all
Filter updated: Mon, 26 Apr 2021 00:08:39 UTC
2021-04-26 00:08:39 +00:00
||madens.com.pl$all
Filter updated: Fri, 24 Sep 2021 12:02:36 +0000
2021-09-24 12:02:36 +00:00
||madras.com.br/mbl/$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||madrugadaolanches.com.br$all
Filter updated: Thu, 09 Sep 2021 12:02:27 +0000
2021-09-09 12:02:27 +00:00
||maestro.my.prod.dfg152.ru$all
Filter updated: Tue, 03 Aug 2021 12:01:54 +0000
2021-08-03 12:01:54 +00:00
||magicteachescoresubjects.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||magistrol.az$all
Filter updated: Wed, 10 Feb 2021 12:07:16 UTC
2021-02-10 12:07:16 +00:00
||magyarpoosta.blogspot.com/2021/02/blog-post.html$all
Filter updated: Wed, 04 Aug 2021 00:02:10 +0000
2021-08-04 00:02:10 +00:00
||maikhl0.ultimatefreehost.in$all
Filter updated: Thu, 16 Sep 2021 00:01:52 +0000
2021-09-16 00:01:52 +00:00
||mail-account-verify-f4723.web.app$all
Filter updated: Tue, 21 Sep 2021 00:01:40 +0000
2021-09-21 00:01:40 +00:00
||mail-ovhcloud.web.app$all
Filter updated: Thu, 19 Aug 2021 00:01:47 +0000
2021-08-19 00:01:47 +00:00
||mail-reschedules.com$all
Filter updated: Fri, 17 Sep 2021 12:01:51 +0000
2021-09-17 12:01:52 +00:00
||mail-security-server.000webhostapp.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||mail.1repair.co.uk$all
Filter updated: Wed, 18 Aug 2021 00:01:50 +0000
2021-08-18 00:01:50 +00:00
||mail.bay81.com$all
Filter updated: Tue, 24 Aug 2021 12:02:00 +0000
2021-08-24 12:02:00 +00:00
||mail.bay81studios.com$all
Filter updated: Mon, 03 May 2021 12:06:30 UTC
2021-05-03 12:06:31 +00:00
||mail.blogdoaltivo.com.br$all
Filter updated: Sat, 10 Jul 2021 00:01:42 +0000
2021-07-10 00:01:42 +00:00
||mail.cabconnect.com.au/images/wet/2020dhl_topscript/dhl_topscript/cmd-login=cd01efe09a3c34091edcbd69433f3bbc$all
Filter updated: Fri, 09 Jul 2021 00:01:59 +0000
2021-07-09 00:01:59 +00:00
||mail.cabconnect.com.au/images/wet/2020dhl_topscript/dhl_topscript/cmd-login=cd01efe09a3c34091edcbd69433f3bbc/$all
Filter updated: Tue, 06 Jul 2021 12:02:08 +0000
2021-07-06 12:02:09 +00:00
||mail.cabconnect.com.au/images/wet/2020dhl_topscript/dhl_topscript/cmd-login=cd01efe09a3c34091edcbd69433f3bbc/?reff=mdg1odi4mgi1nta4zwuxmdk1oge3nwvkntexoge3nzg=$all
Filter updated: Tue, 23 Feb 2021 12:07:09 UTC
2021-02-23 12:07:09 +00:00
||mail.charperimagedesign.com$all
Filter updated: Mon, 09 Aug 2021 12:01:58 +0000
2021-08-09 12:01:58 +00:00
||mail.connexion-service.com$all
Filter updated: Tue, 08 Jun 2021 12:06:44 UTC
2021-06-08 12:06:44 +00:00
||mail.conway.sa$all
Filter updated: Sat, 14 Aug 2021 12:02:02 +0000
2021-08-14 12:02:02 +00:00
||mail.czechineseauction.com$all
Filter updated: Sat, 10 Jul 2021 00:01:42 +0000
2021-07-10 00:01:42 +00:00
||mail.designandcraftsmanship.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||mail.dmsireland1.com$all
Filter updated: Thu, 19 Aug 2021 12:02:33 +0000
2021-08-19 12:02:33 +00:00
||mail.easycoachltd.com$all
Filter updated: Thu, 01 Apr 2021 12:06:44 UTC
2021-04-01 12:06:45 +00:00
||mail.enrollmoreclientsbootcamp.com$all
Filter updated: Mon, 21 Jun 2021 12:06:31 +0000
2021-06-21 12:06:31 +00:00
||mail.gardenlog.com.br$all
Filter updated: Tue, 08 Jun 2021 00:06:30 UTC
2021-06-08 00:06:30 +00:00
||mail.glui.eu$all
Filter updated: Fri, 20 Nov 2020 00:06:19 UTC
2020-11-20 00:06:19 +00:00
||mail.harmonmedical.net$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||mail.hfcfit.com/forms/forms/form1.html$all
Filter updated: Fri, 02 Jul 2021 12:01:53 +0000
2021-07-02 12:01:53 +00:00
||mail.hhtinvestments.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||mail.houra.xyz/wellsfargo/wellsfargo/login.php?cmd=login_submit&id=8a7066082fb3f1b00c831bb179d803e38a7066082fb3f1b00c831bb179d803e3&session=8a7066082fb3f1b00c831bb179d803e38a7066082fb3f1b00c831bb179d803e3$all
||mail.houra.xyz/wellsfargo/wellsfargo/login.php?cmd=login_submit&id=a9145057b93f033a80445b58f4f6a4e1a9145057b93f033a80445b58f4f6a4e1&session=a9145057b93f033a80445b58f4f6a4e1a9145057b93f033a80445b58f4f6a4e1$all
||mail.houra.xyz/wellsfargo/wellsfargo/next2.php$all
Filter updated: Tue, 11 May 2021 12:06:36 UTC
2021-05-11 12:06:36 +00:00
||mail.ims-fe.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||mail.kotpantolon.gen.tr$all
Filter updated: Mon, 13 Sep 2021 12:01:52 +0000
2021-09-13 12:01:52 +00:00
||mail.kulturkurs.se$all
Filter updated: Sun, 19 Sep 2021 12:01:34 +0000
2021-09-19 12:01:35 +00:00
||mail.macrofashion.com.br$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||mail.mlcexpresstransportes.com.br$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||mail.mopxopeps.vn$all
Filter updated: Sat, 26 Jun 2021 12:06:10 +0000
2021-06-26 12:06:10 +00:00
||mail.musicgiftsgalore.com$all
Filter updated: Thu, 08 Jul 2021 00:02:02 +0000
2021-07-08 00:02:02 +00:00
||mail.navarrotow.com$all
Filter updated: Tue, 12 Jan 2021 12:06:44 UTC
2021-01-12 12:06:44 +00:00
||mail.netflixpartycanada.com$all
Filter updated: Sun, 06 Jun 2021 00:06:22 UTC
2021-06-06 00:06:22 +00:00
||mail.nris.com.au$all
Filter updated: Mon, 21 Jun 2021 00:06:20 +0000
2021-06-21 00:06:20 +00:00
||mail.phongvuexpress.vn$all
Filter updated: Sun, 11 Apr 2021 00:06:52 UTC
2021-04-11 00:06:52 +00:00
||mail.pnatwest.site$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||mail.prosupportteamdhlexp.com$all
||mail.securevpn.co.uk/73c681b4ae100182161964fb5a10205f$all
||mail.securevpn.co.uk/73c681b4ae100182161964fb5a10205f/qes.php?cmd=_account-details&session=2e5d2d5ed7d9e86414c1985ea9a68431&dispatch=616f0741bcacd52654141c7d7e3823d32b67801c$all
||mail.securevpn.co.uk/73c681b4ae100182161964fb5a10205f/security.php?cmd=_account-details&session=537877b92c3c8ebc3fad46c6602dd28e&dispatch=e952dafa62760c7c8ea49ffa5a82650dd7733e29$all
||mail.securevpn.co.uk/9acf462b2e5813af333a2684774a4ce7$all
||mail.securevpn.co.uk/9acf462b2e5813af333a2684774a4ce7/qes.php?cmd=_account-details&session=c13d66df62e6ca4d68d8aedfa1100296&dispatch=7de8a7fe8602c83dc755268e1324dd3acfa3e6be$all
||mail.securevpn.co.uk/9acf462b2e5813af333a2684774a4ce7/security.php?cmd=_account-details&session=3621b4eb75a3e637d08cca60d6355f14&dispatch=48421bd403265b79e20324305fa136d2d855ef4d$all
||mail.securevpn.co.uk/ee55d79f9ea89bcaff49c845bd3a954d/qes.php?cmd=_account-details&session=3529b8ef2b7c9a2169ce7d93a7da9f6e&dispatch=91b7ae3708cb1de2551ff40927ee10495dba650d$all
||mail.securevpn.co.uk/ee55d79f9ea89bcaff49c845bd3a954d/security.php?cmd=_account-details&session=c31b5b23f3a03f5c482344db93f6e452&dispatch=8fa25f3019558028a01f8de46353a2b93d5358d8$all
||mail.sustainabletech.cc$all
||mail.sustech.cc$all
Filter updated: Tue, 20 Apr 2021 12:06:59 UTC
2021-04-20 12:07:00 +00:00
||mail.tariqalaraimi.com$all
Filter updated: Fri, 24 Sep 2021 12:02:36 +0000
2021-09-24 12:02:36 +00:00
||mail.thelovegarden.com.ph$all
Filter updated: Fri, 10 Sep 2021 00:02:17 +0000
2021-09-10 00:02:17 +00:00
||mail.trendset.com.ar.ci3.toservers.com/mua/186.154.25.1064023/sucursalpersonas.transaccionesbancolombia.com/mua$all
||mail.trendset.com.ar.ci3.toservers.com/mua/186.154.25.1064023/sucursalpersonas.transaccionesbancolombia.com/mua/$all
Filter updated: Fri, 24 Sep 2021 12:02:36 +0000
2021-09-24 12:02:36 +00:00
||mail.trendset.com.ar.ci3.toservers.com/mua/190.61.55.2105806/sucursalpersonas.transaccionesbancolombia.com/mua/index.html$all
Filter updated: Fri, 10 Sep 2021 00:02:17 +0000
2021-09-10 00:02:17 +00:00
||mail.trendset.com.ar.ci3.toservers.com/mua/191.110.122.835718/sucursalpersonas.transaccionesbancolombia.com/mua$all
||mail.trendset.com.ar.ci3.toservers.com/mua/191.110.122.835718/sucursalpersonas.transaccionesbancolombia.com/mua/$all
||mail.trendset.com.ar.ci3.toservers.com/mua/201.233.42.1501206/sucursalpersonas.transaccionesbancolombia.com/mua/index.html$all
Filter updated: Mon, 12 Jul 2021 12:02:03 +0000
2021-07-12 12:02:03 +00:00
||mail.weddingstaffcompanies.com$all
Filter updated: Thu, 01 Apr 2021 12:06:44 UTC
2021-04-01 12:06:45 +00:00
||mail.wheel1factory.net$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||mail.yehcommerce.com.br$all
Filter updated: Tue, 14 Sep 2021 12:01:44 +0000
2021-09-14 12:01:44 +00:00
||mail01.tinyletterapp.com/support--1/friends-romans-countrymen-lend-me-your-ears-2/13668329-service-account-3.000webhostapp.com/mafiiiiiiia/mafiiiiiiia/gs_gen/gs9bb68a92d020f84a0d8f34df0f4e035e/?redacted$all
||mail01.tinyletterapp.com/support--1/important-confirm-your-account-1/13669205-service-account-5.000webhostapp.com/account/account/gs_gen/gs321c3043f9edf99647ed762add65f6dc/?redacted$all
||mail01.tinyletterapp.com/support--2/important-confirm-your-account-2/13672637-service-account-4.000webhostapp.com/account/account/gs_gen/gs8987183b45b1fe5ea8e32131b9fb5718/?redacted$all
Filter updated: Tue, 09 Feb 2021 12:06:34 UTC
2021-02-09 12:06:34 +00:00
||mail2.mclink.it$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||mailer.cl.tripod.com$all
Filter updated: Sat, 26 Jun 2021 12:06:10 +0000
2021-06-26 12:06:10 +00:00
||mailer2.zohoinsights-crm.com$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||mailerserver65mailerserver65mailerserver65mailerserver65mail.s3.eu-de.cloud-object-storage.appdomain.cloud$all
Filter updated: Fri, 10 Sep 2021 12:02:02 +0000
2021-09-10 12:02:02 +00:00
||mailing.languedoc-roussillon.cci.fr$all
Filter updated: Sun, 02 May 2021 00:06:30 UTC
2021-05-02 00:06:30 +00:00
||mailmanager.engineread.gq$all
Filter updated: Wed, 26 May 2021 12:06:39 UTC
2021-05-26 12:06:39 +00:00
||mailserver7656566.blob.core.windows.net$all
Filter updated: Thu, 03 Sep 2020 12:06:37 UTC
2020-09-03 12:06:37 +00:00
||mailupgrade2info.site44.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||mainehomeconnection.com$all
Filter updated: Wed, 15 Sep 2021 00:01:54 +0000
2021-09-15 00:01:55 +00:00
||majorityclub.top$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||makecustomgifts.com$all
Filter updated: Wed, 22 Sep 2021 00:02:26 +0000
2021-09-22 00:02:26 +00:00
||makingmoneyiscertainlyamusthereindiszones.s3.amazonaws.com/index.html$all
Filter updated: Sat, 04 Sep 2021 00:17:00 +0000
2021-09-04 00:17:00 +00:00
||maklononline.nutrifood.co.id$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||mala-riba.com$all
Filter updated: Wed, 22 Sep 2021 12:01:56 +0000
2021-09-22 12:01:56 +00:00
||maliya-misrata.org$all
Filter updated: Sat, 11 Sep 2021 00:34:15 +0000
2021-09-11 00:34:15 +00:00
||malloryweisstearpedia.com$all
Filter updated: Sun, 15 Aug 2021 00:01:57 +0000
2021-08-15 00:01:57 +00:00
||malukutenggarakab.go.id/covid-19/ebay.de.singonacccountc53335b82cb093170657a560aa633ae793b1b483d10d47e1b06db4e/$all
Filter updated: Sat, 18 Sep 2021 12:01:34 +0000
2021-09-18 12:01:34 +00:00
||malvaudconstruction.fr$all
Filter updated: Thu, 16 Sep 2021 00:01:52 +0000
2021-09-16 00:01:52 +00:00
||mamameloweqweqwe.my-board.org$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||man1bantul.sch.id$all
Filter updated: Sat, 18 Sep 2021 00:14:48 +0000
2021-09-18 00:14:48 +00:00
||manager.ovh.com-bourgoin-depannage.frsd.metalworks.pt$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||manager.ovh.comdelattre-family.fr.scmbuarcos.com$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||manager.ovh.comdsfsifoyaka.comd.show-on.pt$all
Filter updated: Thu, 25 Feb 2021 12:07:26 UTC
2021-02-25 12:07:26 +00:00
||manateetreeservice.com$all
Filter updated: Thu, 09 Sep 2021 00:01:56 +0000
2021-09-09 00:01:56 +00:00
||mancomplain.com$all
||mancomplain.net$all
Filter updated: Mon, 13 Sep 2021 12:01:52 +0000
2021-09-13 12:01:52 +00:00
||mandmtextiles.com$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||manligtharavfall.se$all
Filter updated: Tue, 24 Aug 2021 00:02:23 +0000
2021-08-24 00:02:24 +00:00
||mantemask.com$all
Filter updated: Fri, 27 Aug 2021 00:01:47 +0000
2021-08-27 00:01:47 +00:00
||mantri.in$all
Filter updated: Mon, 30 Aug 2021 12:01:50 +0000
2021-08-30 12:01:51 +00:00
||mapadocrime.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||mapeigroup-my.sharepoint.com/:o:/g/personal/dejackson_mapei_com/eoimj1iifxtkuvej7paluwmb8rmln15hjfe2y09qaqtd6a?e=w9mk$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||mapleaiongroup.co.uk$all
Filter updated: Fri, 02 Jul 2021 12:01:53 +0000
2021-07-02 12:01:53 +00:00
||mapsa.com.pe$all
Filter updated: Sat, 18 Sep 2021 00:14:48 +0000
2021-09-18 00:14:48 +00:00
||mapsoft.ga$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||maquinasdecartaosemaluguel.com.br$all
Filter updated: Mon, 20 Sep 2021 12:02:05 +0000
2021-09-20 12:02:05 +00:00
||mar-developer.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||maratonadoemagrecimento.com$all
Filter updated: Wed, 07 Apr 2021 12:23:11 UTC
2021-04-07 12:23:12 +00:00
||marceluoribeiro.weebly.com$all
Filter updated: Fri, 21 May 2021 12:06:31 UTC
2021-05-21 12:06:31 +00:00
||marckloper.vzpla.net$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||margarita.md$all
Filter updated: Wed, 26 May 2021 00:06:29 UTC
2021-05-26 00:06:29 +00:00
||mariaeugeniafm.vzpla.net$all
Filter updated: Fri, 27 Aug 2021 00:01:47 +0000
2021-08-27 00:01:47 +00:00
||marianellame.com.ar$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||marjaharmon.com$all
Filter updated: Fri, 24 Sep 2021 00:01:50 +0000
2021-09-24 00:01:51 +00:00
||markazgroup.pk$all
Filter updated: Thu, 19 Aug 2021 12:02:33 +0000
2021-08-19 12:02:33 +00:00
||markbids.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||marketinghbt-my.sharepoint.com/personal/helaine_marketinghbt_onmicrosoft_com/_layouts/15/doc.aspx?sourcedoc={399d080d-00f3-498e-ab31-d3871303131e}&action=view&wd=target%28payment.one%7cab348455-fd82-496a-a5fb-d3816a55a264%2frobin%20kallas%20has%20sent%20you%20a%20secure%20document%20%22payment%22%7cedaf5b03-0f86-4664-902e-2e69550aa890%2f%29$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||marketingmindz.com$all
Filter updated: Sat, 31 Oct 2020 00:06:42 UTC
2020-10-31 00:06:42 +00:00
||marketplace-65985214.com$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||marketplace.cryptobay.vip$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||marketplace.facebook.com-67mlpjqszh.isiolo.go.ke$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||marketvit.by$all
Filter updated: Thu, 08 Jul 2021 00:02:02 +0000
2021-07-08 00:02:02 +00:00
||markgoldbach.com$all
Filter updated: Mon, 09 Aug 2021 12:01:58 +0000
2021-08-09 12:01:58 +00:00
||martinsboots.shop$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||martunjukkankehebatanmy.ml$all
Filter updated: Tue, 15 Jun 2021 12:29:08 UTC
2021-06-15 12:29:08 +00:00
||masaeilvo.com$all
Filter updated: Fri, 16 Jul 2021 12:01:57 +0000
2021-07-16 12:01:57 +00:00
||massaget5456hera.gb.net$all
Filter updated: Fri, 28 May 2021 12:06:27 UTC
2021-05-28 12:06:27 +00:00
||massimobacchini.com$all
Filter updated: Thu, 02 Sep 2021 12:02:02 +0000
2021-09-02 12:02:02 +00:00
||masterclass-meeting.com$all
Filter updated: Sat, 07 Nov 2020 12:06:37 UTC
2020-11-07 12:06:37 +00:00
||masterdrive.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||matbetgir1.blogspot.com$all
||matbetgirisimizgir.blogspot.com$all
Filter updated: Sun, 29 Aug 2021 00:01:50 +0000
2021-08-29 00:01:51 +00:00
||match.lookatmynewphotos.com$all
Filter updated: Fri, 29 Jan 2021 00:06:14 UTC
2021-01-29 00:06:14 +00:00
||matematika.fkip.untirta.ac.id$all
Filter updated: Mon, 07 Jun 2021 00:06:20 UTC
2021-06-07 00:06:20 +00:00
||matixlogin.eshost.com.ar$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||mavibetgir5.blogspot.com$all
||mavibets.blogspot.com$all
||mavibett1.blogspot.com$all
||mavibett11.blogspot.com$all
Filter updated: Fri, 25 Jun 2021 00:06:14 +0000
2021-06-25 00:06:14 +00:00
||mavinglobal.net$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||maviswalletupdate.com$all
Filter updated: Tue, 10 Aug 2021 00:01:49 +0000
2021-08-10 00:01:49 +00:00
||maxclinic.ru$all
Filter updated: Wed, 17 Feb 2021 00:06:37 UTC
2021-02-17 00:06:37 +00:00
||maximilianschnauzers.com$all
Filter updated: Sun, 12 Sep 2021 12:01:35 +0000
2021-09-12 12:01:35 +00:00
||maxis-winner-2020.webs.com$all
Filter updated: Mon, 24 May 2021 12:06:37 UTC
2021-05-24 12:06:37 +00:00
||mazinsamona.com$all
Filter updated: Tue, 09 Feb 2021 12:06:34 UTC
2021-02-09 12:06:34 +00:00
||mbex.ru$all
Filter updated: Thu, 14 Jan 2021 12:06:32 UTC
2021-01-14 12:06:32 +00:00
||mccarthyelectrical.com$all
Filter updated: Sun, 15 Aug 2021 12:01:40 +0000
2021-08-15 12:01:40 +00:00
||mckennittfamily.com$all
Filter updated: Thu, 15 Jul 2021 12:01:53 +0000
2021-07-15 12:01:53 +00:00
||mclaren-org.org$all
Filter updated: Sun, 19 Sep 2021 12:01:34 +0000
2021-09-19 12:01:35 +00:00
||mdbil.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||mdrashedulhasan.com$all
Filter updated: Mon, 05 Apr 2021 12:06:40 UTC
2021-04-05 12:06:40 +00:00
||mdurucan.com$all
Filter updated: Sat, 31 Jul 2021 12:01:55 +0000
2021-07-31 12:01:55 +00:00
||mdvpycmtmhzxsvjukwrzzgjnsx-dot-goff039302032323.rj.r.appspot.com$all
Filter updated: Fri, 24 Sep 2021 12:02:36 +0000
2021-09-24 12:02:36 +00:00
||me2.do/xzcnvkju?userid=0pkfbzff$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||medicinalisfarmaceutica.com.br$all
Filter updated: Mon, 30 Aug 2021 12:01:50 +0000
2021-08-30 12:01:51 +00:00
||mediosdigitalescr.com$all
Filter updated: Thu, 10 Jun 2021 12:06:40 UTC
2021-06-10 12:06:40 +00:00
||medscore.azurewebsites.net$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||meet.google.com/linkredirect?authuser=0&dest=https%3a%2f%2flinktr.ee%2fpaypai.serviceid?idtrack=kzsykctt$all
Filter updated: Sat, 17 Jul 2021 00:01:47 +0000
2021-07-17 00:01:47 +00:00
||meet.google.com/linkredirect?dest=http://hunter.capitalfinaleu.com/?ahvudgvyqg1pzs51dg9yb250by5jyq==/username$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||meeting-23900123090123.bitbucket.io$all
||megacredi.com$all
Filter updated: Sun, 04 Apr 2021 00:06:31 UTC
2021-04-04 00:06:31 +00:00
||megasolar.lk$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||mein.bw-bank.de.logos-psicoterapia.com$all
Filter updated: Thu, 18 Feb 2021 12:07:12 UTC
2021-02-18 12:07:12 +00:00
||mein.gebuhrenfrei.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||meinkonto-kontrol24.blogspot.com$all
Filter updated: Sat, 10 Jul 2021 00:01:42 +0000
2021-07-10 00:01:42 +00:00
||mekelanmlock.byethost9.com$all
Filter updated: Mon, 05 Apr 2021 00:06:34 UTC
2021-04-05 00:06:34 +00:00
||member-mailtech-support.com/login/domain.com/office_365_authentication$all
Filter updated: Mon, 05 Apr 2021 12:06:40 UTC
2021-04-05 12:06:40 +00:00
||member-mailtech-support.com/login/domain.com/office_365_authentication/$all
||member-mailtech-support.com/login/domain.com/office_365_authentication/office.php?11kd051617588590ec69beb630c68a267a277590c3f709d1ec69beb630c68a267a277590c3f709d1ec69beb630c68a267a277590c3f709d1ec69beb630c68a267a277590c3f709d1ec69beb630c68a267a277590c3f709d1$all
||member-mailtech-support.com/login/domain.com/office_365_authentication/office.php?bj886b16175953298d2e60f8a73bbd00f696eb436652ba648d2e60f8a73bbd00f696eb436652ba648d2e60f8a73bbd00f696eb436652ba648d2e60f8a73bbd00f696eb436652ba648d2e60f8a73bbd00f696eb436652ba64$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||members.theatrewomen.org$all
Filter updated: Tue, 10 Aug 2021 12:02:08 +0000
2021-08-10 12:02:08 +00:00
||membershipff.vn$all
Filter updated: Fri, 03 Sep 2021 12:01:48 +0000
2021-09-03 12:01:48 +00:00
||memkart.com$all
Filter updated: Thu, 23 Sep 2021 00:02:18 +0000
2021-09-23 00:02:18 +00:00
||menghuanchaoren.xyz$all
Filter updated: Tue, 07 Sep 2021 00:01:46 +0000
2021-09-07 00:01:46 +00:00
||mensajeriaexpressguatemala.com$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||mental-zip-wma-thoroughly.trycloudflare.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||mentioned-relocation-distribute-explained.trycloudflare.com$all
Filter updated: Fri, 30 Jul 2021 00:01:47 +0000
2021-07-30 00:01:47 +00:00
||mepsijikctvssrkyubkzhrzuuq-dot-goff039302032323.rj.r.appspot.com$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||mercari.bderx.com$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||mercari.gherw.com$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||mercari.gqwzx.com$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||mercari.hjredf.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||mercari.meriiy.com$all
||mercari.meriut.com/#/$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||mercari.merse1.com$all
||mercari.merse2.com$all
||mercari.merse3.com$all
||mercari.merse4.com$all
||mercari.merse5.com$all
||mercari.merse6.com$all
||mercari.merse7.com$all
||mercari.merse8.com$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||mercari.merssc.com$all
||mercari.merux3.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||mercari.tdefs.com$all
||mercarib.com$all
Filter updated: Thu, 08 Jul 2021 00:02:02 +0000
2021-07-08 00:02:02 +00:00
||mercatorgloves.com$all
Filter updated: Sat, 11 Sep 2021 12:01:27 +0000
2021-09-11 12:01:27 +00:00
||meremanovegabana.website2.me$all
Filter updated: Sun, 18 Jul 2021 00:02:04 +0000
2021-07-18 00:02:04 +00:00
||mericaproafterdu.byethost6.com$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||meriprocaseinbanfro.42web.io$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||merveyilmazericmimarlik.com$all
Filter updated: Thu, 24 Jun 2021 00:06:35 +0000
2021-06-24 00:06:35 +00:00
||meschinowellness.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||mesquecamping.es$all
Filter updated: Sat, 10 Apr 2021 12:07:15 UTC
2021-04-10 12:07:15 +00:00
||messagerie-orange164.yolasite.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||messagerie-vocale-orange202.yolasite.com$all
Filter updated: Fri, 02 Jul 2021 00:01:50 +0000
2021-07-02 00:01:51 +00:00
||messagerie.groupe-labanquepostale.ml$all
Filter updated: Sat, 10 Jul 2021 00:01:42 +0000
2021-07-10 00:01:42 +00:00
||messagerieseloger.unaux.com$all
Filter updated: Tue, 31 Aug 2021 00:01:55 +0000
2021-08-31 00:01:55 +00:00
||messagerievocale.ctcin.bio$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||messelive.tv$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||messmericse.gq$all
Filter updated: Fri, 15 Jan 2021 00:06:14 UTC
2021-01-15 00:06:14 +00:00
||mester.info.hu$all
Filter updated: Tue, 27 Jul 2021 00:02:10 +0000
2021-07-27 00:02:10 +00:00
||mestersuperwingskb1a.blogspot.com$all
Filter updated: Thu, 29 Jul 2021 00:01:57 +0000
2021-07-29 00:01:57 +00:00
||mestersuperwingskb3c.blogspot.com$all
Filter updated: Wed, 25 Aug 2021 12:02:06 +0000
2021-08-25 12:02:07 +00:00
||mestertignseekjet1.blogspot.com$all
||mestertignseekjet2.blogspot.com$all
||mestertignseekjet3.blogspot.com$all
||mestertignseekjet4.blogspot.com$all
||mestertignseekjet5.blogspot.com$all
||mestertignseekjet6.blogspot.com$all
Filter updated: Sat, 04 Sep 2021 00:17:00 +0000
2021-09-04 00:17:00 +00:00
||metallkom-spb.ru$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||metaltube.co.in$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||metaltubos.com.br$all
Filter updated: Mon, 26 Jul 2021 12:02:00 +0000
2021-07-26 12:02:00 +00:00
||metamask-extension.com.hsurge.com$all
Filter updated: Thu, 22 Apr 2021 00:06:42 UTC
2021-04-22 00:06:42 +00:00
||metamask.cam$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||metamask.gg$all
Filter updated: Wed, 22 Sep 2021 00:02:26 +0000
2021-09-22 00:02:26 +00:00
||metamask.secure-connection.org$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||metamaska.pro$all
Filter updated: Tue, 20 Jul 2021 12:01:48 +0000
2021-07-20 12:01:48 +00:00
||metamaskservicesweb.com$all
Filter updated: Fri, 18 Jun 2021 12:06:25 +0000
2021-06-18 12:06:25 +00:00
||metavideos.com$all
Filter updated: Mon, 20 Sep 2021 12:02:05 +0000
2021-09-20 12:02:05 +00:00
||metroluxflowers.com$all
Filter updated: Fri, 03 Sep 2021 12:01:48 +0000
2021-09-03 12:01:48 +00:00
||meuacessegurccxaaiixxaa.com$all
Filter updated: Thu, 22 Apr 2021 00:06:42 UTC
2021-04-22 00:06:42 +00:00
||meusabor.com.br$all
Filter updated: Sat, 11 Sep 2021 12:01:27 +0000
2021-09-11 12:01:27 +00:00
||meusacessocaixas.com$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||meysamweb.ir$all
Filter updated: Sat, 07 Aug 2021 00:20:48 +0000
2021-08-07 00:20:48 +00:00
||mf.rks-gov.net$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||mfacebook.blogspot.rs$all
||mfacebook.blogspot.ru$all
Filter updated: Tue, 10 Aug 2021 12:02:08 +0000
2021-08-10 12:02:08 +00:00
||mhacrix.freecluster.eu$all
Filter updated: Sun, 19 Sep 2021 00:02:16 +0000
2021-09-19 00:02:17 +00:00
||mhlvv.xyz$all
Filter updated: Wed, 22 Sep 2021 00:02:26 +0000
2021-09-22 00:02:26 +00:00
||mhughujij-sedfgyhujni-tfghujji.s3.amazonaws.com/index.html$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||mi.homedepot.com/p/cp/46595ecebf250010/c?mi_u=54632464&url=https%3a%2f%2fwww.google.com%2furl%3fsa%3dt%26rct%3dj%26q%3d%26esrc%3ds%26source%3dweb%26cd%3d%26cad%3drja%26uact%3d8%26ved%3d2ahukewiq5z7q2ehsahvt5uakhem0c-cqfjaaegqibrac%26url%3dhttp%253a%252f%252fwww.agtroma.it%252fesperienze.htm%26usg%3daovvaw0qjsiebpcbznvj3y5d6wvu$all
Filter updated: Mon, 20 Sep 2021 12:02:05 +0000
2021-09-20 12:02:05 +00:00
||mi.jetblue.com/p/cp/0ccc3066dc2bcd17/c?mi_u=87923176&mi_origin=&url=http://email.stickercanada.com/t?entity_type=2&entity_id=32534&email_pref_id=34785928&sent_id=1600423397&service_id=22668&redirect_url=https:/relievehotmailonly.cloudns.cl/imagineme/ionos.php$all
Filter updated: Mon, 13 Sep 2021 12:01:52 +0000
2021-09-13 12:01:52 +00:00
||miangroupofcompanies.com$all
Filter updated: Tue, 27 Jul 2021 00:02:10 +0000
2021-07-27 00:02:10 +00:00
||mibancocrece.com.co$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||michaelshapiromusic.com$all
Filter updated: Wed, 18 Aug 2021 00:01:50 +0000
2021-08-18 00:01:50 +00:00
||michel.hyperphp.com$all
Filter updated: Tue, 13 Apr 2021 12:07:03 UTC
2021-04-13 12:07:03 +00:00
||micr0s0ftverify.nicepage.io$all
Filter updated: Thu, 22 Apr 2021 12:08:20 UTC
2021-04-22 12:08:20 +00:00
||microcav.square.site$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||microsoft-excel.kr.jaleco.com$all
Filter updated: Sun, 15 Aug 2021 00:01:57 +0000
2021-08-15 00:01:57 +00:00
||microsoft01829.odoo.com$all
Filter updated: Wed, 25 Aug 2021 12:02:06 +0000
2021-08-25 12:02:07 +00:00
||microsoft0invoce.rf.gd$all
Filter updated: Fri, 27 Aug 2021 00:01:47 +0000
2021-08-27 00:01:47 +00:00
||microsoftloginverification.questionpro.com$all
Filter updated: Sat, 29 May 2021 12:06:18 UTC
2021-05-29 12:06:19 +00:00
||microsoftonedlrlve.typeform.com$all
Filter updated: Thu, 16 Sep 2021 12:02:15 +0000
2021-09-16 12:02:15 +00:00
||microsoftsecure-docucenterfile.questionpro.com$all
Filter updated: Wed, 03 Mar 2021 12:14:44 UTC
2021-03-03 12:14:44 +00:00
||microsoftwebserver.mfs.gg$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||microspromeri081.byethost22.com$all
Filter updated: Fri, 16 Jul 2021 00:01:53 +0000
2021-07-16 00:01:53 +00:00
||microuuy.ultimatefreehost.in$all
Filter updated: Sun, 11 Jul 2021 00:02:18 +0000
2021-07-11 00:02:18 +00:00
||microverifylink.github.io$all
Filter updated: Thu, 05 Aug 2021 00:02:05 +0000
2021-08-05 00:02:05 +00:00
||micuenta01.github.io$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||middle.servehttp.com$all
Filter updated: Sat, 29 May 2021 12:06:18 UTC
2021-05-29 12:06:19 +00:00
||midnightluna1.typeform.com$all
Filter updated: Sun, 15 Aug 2021 12:01:40 +0000
2021-08-15 12:01:40 +00:00
||mido-safe.com$all
Filter updated: Mon, 23 Nov 2020 12:06:43 UTC
2020-11-23 12:06:44 +00:00
||midshopping.ro$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||miecompany.8b.io$all
Filter updated: Mon, 23 Nov 2020 12:06:43 UTC
2020-11-23 12:06:44 +00:00
||mijnbuitenhuis.nl$all
Filter updated: Thu, 19 Aug 2021 00:01:47 +0000
2021-08-19 00:01:47 +00:00
||mikakahla463.shoplineapp.com$all
Filter updated: Tue, 18 May 2021 00:06:34 UTC
2021-05-18 00:06:34 +00:00
||mikelantes.vzpla.net$all
Filter updated: Thu, 19 Aug 2021 12:02:33 +0000
2021-08-19 12:02:33 +00:00
||milamansa.com$all
Filter updated: Tue, 29 Dec 2020 12:06:20 UTC
2020-12-29 12:06:20 +00:00
||milanno342.blogspot.com/2020/11/fiyatlar.html$all
Filter updated: Mon, 16 Aug 2021 12:01:42 +0000
2021-08-16 12:01:42 +00:00
||milanobet301.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||millenniaco-my.sharepoint.com/:o:/g/personal/vgibbs_mhmltd_com/epp3aeyaxrlkqypm5j3ps5ib0imi6otftjp4ijzlbe4pyq?e=5:r8hnxr&at=9$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||millenniaco-my.sharepoint.com/personal/vgibbs_mhmltd_com/_layouts/15/doc.aspx?sourcedoc={ec69f793-5e80-4ab9-ab2a-66e49de9b392}&action=default&slrid=dca0489f-f03b-b000-9fd0-1e171e182306&originalpath=ahr0chm6ly9tawxszw5uawfjby1tes5zagfyzxbvaw50lmnvbs86bzovzy9wzxjzb25hbc92z2liynnfbwhtbhrkx2nvbs9fcfazywv5qvhybetxexbtnuozchm1suiwaw1pnk90znrqcdrpsnpmqmu0uhlrp3j0aw1lpujzclb1vkrnmtbn&cid=0e1475ff-8901-48a8-aeae-660a9e5b5547$all
Filter updated: Mon, 08 Feb 2021 12:09:02 UTC
2021-02-08 12:09:02 +00:00
||millenniumstaffing.co.uk$all
Filter updated: Sat, 20 Feb 2021 00:06:47 UTC
2021-02-20 00:06:47 +00:00
||miloserdie-rzn.ru$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||mimecast.fmlms.com$all
Filter updated: Sat, 06 Feb 2021 12:06:42 UTC
2021-02-06 12:06:42 +00:00
||mimecast.swagonline.co.uk$all
Filter updated: Thu, 09 Sep 2021 00:01:56 +0000
2021-09-09 00:01:56 +00:00
||minor-color.surge.sh$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||mintmade.co.uk$all
Filter updated: Wed, 25 Aug 2021 00:01:57 +0000
2021-08-25 00:01:57 +00:00
||minute-too-late.my.id$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||miplab.net$all
Filter updated: Wed, 27 Jan 2021 12:06:59 UTC
2021-01-27 12:06:59 +00:00
||mipymescolombiana.com$all
Filter updated: Sat, 18 Sep 2021 12:01:34 +0000
2021-09-18 12:01:34 +00:00
||miraclecraftshop.com$all
Filter updated: Tue, 14 Sep 2021 00:01:48 +0000
2021-09-14 00:01:48 +00:00
||misdatosviabcp.live$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||missed-delivery-depot.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||missionshashank.org$all
Filter updated: Tue, 10 Nov 2020 00:06:13 UTC
2020-11-10 00:06:13 +00:00
||mistimbas.com$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||mitrasinergisukses.com$all
Filter updated: Fri, 17 Sep 2021 12:01:51 +0000
2021-09-17 12:01:52 +00:00
||mitrasinergisukses.com/to/authorize_client_id:0ar3ubx9-efko-7kel-dzvi-g1u9yep3xwi2_2iwdasp18v3y09z7oenhkjcxltg564umqrbfh6f184ynrv9cktxoj0e3w5qzabsdg27mulipge8a5yrthd91pq4scu7kvobn0xwifz63ljm2?data=&email=brickell1st@unitedpropertymgt.com$all
Filter updated: Mon, 20 Sep 2021 12:02:05 +0000
2021-09-20 12:02:05 +00:00
||mitrasinergisukses.com/to/authorize_client_id:fd34jogt-okyt-doxr-xsu7-miu4tra9zxoc_agus0hd8b6yj25miwzc31xtrpqevol794kfnizj96yq0hr8x3wfu5cb1ma72ngpolte4dvskjvsnwi0do5zfb687lexkh3mqa9c2p4utgy1r?data=&email=brickell1st@unitedpropertymgt.com$all
Filter updated: Tue, 19 Jan 2021 12:07:14 UTC
2021-01-19 12:07:14 +00:00
||mivtsystems.com$all
Filter updated: Sat, 26 Jun 2021 00:06:14 +0000
2021-06-26 00:06:14 +00:00
||mixedgoat.com/index.php$all
Filter updated: Thu, 12 Nov 2020 12:06:49 UTC
2020-11-12 12:06:49 +00:00
||mixi.guru$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||mixmytea.at$all
Filter updated: Fri, 30 Oct 2020 00:06:25 UTC
2020-10-30 00:06:25 +00:00
||mjayme9jdg9izxixmjeydgg.filesusr.com$all
Filter updated: Sat, 14 Aug 2021 00:01:49 +0000
2021-08-14 00:01:49 +00:00
||mjayme9jdg9izxiymjnyza.filesusr.com$all
Filter updated: Wed, 19 May 2021 00:06:43 UTC
2021-05-19 00:06:44 +00:00
||mjaymu1heta1dgg.filesusr.com$all
Filter updated: Fri, 21 May 2021 00:06:36 UTC
2021-05-21 00:06:36 +00:00
||mjaymu1hetezmtj0aa.filesusr.com$all
Filter updated: Mon, 24 May 2021 00:06:37 UTC
2021-05-24 00:06:37 +00:00
||mjaymu1hetgym3jk.filesusr.com$all
Filter updated: Fri, 21 May 2021 00:06:36 UTC
2021-05-21 00:06:36 +00:00
||mjaymu1hetizmtl0aa.filesusr.com$all
Filter updated: Sun, 23 May 2021 00:06:33 UTC
2021-05-23 00:06:33 +00:00
||mjaymu1hetqymhro.filesusr.com$all
Filter updated: Sat, 08 May 2021 00:06:32 UTC
2021-05-08 00:06:32 +00:00
||mjaymu1hetu3dgg.filesusr.com$all
Filter updated: Sun, 23 May 2021 00:06:33 UTC
2021-05-23 00:06:33 +00:00
||mjaymu1hetuymhro.filesusr.com$all
Filter updated: Thu, 12 Aug 2021 12:01:52 +0000
2021-08-12 12:01:53 +00:00
||mjaymuf1z3vzdde4mtf0aa.filesusr.com$all
Filter updated: Tue, 27 Apr 2021 00:06:47 UTC
2021-04-27 00:06:47 +00:00
||mjaymufwcmlsmde5dgg.filesusr.com$all
Filter updated: Sat, 17 Jul 2021 12:01:37 +0000
2021-07-17 12:01:37 +00:00
||mjaymup1bhk0mtf0aa.filesusr.com$all
Filter updated: Thu, 15 Jul 2021 12:01:53 +0000
2021-07-15 12:01:53 +00:00
||mjaymup1bhk1mtr0aa.filesusr.com$all
||mjaymup1bhkzmtn0aa.filesusr.com$all
Filter updated: Sat, 12 Jun 2021 00:25:37 UTC
2021-06-12 00:25:37 +00:00
||mjaymup1bmu0mtf0aa.filesusr.com$all
Filter updated: Fri, 04 Jun 2021 12:07:04 UTC
2021-06-04 12:07:04 +00:00
||mjaymup1bmuymzfzda.filesusr.com$all
Filter updated: Thu, 29 Jul 2021 00:01:57 +0000
2021-07-29 00:01:57 +00:00
||mjaymuphbnvhcnkxmzv0aa.filesusr.com$all
Filter updated: Sat, 18 Sep 2021 00:14:48 +0000
2021-09-18 00:14:48 +00:00
||mjaymvnlchrlbwjlcjizmxn0.filesusr.com$all
Filter updated: Tue, 25 May 2021 00:06:25 UTC
2021-05-25 00:06:25 +00:00
||mkengineering.com.my$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||mkiuyhakauywa.blogspot.com$all
Filter updated: Fri, 13 Aug 2021 00:01:48 +0000
2021-08-13 00:01:48 +00:00
||mky.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||ml3wsnjp74.000webhostapp.com$all
Filter updated: Thu, 23 Sep 2021 00:02:18 +0000
2021-09-23 00:02:18 +00:00
||mlcexpresstransportes.com.br$all
Filter updated: Tue, 31 Aug 2021 00:01:55 +0000
2021-08-31 00:01:55 +00:00
||mlcoarb.com$all
Filter updated: Fri, 04 Dec 2020 00:06:15 UTC
2020-12-04 00:06:16 +00:00
||mmprsatx.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||mms.tucsonhispanicchamber.net$all
Filter updated: Thu, 03 Sep 2020 12:06:37 UTC
2020-09-03 12:06:37 +00:00
||mmsportable.kissr.com$all
Filter updated: Tue, 21 Sep 2021 12:02:11 +0000
2021-09-21 12:02:11 +00:00
||mnhjhjuuhn-vtvghyghji-ygfgyhuji.s3.amazonaws.com/index.html$all
Filter updated: Fri, 05 Mar 2021 12:06:38 UTC
2021-03-05 12:06:38 +00:00
||mnp-postscriptum.com$all
Filter updated: Wed, 22 Sep 2021 00:02:26 +0000
2021-09-22 00:02:26 +00:00
||moaracubucate.ro$all
Filter updated: Mon, 04 Jan 2021 00:06:10 UTC
2021-01-04 00:06:10 +00:00
||mobile-alerts-o2.com$all
Filter updated: Tue, 10 Nov 2020 00:06:13 UTC
2020-11-10 00:06:13 +00:00
||mobile-portail.live$all
Filter updated: Mon, 08 Feb 2021 12:09:02 UTC
2021-02-08 12:09:02 +00:00
||mobile-srftoken-benutzername.de$all
Filter updated: Wed, 05 May 2021 12:12:51 UTC
2021-05-05 12:12:51 +00:00
||mobile.retrocafe.net.au$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||mobile.servepics.com$all
Filter updated: Tue, 14 Sep 2021 00:01:48 +0000
2021-09-14 00:01:48 +00:00
||mobiledesbloqueio.com$all
Filter updated: Sun, 04 Jul 2021 12:01:42 +0000
2021-07-04 12:01:42 +00:00
||mobsuemil.com$all
Filter updated: Mon, 22 Mar 2021 12:06:55 UTC
2021-03-22 12:06:55 +00:00
||mockup.metradigitalmedia.com$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||modabotas.com$all
Filter updated: Sat, 28 Aug 2021 12:01:47 +0000
2021-08-28 12:01:47 +00:00
||modasbrilhodosol.com$all
Filter updated: Wed, 23 Jun 2021 00:06:32 +0000
2021-06-23 00:06:32 +00:00
||moderka-sklep.pl$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||modest-kapitsa.23-94-190-112.plesk.page$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||modularmovements-my.sharepoint.com/personal/khunsley_modularmovements_com/_layouts/15/onedrive.aspx?id=/personal/khunsley_modularmovements_com/documents/dbc%20sharepoint.pdf&parent=/personal/khunsley_modularmovements_com/documents&originalpath=ahr0chm6ly9tb2r1bgfybw92zw1lbnrzlw15lnnoyxjlcg9pbnquy29tlzpioi9wl2todw5zbgv5l0vhuupzyxbquvvkq25wtxjfexzgd2tbqm5bmly0s0tzu01kdu0tukvns1h6tle_cnrpbwu9dzhiulbwaguyrwc$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||mohansenhighschool.com$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||moira.cl$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||moj.aktiv.rs$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||mokusew.cf$all
Filter updated: Wed, 15 Sep 2021 12:01:46 +0000
2021-09-15 12:01:46 +00:00
||mollybabes.com$all
Filter updated: Wed, 25 Aug 2021 12:02:06 +0000
2021-08-25 12:02:07 +00:00
||momentoslemadrid.com$all
Filter updated: Wed, 22 Sep 2021 00:02:26 +0000
2021-09-22 00:02:26 +00:00
||mon-service-admin.mikecole-tennis.de$all
Filter updated: Fri, 16 Jul 2021 12:01:57 +0000
2021-07-16 12:01:57 +00:00
||monexde.com$all
Filter updated: Mon, 16 Aug 2021 12:01:42 +0000
2021-08-16 12:01:42 +00:00
||moneyclaims-legal.aat.platform.hmcts.net$all
Filter updated: Sat, 13 Mar 2021 12:07:44 UTC
2021-03-13 12:07:44 +00:00
||moneyviewfinance.in$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||moni.bg$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||monirshouvo.github.io$all
||monomobileservice.yolasite.com$all
Filter updated: Mon, 16 Aug 2021 00:01:59 +0000
2021-08-16 00:01:59 +00:00
||monooh.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||monovative-my.sharepoint.com:443/:o:/g/personal/user_monovative_onmicrosoft_com/emczkjnkzgxdtejtstz67qqblknarn4da620kjaje91ewq?e=5:weseg8&at=9$all
Filter updated: Sat, 19 Dec 2020 00:06:42 UTC
2020-12-19 00:06:42 +00:00
||monstercarp.rn86.ru$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||monstercarp.rn86.ru/dvtygtgvrv.html?ggcdraewqaszxfdxcgchjbjnhbgvfcdrxtcyvbuninhbygtfcrx$all
Filter updated: Tue, 24 Aug 2021 12:02:00 +0000
2021-08-24 12:02:00 +00:00
||montessoricali.edu.co$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||monthly-o2-paymentsupport.com$all
||montmabesa1888.blogspot.com$all
Filter updated: Fri, 10 Sep 2021 00:02:17 +0000
2021-09-10 00:02:17 +00:00
||monyeward.com$all
Filter updated: Fri, 12 Mar 2021 12:07:45 UTC
2021-03-12 12:07:45 +00:00
||moodle.lms-su.com$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||mopxopeps.vn$all
Filter updated: Wed, 22 Sep 2021 00:02:26 +0000
2021-09-22 00:02:26 +00:00
||mor-globa.cf$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||mor-globa.ga$all
Filter updated: Fri, 27 Aug 2021 00:01:47 +0000
2021-08-27 00:01:47 +00:00
||moraesegiocondo.adv.br$all
Filter updated: Thu, 27 May 2021 00:06:23 UTC
2021-05-27 00:06:23 +00:00
||mordovia-darts.ru$all
Filter updated: Tue, 21 Sep 2021 12:02:11 +0000
2021-09-21 12:02:11 +00:00
||morning-cloud-9b80.loginupdatemail.workers.dev$all
Filter updated: Mon, 02 Aug 2021 00:02:18 +0000
2021-08-02 00:02:18 +00:00
||most-afrikanist.co.za/.system.info/chasetherednecktothesee.htm$all
Filter updated: Sun, 06 Jun 2021 12:06:15 UTC
2021-06-06 12:06:16 +00:00
||mosvisa24.ru$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||motherboard-filters-stephanie-membrane.trycloudflare.com$all
Filter updated: Sat, 18 Sep 2021 00:14:48 +0000
2021-09-18 00:14:48 +00:00
||motormoskito.cl$all
Filter updated: Fri, 27 Aug 2021 12:01:40 +0000
2021-08-27 12:01:40 +00:00
||motorsparkle.top$all
Filter updated: Thu, 16 Sep 2021 00:01:52 +0000
2021-09-16 00:01:52 +00:00
||movingsquadsc-com.ga$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||mperso5gm2.temp.swtest.ru$all
Filter updated: Mon, 20 Sep 2021 00:01:41 +0000
2021-09-20 00:01:41 +00:00
||mq.gl$all
||msc-doelsach.at$all
Filter updated: Wed, 15 Sep 2021 12:01:46 +0000
2021-09-15 12:01:46 +00:00
||msftoutlook.site$all
Filter updated: Mon, 24 May 2021 00:06:37 UTC
2021-05-24 00:06:37 +00:00
||msnserviceverifivation.wordpress.com$all
Filter updated: Tue, 13 Apr 2021 12:07:03 UTC
2021-04-13 12:07:03 +00:00
||msofficemessagescenter-1.mfs.gg$all
Filter updated: Sat, 12 Jun 2021 00:25:37 UTC
2021-06-12 00:25:37 +00:00
||msofficesystems.mfs.gg$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||mtbb3authprotect.duckdns.org$all
Filter updated: Sun, 29 Aug 2021 00:01:50 +0000
2021-08-29 00:01:51 +00:00
||mtngifts2021.blogspot.com$all
Filter updated: Wed, 22 Sep 2021 00:02:26 +0000
2021-09-22 00:02:26 +00:00
||mtpo.pages.dev$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||mtradeasia.cf$all
||muabanotoxemay.com$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||mudraloans.biz$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||muhasebex.com$all
Filter updated: Wed, 01 Sep 2021 00:02:20 +0000
2021-09-01 00:02:20 +00:00
||muleshoe-eng.com$all
Filter updated: Wed, 18 Aug 2021 12:02:35 +0000
2021-08-18 12:02:36 +00:00
||multiplushk.com$all
Filter updated: Sat, 13 Feb 2021 12:06:55 UTC
2021-02-13 12:06:55 +00:00
||multirbnacion.com$all
Filter updated: Fri, 24 Sep 2021 12:02:36 +0000
2021-09-24 12:02:36 +00:00
||multiredvirtualbn.live$all
Filter updated: Tue, 17 Aug 2021 12:01:39 +0000
2021-08-17 12:01:39 +00:00
||multiserviciosfibnc.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||mundovirtualhabbo.blogspot.com/2009_01_01_archive.html$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||mundus-capital.com$all
Filter updated: Tue, 07 Sep 2021 00:01:46 +0000
2021-09-07 00:01:46 +00:00
||musclespro.com$all
Filter updated: Tue, 21 Sep 2021 00:01:40 +0000
2021-09-21 00:01:40 +00:00
||music3.wymomg.com$all
Filter updated: Sat, 26 Jun 2021 12:06:10 +0000
2021-06-26 12:06:10 +00:00
||musicgiftsgalore.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||musicisit.de$all
Filter updated: Sat, 29 May 2021 12:06:18 UTC
2021-05-29 12:06:19 +00:00
||mw2hbg7ev0a.typeform.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||mxrr.com$all
Filter updated: Sun, 06 Jun 2021 12:06:15 UTC
2021-06-06 12:06:16 +00:00
||my-bithumb.web.app$all
Filter updated: Wed, 26 May 2021 00:06:29 UTC
2021-05-26 00:06:29 +00:00
||my-da4a.ru$all
Filter updated: Thu, 07 Jan 2021 12:06:18 UTC
2021-01-07 12:06:18 +00:00
||my-devices-halifax.com$all
Filter updated: Thu, 03 Sep 2020 12:06:37 UTC
2020-09-03 12:06:37 +00:00
||my-site219.yolasite.com$all
Filter updated: Mon, 30 Aug 2021 00:02:03 +0000
2021-08-30 00:02:03 +00:00
||my-site228.yolasite.com$all
Filter updated: Fri, 24 Sep 2021 12:02:36 +0000
2021-09-24 12:02:36 +00:00
||my-sofftbank.icu$all
Filter updated: Tue, 24 Aug 2021 12:02:00 +0000
2021-08-24 12:02:00 +00:00
||my.forms.app/citizens-2021-grant/extra-pandemic-stimulus-bonus-application-citizens$all
||my.forms.app/form/60d8ccf87e6c303b0f11e680$all
Filter updated: Sat, 11 Sep 2021 12:01:27 +0000
2021-09-11 12:01:27 +00:00
||my.forms.app/form/60deff002ca34f5aa4985ab3$all
Filter updated: Tue, 24 Aug 2021 12:02:00 +0000
2021-08-24 12:02:00 +00:00
||my.forms.app/form/6113e307a3f6e60d5120c56c$all
||my.forms.app/governmentstimulus1/stimulus$all
||my.forms.app/robertnunn/pandemic-form$all
||my.forms.app/uzhainedan/pandemicreliefprogramm$all
||my.forms.app/verifikasi2/verifikasi-facebook$all
Filter updated: Sat, 12 Sep 2020 00:07:13 UTC
2020-09-12 00:07:13 +00:00
||my.nativeforms.com$all
Filter updated: Fri, 09 Jul 2021 00:01:59 +0000
2021-07-09 00:01:59 +00:00
||my.texter.pk$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||my.ts3card.tvppgz.com$all
Filter updated: Fri, 09 Oct 2020 12:06:12 UTC
2020-10-09 12:06:12 +00:00
||my02billing.dev$all
Filter updated: Sat, 06 Feb 2021 12:06:42 UTC
2021-02-06 12:06:42 +00:00
||my2ktop.company.site$all
||my2ktop.ecwid.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||myacademic-support.com/wp-content/ww/.../generalmanager/inquiry/login.globalsource.com/index.php$all
Filter updated: Sun, 07 Feb 2021 00:06:51 UTC
2021-02-07 00:06:51 +00:00
||myauthorz.com$all
Filter updated: Wed, 21 Jul 2021 12:01:49 +0000
2021-07-21 12:01:49 +00:00
||mybank.toc.com.ec$all
Filter updated: Sat, 14 Aug 2021 12:02:02 +0000
2021-08-14 12:02:02 +00:00
||mybilling-paymybill.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||mybpos.net$all
Filter updated: Wed, 22 Sep 2021 12:01:56 +0000
2021-09-22 12:01:56 +00:00
||mybt-onlinebill.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||mycoerver.es$all
Filter updated: Tue, 13 Jul 2021 00:02:30 +0000
2021-07-13 00:02:30 +00:00
||mydoc-pasadenaisd.org$all
Filter updated: Tue, 20 Jul 2021 00:01:58 +0000
2021-07-20 00:01:58 +00:00
||myedd-profile.verifyidentity.workers.dev$all
Filter updated: Fri, 19 Feb 2021 00:06:27 UTC
2021-02-19 00:06:28 +00:00
||myee-billing-info.com$all
Filter updated: Thu, 26 Aug 2021 12:02:31 +0000
2021-08-26 12:02:31 +00:00
||myeedirect.co.uk$all
Filter updated: Thu, 18 Feb 2021 00:06:34 UTC
2021-02-18 00:06:34 +00:00
||myeeyouree.com$all
Filter updated: Tue, 26 Jan 2021 00:06:20 UTC
2021-01-26 00:06:20 +00:00
||myentnherballet.com$all
Filter updated: Wed, 14 Apr 2021 12:07:09 UTC
2021-04-14 12:07:09 +00:00
||myetherwollot.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||mygrubgrub18.duckdns.org$all
||mygyi.github.io$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||myhealthinsquotes.com$all
Filter updated: Sun, 13 Jun 2021 00:06:42 UTC
2021-06-13 00:06:42 +00:00
||myhermes-redeliveryhelp.com$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||myjcb-89oski.gwcqd.com$all
Filter updated: Fri, 20 Aug 2021 00:01:56 +0000
2021-08-20 00:01:56 +00:00
||myjobassists.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||mykonos.cl$all
||mylovejar.com$all
Filter updated: Thu, 29 Jul 2021 00:01:57 +0000
2021-07-29 00:01:57 +00:00
||mymangowallet.com/wp-content/themes/20/aeon.co.jp/$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||mymentalhealthday.org$all
Filter updated: Tue, 02 Mar 2021 12:07:41 UTC
2021-03-02 12:07:42 +00:00
||mymonero.to$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||mymweb-owner.at.ua$all
Filter updated: Thu, 07 Jan 2021 00:06:17 UTC
2021-01-07 00:06:17 +00:00
||myo2-billing-error28.com$all
Filter updated: Mon, 04 Jan 2021 00:06:10 UTC
2021-01-04 00:06:10 +00:00
||myo2-billing-error83.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||myparc.sharepoint.com/:x:/r/_layouts/15/wopiframe.aspx?guestaccesstoken=xvdowzk%2bkm4wndrziofnpfcj8fb8rkrsqt%2bkybvollg%3d&docid=1_16fb1a2a3e2f9468aa7cebc35874c9da0&wdformid=%7b95111770-0103-492b-8c70-e9625f96b49a%7d&action=formsubmit&cid=4d02a372-8b83-4120-84b5-1d9a2a3492dd$all
||myparc.sharepoint.com/_layouts/15/wopiframe.aspx?guestaccesstoken=xvdowzk%2bkm4wndrziofnpfcj8fb8rkrsqt%2bkybvollg%3d&docid=1_16fb1a2a3e2f9468aa7cebc35874c9da0&wdformid=%7b95111770-0103-492b-8c70-e9625f96b49a%7d&action=formsubmit&cid=4d02a372-8b83-4120-84b5-1d9a2a3492dd$all
Filter updated: Wed, 08 Sep 2021 12:01:51 +0000
2021-09-08 12:01:51 +00:00
||mypixie.net$all
Filter updated: Sat, 12 Sep 2020 12:06:46 UTC
2020-09-12 12:06:46 +00:00
||myqatar.com$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||myqli.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||mysait-my.sharepoint.com/:x:/r/personal/ebenezer_ajayi_edu_sait_ca/_layouts/15/wopiframe.aspx?guestaccesstoken=y%2bhr1dv9mxgpih7r4y%2f%2fjkhvv1nxdh3imaz%2bmjeumni%3d&docid=1_1ff1eb35301564d1698455e7de780fe7f&wdformid=%7b2b1e75ff%2d4748%2d448a%2db5f7%2d7d4a5138e7f7%7d&action=formsubmit&cid=b8bab67a-6675-4883-8c86-32942813ffb3$all
Filter updated: Wed, 16 Jun 2021 00:06:45 +0000
2021-06-16 00:06:45 +00:00
||myshedbuilder.com$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||mysites.infinityfreeapp.com$all
Filter updated: Sat, 10 Jul 2021 00:01:42 +0000
2021-07-10 00:01:42 +00:00
||mysmartconveyance.app$all
Filter updated: Mon, 26 Apr 2021 12:07:30 UTC
2021-04-26 12:07:30 +00:00
||mysoulaura.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||mysummercamps.com/forum/for_camp_directors_c3/research_and_learn_f10/bridging_the_gap_at_summer_camp/gforum.cgi?url=http://server.bludomain82.com/~bree2/review/#_&?hannah.judge@discsystems.co.uk$all
Filter updated: Sat, 18 Sep 2021 12:01:34 +0000
2021-09-18 12:01:34 +00:00
||myswisscomonline.net$all
Filter updated: Fri, 08 Jan 2021 00:06:25 UTC
2021-01-08 00:06:25 +00:00
||myupdates-mynetflix.com$all
Filter updated: Tue, 21 Sep 2021 00:01:40 +0000
2021-09-21 00:01:40 +00:00
||mzwy2.csb.app$all
Filter updated: Sun, 06 Jun 2021 12:06:15 UTC
2021-06-06 12:06:16 +00:00
||n-naoko-0319.github.io$all
Filter updated: Tue, 23 Feb 2021 12:07:09 UTC
2021-02-23 12:07:09 +00:00
||n26-particuluar-n26-personal-own.boxofbusinessblogs.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||n4r7u.app.link$all
Filter updated: Fri, 16 Jul 2021 00:01:53 +0000
2021-07-16 00:01:53 +00:00
||n6623a052sk.typeform.com$all
Filter updated: Sat, 29 May 2021 12:06:18 UTC
2021-05-29 12:06:19 +00:00
||n66744rp5er.typeform.com$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||n7orton.com$all
Filter updated: Wed, 21 Jul 2021 12:01:49 +0000
2021-07-21 12:01:49 +00:00
||n9.cl/fc8n7k94eavtmepu2w$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||n9qyb.csb.app$all
Filter updated: Wed, 15 Sep 2021 12:01:46 +0000
2021-09-15 12:01:46 +00:00
||na-amazon-creturns.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||nabagejec1893.blogspot.com$all
Filter updated: Thu, 18 Feb 2021 12:07:12 UTC
2021-02-18 12:07:12 +00:00
||nabagejec1893.blogspot.sg$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||nabtolonu1913.blogspot.com$all
Filter updated: Thu, 18 Feb 2021 12:07:12 UTC
2021-02-18 12:07:12 +00:00
||nabtolonu1913.blogspot.kr$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||nacionalbank.webcindario.com$all
Filter updated: Fri, 20 Aug 2021 12:01:48 +0000
2021-08-20 12:01:48 +00:00
||najboljeuslugezavas.betterservicesforyou.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||nakamistrad.com$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||namasteflavoursannarbor.com$all
Filter updated: Tue, 20 Jul 2021 00:01:58 +0000
2021-07-20 00:01:58 +00:00
||nanairan.com$all
Filter updated: Sun, 20 Dec 2020 12:06:45 UTC
2020-12-20 12:06:45 +00:00
||naranja-users.auth0.com$all
Filter updated: Tue, 21 Sep 2021 00:01:40 +0000
2021-09-21 00:01:40 +00:00
||narinrayan.ir/o+/$all
Filter updated: Wed, 22 Sep 2021 12:01:56 +0000
2021-09-22 12:01:56 +00:00
||narinrayan.ir/o+/orange.php$all
Filter updated: Sat, 18 Sep 2021 00:14:48 +0000
2021-09-18 00:14:48 +00:00
||narnozom.co.jp.hjmqbza.cn$all
Filter updated: Sat, 03 Oct 2020 00:06:51 UTC
2020-10-03 00:06:51 +00:00
||narrativesummit.org$all
Filter updated: Tue, 19 Jan 2021 12:07:14 UTC
2021-01-19 12:07:14 +00:00
||natwest.nwolb-device-login.com$all
Filter updated: Mon, 18 Jan 2021 12:06:33 UTC
2021-01-18 12:06:33 +00:00
||natwest.nwolb-login-auth.com$all
Filter updated: Sun, 17 Jan 2021 00:06:45 UTC
2021-01-17 00:06:45 +00:00
||natwest.secure-auth-personal-device.com$all
Filter updated: Sun, 07 Feb 2021 00:06:51 UTC
2021-02-07 00:06:51 +00:00
||natwest.secured-online-verify.com$all
Filter updated: Thu, 11 Mar 2021 00:09:12 UTC
2021-03-11 00:09:12 +00:00
||natwest.secured-personal-verify.com$all
Filter updated: Fri, 10 Sep 2021 00:02:17 +0000
2021-09-10 00:02:17 +00:00
||nav.vn$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||navigatorthailand.com$all
Filter updated: Mon, 06 Sep 2021 12:01:50 +0000
2021-09-06 12:01:50 +00:00
||nbdtrade.com$all
Filter updated: Thu, 05 Aug 2021 12:01:57 +0000
2021-08-05 12:01:57 +00:00
||ncaweagricol.byethost33.com$all
Filter updated: Sun, 20 Jun 2021 00:06:25 +0000
2021-06-20 00:06:25 +00:00
||ncservices.co.in$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||ndputed.anoamoz.top$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||ne1flix.com$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||ne7vwmh61fk.typeform.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||nebojsega.com$all
Filter updated: Thu, 15 Apr 2021 00:06:48 UTC
2021-04-15 00:06:48 +00:00
||necessitymag.com$all
Filter updated: Fri, 17 Sep 2021 12:01:51 +0000
2021-09-17 12:01:52 +00:00
||neckelmanns.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||nedbank.demdex.net$all
Filter updated: Wed, 01 Sep 2021 12:01:58 +0000
2021-09-01 12:01:58 +00:00
||nedbankqa.flowblocks.com$all
Filter updated: Sun, 01 Aug 2021 00:01:58 +0000
2021-08-01 00:01:59 +00:00
||nedirien.online$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||nelsonjustus.com.br$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||neltfxix.blogspot.com$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||nerefors.fun$all
Filter updated: Wed, 19 May 2021 00:06:43 UTC
2021-05-19 00:06:44 +00:00
||nero.egybest.site$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||net.logowanie-bezpieczna-online.com$all
||netbka.net$all
Filter updated: Thu, 03 Sep 2020 12:06:37 UTC
2020-09-03 12:06:37 +00:00
||netciti.id$all
Filter updated: Wed, 16 Jun 2021 00:06:45 +0000
2021-06-16 00:06:45 +00:00
||netfilx.com.zonefivestudio.com$all
Filter updated: Wed, 06 Jan 2021 12:06:34 UTC
2021-01-06 12:06:34 +00:00
||netflix-com.com$all
Filter updated: Sun, 05 Sep 2021 00:02:15 +0000
2021-09-05 00:02:15 +00:00
||netflix-fr-fr-navlink-connexion.trans-mea.com$all
Filter updated: Mon, 08 Feb 2021 00:06:40 UTC
2021-02-08 00:06:40 +00:00
||netflix.sourceaudio.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||netflixconfirmer-93ef47.ingress-erytho.easywp.com$all
Filter updated: Thu, 03 Sep 2020 12:06:37 UTC
2020-09-03 12:06:37 +00:00
||netflixloginhelp.com$all
Filter updated: Tue, 30 Mar 2021 00:06:27 UTC
2021-03-30 00:06:27 +00:00
||netlana.com$all
Filter updated: Fri, 20 Aug 2021 00:01:56 +0000
2021-08-20 00:01:56 +00:00
||netmas.com.mx$all
Filter updated: Wed, 18 Aug 2021 12:02:35 +0000
2021-08-18 12:02:36 +00:00
||netorg140587-my.sharepoint.com/:b:/g/personal/david_siteproperty_com/eq8kw97vmw9jkutctnkcbxkbmdwlprnakta1bywrks5-hw?e=vmna6v$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||netorg4219258-my.sharepoint.com/personal/peter_baumanglobal_com/_layouts/15/authenticate.aspx$all
||netorg5539223-my.sharepoint.com/:x:/r/personal/ddoris_airservicesco_com/_layouts/15/wopiframe.aspx?guestaccesstoken=%2b3y%2bcdfvdslxx0tgrivwrfjqapqcjfpi%2fnyhmijz6qa%3d&docid=1_1021e11db2d82413ebf54355221c28513&wdformid=%7b5bf1f9e2%2d5212%2d4414%2d8e87%2d9d18071fcce1%7d&action=formsubmit$all
Filter updated: Fri, 25 Jun 2021 00:06:14 +0000
2021-06-25 00:06:14 +00:00
||netorg6600800-my.sharepoint.com/:x:/r/personal/ginger_gingerfountain_com/_layouts/15/wopiframe.aspx$all
Filter updated: Thu, 10 Jun 2021 00:06:48 UTC
2021-06-10 00:06:48 +00:00
||netorg6600800-my.sharepoint.com/:x:/r/personal/ginger_gingerfountain_com/_layouts/15/wopiframe.aspx?guestaccesstoken=gpys8ex7ys1urrzbfeasvlexkodtrovmmcpn%2brsnebs%3d&docid=1_1882b07b5eb5643d2bdaa63426324ef0e&wdformid=%7b9bd54af1%2dee16%2d4e07%2d8d62%2d6e9b76e47512%7d&action=formsubmit&cid=9adf3e74-8cc1-4e36-b545-c9165fcafde7$all
Filter updated: Tue, 07 Sep 2021 00:01:46 +0000
2021-09-07 00:01:46 +00:00
||netorg6600800-my.sharepoint.com/personal/ginger_gingerfountain_com/_layouts/15/wopiframe.aspx?cid=09f38a51-5e01-4ed2-a663-a97e6a0de6bc$all
Filter updated: Sat, 28 Aug 2021 12:01:47 +0000
2021-08-28 12:01:47 +00:00
||netorg6600800-my.sharepoint.com/personal/ginger_gingerfountain_com/_layouts/15/wopiframe2.aspx?cid=09f38a51-5e01-4ed2-a663-a97e6a0de6bc$all
Filter updated: Fri, 27 Aug 2021 12:01:40 +0000
2021-08-27 12:01:40 +00:00
||netorg791425-my.sharepoint.com/:b:/g/personal/gscaglione_shulmanventures_com/esbu2b9nnzjagf5sh57gkkcbf8xzlqtnsdbogrc9uo_6-w?e=6kdxdd$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||netorgft1393773-my.sharepoint.com/:o:/g/personal/alan_etkinpllc_com/emv9ti9prk1ioco67l0q4eybqcu9jbj--dz3wlksvzg3lg?e=8ainmj$all
||netorgft2223515-my.sharepoint.com/:x:/r/personal/leon_leongavartin_com/_layouts/15/wopiframe.aspx?guestaccesstoken=rpanwaz3gooz0d20j9wu7zzskog8p5egpbt4oc5j5bq%3d&docid=1_137b486a2059c4fc7b670d2ddb8f27254&wdformid=%7b07fe213f%2d4079%2d45b9%2db73f%2dfa9809248dd7%7d&action=formsubmit$all
||netorgft2223515-my.sharepoint.com/:x:/r/personal/leon_leongavartin_com/_layouts/15/wopiframe.aspx?guestaccesstoken=xamh1yie5ztbehymkwldcb6bkcf1kqp13dwjvauswg4%3d&docid=1_10f85e31d21194b00bc5c96bd48a6a4fc&wdformid=%7b702d2762%2df654%2d423b%2dba6b%2d850079f6ed46%7d&action=formsubmit$all
||netorgft7625533-my.sharepoint.com/personal/service_grandisleties_com/_layouts/15/wopiframe.aspx?guestaccesstoken=pmxhjtsepwbmxi%20afreenyvyn0jrccvcgbqrd0jtcq8=&docid=1_1e318a834149c47f884752e9315da88d5&wdformid={21f3b38e-e8d9-4097-be99-0cb952413aff}&action=formsubmit$all
||netorgft7625533-my.sharepoint.com/personal/service_grandisleties_com/_layouts/15/wopiframe.aspx?guestaccesstoken=pmxhjtsepwbmxi%2bafreenyvyn0jrccvcgbqrd0jtcq8%3d&docid=1_1e318a834149c47f884752e9315da88d5&wdformid=%7b21f3b38e%2de8d9%2d4097%2dbe99%2d0cb952413aff%7d&action=formsubmit$all
Filter updated: Sat, 13 Feb 2021 00:06:47 UTC
2021-02-13 00:06:47 +00:00
||netprogress.net$all
Filter updated: Fri, 13 Aug 2021 00:01:48 +0000
2021-08-13 00:01:48 +00:00
||netsantanderuru0.byethost31.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||netservice-upd.tumblr.com$all
Filter updated: Sun, 01 Aug 2021 12:01:43 +0000
2021-08-01 12:01:43 +00:00
||netttxnet.byethost3.com$all
Filter updated: Fri, 19 Feb 2021 00:06:27 UTC
2021-02-19 00:06:28 +00:00
||network.innovatedm.com$all
Filter updated: Wed, 20 Jan 2021 00:06:08 UTC
2021-01-20 00:06:08 +00:00
||new-control-pamis.com$all
Filter updated: Thu, 04 Feb 2021 00:06:18 UTC
2021-02-04 00:06:18 +00:00
||new-devicehelp.com$all
Filter updated: Tue, 19 Jan 2021 00:06:28 UTC
2021-01-19 00:06:28 +00:00
||new-payee-lloyds.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||new.29studios.com$all
Filter updated: Sat, 13 Feb 2021 12:06:55 UTC
2021-02-13 12:06:55 +00:00
||newboi365onlineupdate.com$all
Filter updated: Sat, 05 Jun 2021 12:06:16 UTC
2021-06-05 12:06:17 +00:00
||newcapital-compounds.com$all
Filter updated: Thu, 11 Feb 2021 00:06:15 UTC
2021-02-11 00:06:15 +00:00
||newlien.site44.com$all
Filter updated: Fri, 03 Sep 2021 00:01:54 +0000
2021-09-03 00:01:55 +00:00
||newnanplazapawnshop.com$all
Filter updated: Thu, 07 Jan 2021 00:06:17 UTC
2021-01-07 00:06:17 +00:00
||newonline-payee-restricted.com$all
Filter updated: Wed, 06 Jan 2021 12:06:34 UTC
2021-01-06 12:06:34 +00:00
||newonline-restrict-payee.com$all
Filter updated: Sun, 15 Aug 2021 12:01:40 +0000
2021-08-15 12:01:40 +00:00
||newrydramafestival.co.uk$all
Filter updated: Fri, 25 Jun 2021 12:06:17 +0000
2021-06-25 12:06:17 +00:00
||news.forteens.online$all
Filter updated: Fri, 08 Jan 2021 12:06:25 UTC
2021-01-08 12:06:26 +00:00
||newsbrigade.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||newsbrigade.com/wp-admin/css/colors/ocean/js/theme.js/inc-style/grece.paypai-id.pro968/myaccount/identity/?cmd=_session=us&amp$all
||newsbrigade.com/wp-admin/css/colors/ocean/js/theme.js/inc-style/grece.paypai-id.pro968/myaccount/identity/?cmd=_session=us&d34320f63d56ede7fd814ae4fb903952&dispatch=28eb2b0dad222b43ece5890ac6c4995f14fbf092$all
||newsbrigade.com/wp-admin/css/colors/ocean/js/theme.js/inc-style/grece.paypai-id.pro968/myaccount/identity/?cmd=_session=us&dispatch=a747fec16e90d03372eec4b410a064f3315fc8ab$all
||newsbrigade.com/wp-admin/css/colors/ocean/js/theme.js/inc-style/grece.paypai-id.pro968/myaccount/identity/?cmd=_session=us&e74cc56f728f08bf36fd1c917b4a5074&dispatch=a747fec16e90d03372eec4b410a064f3315fc8ab$all
Filter updated: Mon, 14 Jun 2021 12:06:44 UTC
2021-06-14 12:06:44 +00:00
||newsimdigital.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||newsonghannover.org$all
Filter updated: Wed, 15 Sep 2021 00:01:54 +0000
2021-09-15 00:01:55 +00:00
||newupdateppl.blogspot.com$all
Filter updated: Wed, 05 May 2021 00:06:44 UTC
2021-05-05 00:06:44 +00:00
||newworldcaseblog.com$all
Filter updated: Tue, 13 Apr 2021 00:06:31 UTC
2021-04-13 00:06:31 +00:00
||nexoinmobiliario.pe/bancos/interbank$all
Filter updated: Sun, 28 Feb 2021 12:09:19 UTC
2021-02-28 12:09:19 +00:00
||ngx273.inmotionhosting.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||nha12.samatcha.org$all
Filter updated: Mon, 26 Jul 2021 12:02:00 +0000
2021-07-26 12:02:00 +00:00
||nhacaiuytin888.com$all
Filter updated: Mon, 28 Dec 2020 12:06:19 UTC
2020-12-28 12:06:19 +00:00
||ni212065-1.web02.nitrado.hosting$all
Filter updated: Fri, 27 Aug 2021 00:01:47 +0000
2021-08-27 00:01:47 +00:00
||niadabuyherepayhere.com$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||nice-torvalds.104-168-102-175.plesk.page$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||nicenice.manchesteruniting.space$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||nicoleturneractor.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||nightvision.tech$all
||nihmt.com/examination/admitpanel/filemanager/5365678587$all
Filter updated: Sat, 19 Jun 2021 12:06:28 +0000
2021-06-19 12:06:28 +00:00
||nihongospeechtrainer.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||nikomac.main.jp$all
||nineled.com$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||niversity.serveftp.com$all
Filter updated: Mon, 07 Dec 2020 00:06:12 UTC
2020-12-07 00:06:12 +00:00
||nizotchauffage.bilty.be$all
Filter updated: Fri, 09 Jul 2021 00:01:59 +0000
2021-07-09 00:01:59 +00:00
||njolfs.hyperphp.com$all
Filter updated: Mon, 12 Jul 2021 00:01:55 +0000
2021-07-12 00:01:55 +00:00
||njxzhf.ml$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||noips-y0d0bashi.ddnsking.com$all
Filter updated: Tue, 10 Aug 2021 12:02:08 +0000
2021-08-10 12:02:08 +00:00
||nomehold-gricco3.byethost7.com$all
Filter updated: Fri, 12 Feb 2021 12:06:36 UTC
2021-02-12 12:06:37 +00:00
||nonstop-ks.com$all
Filter updated: Wed, 18 Aug 2021 00:01:50 +0000
2021-08-18 00:01:50 +00:00
||noor-alfajr.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||norcaltc-my.sharepoint.com/personal/acolon_norcaltc_org/_layouts/15/wopiframe.aspx?guestaccesstoken=yze2svus6et1yfbzbrrbp0zblkd6ftbulrue02wudhw=&docid=1_1f1c059892dd04acf92bca72fa2b86901&wdformid={22fa7e1d-2b31-41b8-a33f-0d3a531f6142}&action=formsubmit$all
Filter updated: Wed, 01 Sep 2021 12:01:58 +0000
2021-09-01 12:01:58 +00:00
||nordichairistanbul.com$all
Filter updated: Fri, 19 Feb 2021 00:06:27 UTC
2021-02-19 00:06:28 +00:00
||noreply-netelle.blogspot.com$all
Filter updated: Thu, 20 May 2021 00:06:43 UTC
2021-05-20 00:06:44 +00:00
||normativa-sicurezza-verifica.app.sicurty-login.com$all
Filter updated: Sat, 11 Sep 2021 00:34:15 +0000
2021-09-11 00:34:15 +00:00
||northernswine.com$all
Filter updated: Thu, 15 Jul 2021 12:01:53 +0000
2021-07-15 12:01:53 +00:00
||norton-ultra.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||nortonknatchbull-my.sharepoint.com/:o:/g/personal/19besoriob_nks_kent_sch_uk/eml51uxw3yblmb_cng_jobkbjiz5a9svhv-aa1dwwc9xqg?e=ufnvrz$all
Filter updated: Wed, 03 Feb 2021 00:06:20 UTC
2021-02-03 00:06:20 +00:00
||norwayposten.blogspot.com/2021/02/blog-post.html$all
Filter updated: Fri, 19 Feb 2021 00:06:27 UTC
2021-02-19 00:06:28 +00:00
||notariagalvez.com$all
Filter updated: Mon, 17 May 2021 12:06:42 UTC
2021-05-17 12:06:43 +00:00
||notendur.hi.is$all
Filter updated: Tue, 21 Sep 2021 00:01:40 +0000
2021-09-21 00:01:40 +00:00
||noticia.link$all
Filter updated: Wed, 21 Jul 2021 12:01:49 +0000
2021-07-21 12:01:49 +00:00
||notificacioneslv.hostfree.pw$all
Filter updated: Sat, 17 Jul 2021 00:01:47 +0000
2021-07-17 00:01:47 +00:00
||notificacionesv.hostfree.pw$all
Filter updated: Sun, 18 Jul 2021 00:02:04 +0000
2021-07-18 00:02:04 +00:00
||notificacionesv3.hostfree.pw$all
Filter updated: Sat, 17 Jul 2021 12:01:37 +0000
2021-07-17 12:01:37 +00:00
||notificacionesv8.hostfree.pw$all
Filter updated: Mon, 12 Apr 2021 00:06:48 UTC
2021-04-12 00:06:48 +00:00
||notification-orange6.yolasite.com$all
Filter updated: Tue, 14 Sep 2021 00:01:48 +0000
2021-09-14 00:01:48 +00:00
||notification-vocale-ecoute.freeweb.pk$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||notifications.google.com/g/p/ad-fnewoykv7bxdxwcwindbnwiagaiska0ktc-amq4ved47kkafwimqdkuxsvsfwoypvkv3sqsjli-gxhi9hynifl7n0cjj1apb3zen_0p9c$all
Filter updated: Tue, 18 May 2021 00:06:34 UTC
2021-05-18 00:06:34 +00:00
||notifyfb-2am3335o6s.tv1space.az$all
||notifyfb-9h4s5ryhgh.tv1space.az$all
||notifyfb-i0mfyejbpj.tv1space.az$all
||notifyfb-j8tjsdr70v.tv1space.az$all
||notifyfb-kryox10249.tv1space.az$all
Filter updated: Tue, 24 Aug 2021 00:02:23 +0000
2021-08-24 00:02:24 +00:00
||nour-ala-nour.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||nozed-uname.firebaseapp.com$all
Filter updated: Sun, 21 Feb 2021 00:06:54 UTC
2021-02-21 00:06:54 +00:00
||nrk.one$all
Filter updated: Sun, 15 Aug 2021 12:01:40 +0000
2021-08-15 12:01:40 +00:00
||ns3pssionntngoal.app.link$all
Filter updated: Mon, 16 Aug 2021 00:01:59 +0000
2021-08-16 00:01:59 +00:00
||nsdbds.tk$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||nueva-acropolis.cl$all
Filter updated: Tue, 24 Aug 2021 12:02:00 +0000
2021-08-24 12:02:00 +00:00
||nuewa-hwa.oracleindustry.com$all
Filter updated: Sun, 18 Jul 2021 00:02:04 +0000
2021-07-18 00:02:04 +00:00
||nuezlincalp.hostkda.com$all
Filter updated: Mon, 29 Mar 2021 12:06:44 UTC
2021-03-29 12:06:44 +00:00
||nullrefer.com/?https://amazon.co.jp$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||nullresimler.com$all
||num63rsgroup.com$all
Filter updated: Tue, 14 Sep 2021 12:01:44 +0000
2021-09-14 12:01:44 +00:00
||num63rsgroup.com/?utm_source=10692-14482240068&utm_medium=gid-126116800509&utm_campaign=aid-542738816296&utm_content=&utm_term=youtube.com&pid=tlpgpp&gclid=cjwkcajw7fujbhbdeiwa2llmydhqv9hf_zfukd7-zegpkqbvmughkjkh6hfvxjrslquczgmsbwh1ibocftyqavd_bwe$all
Filter updated: Wed, 09 Dec 2020 12:06:49 UTC
2020-12-09 12:06:49 +00:00
||nuovesicurezzeonline.com$all
Filter updated: Sun, 29 Aug 2021 12:01:39 +0000
2021-08-29 12:01:39 +00:00
||nuu1.com$all
Filter updated: Fri, 02 Oct 2020 00:06:27 UTC
2020-10-02 00:06:27 +00:00
||nuvuneu.com$all
Filter updated: Wed, 25 Nov 2020 12:06:48 UTC
2020-11-25 12:06:48 +00:00
||nv.snprobbx.pbz.r.de.a2ip.ru$all
Filter updated: Mon, 11 Jan 2021 00:06:06 UTC
2021-01-11 00:06:06 +00:00
||nw-securedfailure.com$all
Filter updated: Sat, 06 Feb 2021 12:06:42 UTC
2021-02-06 12:06:42 +00:00
||nwolb.default.aspx.cookiecheck.refferiddent.aspx.online.cross-press.net$all
||nwolbderegisterdevice-access.com$all
Filter updated: Wed, 06 Jan 2021 00:06:10 UTC
2021-01-06 00:06:10 +00:00
||nwsecure-iproceed-icancel.com$all
Filter updated: Fri, 15 Jan 2021 12:06:30 UTC
2021-01-15 12:06:30 +00:00
||nwsecure-newdevice-iproceed.com$all
Filter updated: Wed, 13 Jan 2021 12:06:45 UTC
2021-01-13 12:06:45 +00:00
||nwsecurity-setdevice-icancel.com$all
Filter updated: Tue, 03 Aug 2021 00:01:58 +0000
2021-08-03 00:01:58 +00:00
||nxmbfhj.tk$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||nyc3.digitaloceanspaces.com/uycvnmmh/ellesamellesamsamsamele.html$all
Filter updated: Mon, 20 Sep 2021 12:02:05 +0000
2021-09-20 12:02:05 +00:00
||nyeline.com$all
Filter updated: Sun, 05 Sep 2021 12:01:36 +0000
2021-09-05 12:01:37 +00:00
||nyhet.cc$all
Filter updated: Thu, 31 Dec 2020 00:06:14 UTC
2020-12-31 00:06:15 +00:00
||o2-authbill-secure.com$all
Filter updated: Tue, 16 Mar 2021 00:07:08 UTC
2021-03-16 00:07:09 +00:00
||o2-failure-billing-update.com$all
Filter updated: Sun, 27 Dec 2020 12:06:31 UTC
2020-12-27 12:06:31 +00:00
||o2-processbilling-update.com$all
Filter updated: Mon, 28 Dec 2020 12:06:19 UTC
2020-12-28 12:06:19 +00:00
||o2-securebilling-update.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||o2-service-account.com$all
Filter updated: Wed, 10 Mar 2021 00:08:04 UTC
2021-03-10 00:08:05 +00:00
||o2-updatebillingvia.com$all
Filter updated: Sun, 14 Mar 2021 00:12:43 UTC
2021-03-14 00:12:43 +00:00
||o2billingauth-update.com$all
Filter updated: Thu, 06 May 2021 12:07:07 UTC
2021-05-06 12:07:07 +00:00
||o365.yourcbsm.work$all
Filter updated: Fri, 30 Jul 2021 00:01:47 +0000
2021-07-30 00:01:47 +00:00
||o365microsoftonline.com$all
Filter updated: Tue, 14 Sep 2021 12:01:44 +0000
2021-09-14 12:01:44 +00:00
||o5cpm.skipdns.link$all
Filter updated: Fri, 30 Apr 2021 12:07:08 UTC
2021-04-30 12:07:09 +00:00
||oa5.a0001.net$all
Filter updated: Wed, 15 Sep 2021 00:01:54 +0000
2021-09-15 00:01:55 +00:00
||oah-nc-secure.ga$all
Filter updated: Thu, 16 Sep 2021 00:01:52 +0000
2021-09-16 00:01:52 +00:00
||oakhamstreeservices.com$all
Filter updated: Mon, 31 May 2021 12:06:30 UTC
2021-05-31 12:06:30 +00:00
||obdvczu.cluster030.hosting.ovh.net$all
Filter updated: Mon, 12 Apr 2021 12:08:04 UTC
2021-04-12 12:08:04 +00:00
||oberpiskoihof.it$all
Filter updated: Thu, 03 Jun 2021 12:06:59 UTC
2021-06-03 12:07:00 +00:00
||obgyn.kku.ac.th$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||observatoriodeourofino.com.br$all
Filter updated: Wed, 22 Sep 2021 12:01:56 +0000
2021-09-22 12:01:56 +00:00
||observesuppoqased.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||ocaque-domen.firebaseapp.com$all
Filter updated: Tue, 23 Mar 2021 12:16:28 UTC
2021-03-23 12:16:28 +00:00
||oceantires.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||oceetee-my.sharepoint.com/:x:/r/personal/oceetee_oceetee_com_sa/_layouts/15/wopiframe.aspx?guestaccesstoken=5t/v57wosh/zuc+ubbpprapdh5daqzjepxbham/9wjy=&docid=1_129efcffef3324628b752d1139515937e&wdformid={0767107a-f265-4239-a58d-79524eada2a7}&action=formsubmit&cid=a79ba94e-e9be-4a5f-ba1d-20a889580d1b$all
Filter updated: Tue, 01 Jun 2021 00:06:26 UTC
2021-06-01 00:06:26 +00:00
||of7dh0jxy4s.typeform.com$all
Filter updated: Tue, 15 Jun 2021 00:06:35 UTC
2021-06-15 00:06:35 +00:00
||ofertasonlinebiggs.com$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||offic3887688.sitebuilder.name.tools$all
Filter updated: Fri, 27 Aug 2021 00:01:47 +0000
2021-08-27 00:01:47 +00:00
||office-updateinfo.net$all
Filter updated: Wed, 22 Sep 2021 12:01:56 +0000
2021-09-22 12:01:56 +00:00
||office365.apps.maxsolutions.com.au$all
Filter updated: Tue, 19 Jan 2021 12:07:14 UTC
2021-01-19 12:07:14 +00:00
||officeee.bubbleapps.io$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||officehomeprodprv.westus.cloudapp.azure.com$all
||officence.com$all
Filter updated: Fri, 26 Mar 2021 00:06:40 UTC
2021-03-26 00:06:40 +00:00
||officialevent.way.live$all
Filter updated: Thu, 19 Aug 2021 12:02:33 +0000
2021-08-19 12:02:33 +00:00
||officialliker.co$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||officialmabar.duckdns.org$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||officialparaboy.com$all
||offnft.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||ogz6d.codesandbox.io$all
Filter updated: Thu, 03 Jun 2021 00:06:28 UTC
2021-06-03 00:06:28 +00:00
||oh-unemployment-ohio-gov.com$all
Filter updated: Wed, 07 Jul 2021 00:01:56 +0000
2021-07-07 00:01:57 +00:00
||oi58904x.yolasite.com$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||oillamp.zikiso.jp$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||ojnw.app.link$all
||ojs.budimulia.ac.id$all
Filter updated: Thu, 02 Sep 2021 00:01:59 +0000
2021-09-02 00:01:59 +00:00
||okankaracan.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||oki.ilmci.com$all
Filter updated: Fri, 25 Jun 2021 00:06:14 +0000
2021-06-25 00:06:14 +00:00
||okwok.co.kr$all
Filter updated: Mon, 13 Sep 2021 12:01:52 +0000
2021-09-13 12:01:52 +00:00
||old.prunescape.com.au$all
Filter updated: Thu, 16 Sep 2021 12:02:15 +0000
2021-09-16 12:02:15 +00:00
||oldps1.com$all
Filter updated: Tue, 19 Jan 2021 00:06:28 UTC
2021-01-19 00:06:28 +00:00
||oldschool-runescape-bondrewards.com$all
Filter updated: Thu, 03 Dec 2020 12:07:06 UTC
2020-12-03 12:07:06 +00:00
||olidooo.waca.tw$all
Filter updated: Wed, 08 Sep 2021 12:01:51 +0000
2021-09-08 12:01:51 +00:00
||olittbakeryv2-71.olitt.net$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||olivergency-ukk.ga$all
Filter updated: Thu, 22 Apr 2021 00:06:42 UTC
2021-04-22 00:06:42 +00:00
||olx-casa.com$all
Filter updated: Mon, 26 Apr 2021 12:07:30 UTC
2021-04-26 12:07:30 +00:00
||olx-group.com$all
Filter updated: Wed, 22 Sep 2021 12:01:56 +0000
2021-09-22 12:01:56 +00:00
||olx-order.pl-id50073848.xyz$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||olx-order.pl-id67594295.xyz$all
||olx-order.pl-id97118124.xyz$all
||olx-order.pl-id98463553.xyz$all
Filter updated: Wed, 17 Feb 2021 12:06:49 UTC
2021-02-17 12:06:49 +00:00
||olx-pl-konto-ref.com$all
Filter updated: Mon, 20 Sep 2021 12:02:05 +0000
2021-09-20 12:02:05 +00:00
||olx-pl.fes-pay.info$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||olx.pl-id423678123.net$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||olx.pl-id97118124.xyz$all
Filter updated: Wed, 22 Sep 2021 00:02:26 +0000
2021-09-22 00:02:26 +00:00
||olx.pl-paymentsget.xyz$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||olx.pl-securepay-invoice.xyz$all
Filter updated: Wed, 22 Sep 2021 00:02:26 +0000
2021-09-22 00:02:26 +00:00
||olx.pl.express-shop.org$all
Filter updated: Wed, 22 Sep 2021 12:01:56 +0000
2021-09-22 12:01:56 +00:00
||olx.pl.getmoney.xyz$all
||olx.pl.safedeal-click.info$all
Filter updated: Tue, 22 Dec 2020 12:06:42 UTC
2020-12-22 12:06:42 +00:00
||olx.rwpay.ru$all
Filter updated: Mon, 22 Mar 2021 12:06:55 UTC
2021-03-22 12:06:55 +00:00
||omesqiwines.de$all
Filter updated: Fri, 10 Sep 2021 00:02:17 +0000
2021-09-10 00:02:17 +00:00
||omshad-links.com$all
Filter updated: Thu, 05 Aug 2021 12:01:57 +0000
2021-08-05 12:01:57 +00:00
||on-linecaso326.ultimatefreehost.in$all
||on-linecaso3298.ultimatefreehost.in$all
Filter updated: Thu, 03 Sep 2020 12:06:37 UTC
2020-09-03 12:06:37 +00:00
||on-me-ro.firebaseapp.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||oncopharma-ae.com$all
Filter updated: Thu, 05 Aug 2021 12:01:57 +0000
2021-08-05 12:01:57 +00:00
||one.app-aktualisieren.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||oneaim.lu$all
Filter updated: Thu, 03 Dec 2020 12:07:06 UTC
2020-12-03 12:07:06 +00:00
||onecreator.info$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||onedrive.live.com/?authkey=!aiuszyywonlw6wq&cid=5a1faf0110c4a22c&id=5a1faf0110c4a22c!1550&parid=root&o=oneup$all
||onedrive.live.com/?authkey=!aiwjcwhmidrycfe&cid=6ff30ec047bf7f90&id=6ff30ec047bf7f90!1118&parid=root&o=oneup$all
||onedrive.live.com/?authkey=%21abdtnonrfuimmte&cid=8b06262ca3def289&id=8b06262ca3def289%21106&parid=root&o=oneup$all
Filter updated: Tue, 10 Aug 2021 12:02:08 +0000
2021-08-10 12:02:08 +00:00
||onedrive.live.com/?authkey=%21aef%2dmh1m1dxpwfq&cid=62e43ed1e02faa46&id=62e43ed1e02faa46%2145901&parid=62e43ed1e02faa46%218744&o=oneup$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||onedrive.live.com/?authkey=%21ag7v3k%5fv%5fvmx0wu&cid=2022b4d58b052264&id=2022b4d58b052264%21709&parid=root&o=oneup$all
||onedrive.live.com/?authkey=%21ahm9ud6tremilmy&cid=d3acf7db10258474&id=d3acf7db10258474%21118&parid=root&o=oneup$all
Filter updated: Thu, 15 Apr 2021 12:07:36 UTC
2021-04-15 12:07:36 +00:00
||onedrive.live.com/download?cid=14f03cc1e6238baf&resid=14f03cc1e6238baf%21109&authkey=ahztenuziu71bkw$all
Filter updated: Tue, 20 Jul 2021 12:01:48 +0000
2021-07-20 12:01:48 +00:00
||onedrive.live.com/download?cid=d91517ba717d8f93&resid=d91517ba717d8f93%21106&authkey=aad0mocflqj2d7g$all
Filter updated: Mon, 31 May 2021 12:06:30 UTC
2021-05-31 12:06:30 +00:00
||onedrive.live.com/embed?cid=8c6ac597cdb8f3ca&resid=8c6ac597cdb8f3ca%216662&authkey=abbvyhcqvxnyk7a&em=2$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||onedrive.live.com/redir?resid=15d888f2c88e7d68%21104&authkey=%21alapi82fus8uhw8&page=view&wd=target%28martco.one%7c248982a3-c6db-4608-9b3f-59d46f4a8f11%2fdan%20shared%20a%20file%20with%20you%7c85b5e37c-8918-4d14-b5a0-0742bfe487b0%2f%29$all
||onedrive.live.com/redir?resid=1b259cec1257165d%21143&authkey=%21apkdm5ellcpwz_w&page=view&wd=target%28quick%20notes.one%7c70d4ff33-5389-4385-b3e5-751c2cf1989e%2frau%20construction%7c961392e9-1ab5-4334-9d52-69d0f17f7c4c%2f%29$all
||onedrive.live.com/redir?resid=7aa7bb4172c9678d%21104&authkey=%21ancnqdf2mi0o4bs&page=view&wd=target%28untitled%20section.one%7c78a1f9ff-7561-4169-a2f1-2b4bfce0e5d2%2fbusiness%20insurance%20services%2c%20inc.%7cb909bc92-cd18-491c-afbb-8e0537ffd3ed%2f%29$all
||onedrive.live.com/redir?resid=85c38ec07aa8c9eb%21104&authkey=%21akfbbhbpqjalrag&page=edit&wd=target%28king%20plastic%20corporation.one%7c74227ab3-5b67-4fed-aee8-c6ec5625e330%2fmichael%20fabbri%20has%20shared%20a%20file%20with%20you%7c5ea49da5-4656-4a44-a813-5b186327c32f%2f%29$all
||onedrive.live.com/redir?resid=a37258a5832f32b8%214551&authkey=%21ah-prmdnyc6z-he&page=view&wd=target%28quick%20notes.one%7c4617bc2b-8a69-4e83-9b28-fdc3f0e092a4%2freview%20document%20no.%20clt9071825%7ca63f7492-3a53-4740-8ff8-743d2bf58dd0%2f%29$all
||onedrive.live.com/redir?resid=cc542b30a231222a%21104&authkey=%21aagyx6eylxtvs0i&page=view&wd=target%28southwest%20funding.one%7cdb02ff26-a000-4a11-a770-a766574c7395%2feric%20barefoot%c2%a0has%20shared%20a%20file%20with%20you%7cbbd45792-c84c-4ac7-b2f5-1368247a21f4%2f%29$all
||onedrive.live.com/redir?resid=f224e40f244f69d%213603&authkey=%21aa0etofrovbzrds&page=view&wd=target%28quick%20notes.one%7cef3efdee-f2ab-465b-af63-7c751f8ee737%2feddie%20winfrey%20has%20shared%20a%20document%20with%20you%7c2c2aaad0-b64f-4424-9eed-b8e299fa1177%2f%29$all
||onedrive.live.com/redir?resid=f950f8718f3413f!139&authkey=!abm4jclf3vh4_ea&ithint=file%2cxlsx&page=survey&wdformid=8786a7d4-f24e-494d-a981-ec4d7be22b99$all
||onedrive.live.com/view.aspx?resid=165bfee39105d588!1450&wdo=2&authkey=!ahdxqiyo1wxtypa$all
||onedrive.live.com/view.aspx?resid=2ccda0f55e51c04d!1056&authkey=!ahvxdmahsk9xqic$all
||onedrive.live.com/view.aspx?resid=357cf596b048e521!68171&ithint=onenote%2c&authkey=!agrjg_pgegj6peq$all
Filter updated: Tue, 07 Sep 2021 12:01:49 +0000
2021-09-07 12:01:49 +00:00
||onedrive.live.com/view.aspx?resid=63d34a02fb9cbdc0!830&ithint=onenote%2c&wdo=2&authkey=!agdcipgpa9o5uw8$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||onedrive.live.com/view.aspx?resid=b116b3793040630b!5852&ithint=onenote%2c&authkey=!altmjf-4bzb1ygu$all
Filter updated: Fri, 27 Aug 2021 12:01:40 +0000
2021-08-27 12:01:40 +00:00
||onedrive.live.com/view.aspx?resid=b730f58852aff932!139&ithint=onenote%2c&wdo=2&authkey=!aul7udqhfptgafm$all
Filter updated: Thu, 09 Sep 2021 00:01:56 +0000
2021-09-09 00:01:56 +00:00
||onee-a0488.web.app$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||onemedic.com.mx$all
Filter updated: Sun, 12 Sep 2021 00:02:13 +0000
2021-09-12 00:02:13 +00:00
||oneone-19cd8.web.app$all
Filter updated: Tue, 31 Aug 2021 12:01:54 +0000
2021-08-31 12:01:54 +00:00
||oneone-a38ef.web.app$all
Filter updated: Tue, 27 Jul 2021 00:02:10 +0000
2021-07-27 00:02:10 +00:00
||onet-swietokrzyskie.xyz$all
Filter updated: Tue, 10 Aug 2021 12:02:08 +0000
2021-08-10 12:02:08 +00:00
||online-auth-doc-trippumbach.cf$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||online-citizens.serveftp.com$all
Filter updated: Thu, 19 Aug 2021 12:02:33 +0000
2021-08-19 12:02:33 +00:00
||online-doc-madisonpointecc.cf$all
Filter updated: Mon, 06 Sep 2021 00:01:54 +0000
2021-09-06 00:01:54 +00:00
||online.firstfinan.com$all
Filter updated: Fri, 18 Dec 2020 00:06:14 UTC
2020-12-18 00:06:14 +00:00
||online.natwest-personal.com$all
Filter updated: Sat, 06 Feb 2021 12:06:42 UTC
2021-02-06 12:06:42 +00:00
||online.natwest-supportcentre.com$all
Filter updated: Fri, 05 Feb 2021 00:06:10 UTC
2021-02-05 00:06:10 +00:00
||online.natwest-welfare.com$all
Filter updated: Tue, 17 Aug 2021 12:01:39 +0000
2021-08-17 12:01:39 +00:00
||online.visual-paradigm.com/app/forms/view/dssmibyk/789c19c6-58f7-4a39-8cf3-62e4f13c605a$all
||online.visual-paradigm.com/app/forms/view/dxhotnbj/aad0ff1e-c90d-487c-a28d-f07b0d303e5c$all
||online.visual-paradigm.com/app/forms/view/jqliidcl/29c78a95-ff7d-42a0-9cef-43118693b879$all
||online.visual-paradigm.com/app/forms/view/lvswydoz/f4123832-7b09-4ac6-bbfc-9fde28e728c4$all
||online.visual-paradigm.com/app/forms/view/zalxyved/a9adea36-d163-4d46-a3de-0e990d86e78e$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||online2banking.byethost6.com$all
Filter updated: Mon, 20 Sep 2021 12:02:05 +0000
2021-09-20 12:02:05 +00:00
||onlinebneutuedwybjrgwrezyqqvhatcvbuubebnonline.66ghz.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||onlinehalifax-account.com/halifax$all
||onlinehalifax-account.com/halifax/login.php$all
Filter updated: Thu, 07 Jan 2021 00:06:17 UTC
2021-01-07 00:06:17 +00:00
||onlinepayee-restricted-service.com$all
Filter updated: Fri, 18 Jun 2021 00:06:41 +0000
2021-06-18 00:06:41 +00:00
||onlineprint.cufapparel.cf$all
Filter updated: Sat, 14 Aug 2021 00:01:49 +0000
2021-08-14 00:01:49 +00:00
||onlinepromerica.ultimatefreehost.in$all
Filter updated: Sun, 18 Jul 2021 00:02:04 +0000
2021-07-18 00:02:04 +00:00
||onlinepromerica5.byethost8.com$all
Filter updated: Fri, 16 Jul 2021 00:01:53 +0000
2021-07-16 00:01:53 +00:00
||onlinepromericac.byethost3.com$all
Filter updated: Thu, 15 Jul 2021 00:02:02 +0000
2021-07-15 00:02:03 +00:00
||onlinepromericas.byethost7.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||onlinepubg.com$all
Filter updated: Tue, 15 Jun 2021 00:06:35 UTC
2021-06-15 00:06:35 +00:00
||onlineremanager.com$all
Filter updated: Fri, 12 Feb 2021 00:06:27 UTC
2021-02-12 00:06:27 +00:00
||onlineroisupportupdate.com$all
Filter updated: Fri, 20 Aug 2021 12:01:48 +0000
2021-08-20 12:01:48 +00:00
||onlinesbi.online$all
Filter updated: Tue, 01 Jun 2021 00:06:26 UTC
2021-06-01 00:06:26 +00:00
||onlineserveroffice365.mfs.gg$all
Filter updated: Sun, 19 Sep 2021 12:01:34 +0000
2021-09-19 12:01:35 +00:00
||onlineservicefree.club$all
Filter updated: Sun, 08 Aug 2021 00:02:06 +0000
2021-08-08 00:02:06 +00:00
||onlineservicetec.com$all
Filter updated: Wed, 25 Aug 2021 00:01:57 +0000
2021-08-25 00:01:57 +00:00
||onlineservicetech.website$all
Filter updated: Thu, 15 Jul 2021 00:02:02 +0000
2021-07-15 00:02:03 +00:00
||onlinpromerica2.byethost11.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||ons-hence-anderson-reducing.trycloudflare.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||onsparks-dab.blogspot.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||ooxvocalor.yolasite.com$all
Filter updated: Mon, 20 Sep 2021 12:02:05 +0000
2021-09-20 12:02:05 +00:00
||opallds.com$all
Filter updated: Tue, 21 Sep 2021 12:02:11 +0000
2021-09-21 12:02:11 +00:00
||opened.bosshomestead.work$all
Filter updated: Sat, 10 Jul 2021 00:01:42 +0000
2021-07-10 00:01:42 +00:00
||openmessageriespacemms.ukit.me$all
Filter updated: Fri, 28 May 2021 12:06:27 UTC
2021-05-28 12:06:27 +00:00
||opentorue.byethost7.com$all
Filter updated: Thu, 21 Jan 2021 12:06:44 UTC
2021-01-21 12:06:44 +00:00
||operacionmultired1bn-web.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||opfgmdm.creatorlink.net$all
Filter updated: Tue, 17 Nov 2020 00:06:23 UTC
2020-11-17 00:06:23 +00:00
||opjkk.creatorlink.net$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||opsidposqidpoqsidpoiqspodiqsopdipqsd.blogspot.com$all
Filter updated: Wed, 21 Apr 2021 00:07:05 UTC
2021-04-21 00:07:05 +00:00
||optika-anda.hr$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||optus-au.blogspot.com$all
||optus-com-au.blogspot.com$all
||optusnet-com.blogspot.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||optusnet-com.blogspot.com/?m=1$all
Filter updated: Thu, 03 Sep 2020 12:06:37 UTC
2020-09-03 12:06:37 +00:00
||ora-n.yolasite.com$all
Filter updated: Tue, 13 Apr 2021 00:06:31 UTC
2021-04-13 00:06:31 +00:00
||orabu.it$all
Filter updated: Tue, 13 Apr 2021 12:07:03 UTC
2021-04-13 12:07:03 +00:00
||oraclemart.com/ondedrive/onedrive/rolex/index.php$all
Filter updated: Wed, 08 Sep 2021 12:01:51 +0000
2021-09-08 12:01:51 +00:00
||oralcamp.com.br$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||orange-covid20.yolasite.com$all
Filter updated: Thu, 24 Dec 2020 12:06:14 UTC
2020-12-24 12:06:14 +00:00
||orange-dcr.fr$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||orange-messagepro546.moonfruit.com$all
Filter updated: Thu, 05 Aug 2021 00:02:05 +0000
2021-08-05 00:02:05 +00:00
||orange-mobile16.wixsite.com$all
Filter updated: Wed, 27 Jan 2021 12:06:59 UTC
2021-01-27 12:06:59 +00:00
||orange-offre.mobile-forfait.client.travelforever.co.uk$all
Filter updated: Fri, 23 Apr 2021 00:06:35 UTC
2021-04-23 00:06:35 +00:00
||orange-rdv-mvp.ayaline.com$all
Filter updated: Sat, 01 May 2021 00:08:55 UTC
2021-05-01 00:08:55 +00:00
||orange-rdv.ayaline.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||orange-s-school.thinkific.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||orange-security.cloud.coreoz.com$all
Filter updated: Sat, 20 Mar 2021 00:06:31 UTC
2021-03-20 00:06:31 +00:00
||orange.iobeya.com$all
Filter updated: Fri, 09 Apr 2021 00:06:41 UTC
2021-04-09 00:06:41 +00:00
||orange624.yolasite.com$all
Filter updated: Tue, 31 Aug 2021 00:01:55 +0000
2021-08-31 00:01:55 +00:00
||orangeconnectweb.contactin.bio$all
Filter updated: Wed, 24 Mar 2021 12:06:42 UTC
2021-03-24 12:06:42 +00:00
||orangemessagerie.icon.io$all
Filter updated: Wed, 14 Jul 2021 00:03:28 +0000
2021-07-14 00:03:28 +00:00
||orangemiseajour.hostfree.pw$all
Filter updated: Thu, 13 May 2021 12:06:27 UTC
2021-05-13 12:06:28 +00:00
||orangevalechamber.com$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||oranj.moonfruit.com$all
Filter updated: Wed, 15 Sep 2021 12:01:46 +0000
2021-09-15 12:01:46 +00:00
||orbitcluster.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||orcapm.com$all
Filter updated: Wed, 02 Jun 2021 12:06:27 UTC
2021-06-02 12:06:28 +00:00
||ordenesticccc.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||org-nr.yolasite.com$all
Filter updated: Thu, 20 May 2021 00:06:43 UTC
2021-05-20 00:06:44 +00:00
||organicreviews.net$all
Filter updated: Thu, 13 May 2021 00:06:46 UTC
2021-05-13 00:06:46 +00:00
||originalcomics.fr$all
Filter updated: Wed, 15 Sep 2021 00:01:54 +0000
2021-09-15 00:01:55 +00:00
||originalfilm.se$all
Filter updated: Wed, 28 Jul 2021 12:01:46 +0000
2021-07-28 12:01:46 +00:00
||orjziutttbosibcbqoywzjfhnt-dot-gowa11111111.rj.r.appspot.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||orlandoareavacations.orlandoareavacation.com$all
Filter updated: Tue, 17 Aug 2021 12:01:39 +0000
2021-08-17 12:01:39 +00:00
||orlen.hotchili.pl$all
Filter updated: Thu, 29 Jul 2021 00:01:57 +0000
2021-07-29 00:01:57 +00:00
||orlenn.libracoinofficial-company.xyz$all
Filter updated: Tue, 08 Jun 2021 12:06:44 UTC
2021-06-08 12:06:44 +00:00
||orlenoil-la.com$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||orlensbkpl.com$all
Filter updated: Fri, 17 Sep 2021 12:01:51 +0000
2021-09-17 12:01:52 +00:00
||ornozam.co.jp.s4jrl6.cn$all
Filter updated: Thu, 15 Apr 2021 12:07:36 UTC
2021-04-15 12:07:36 +00:00
||orquestaloshispanos.com$all
Filter updated: Thu, 19 Aug 2021 12:02:33 +0000
2021-08-19 12:02:33 +00:00
||orsted-refund.blogspot.com/2021/08/rsted.html$all
Filter updated: Fri, 06 Aug 2021 00:01:52 +0000
2021-08-06 00:01:52 +00:00
||ortonder.freecluster.eu$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||oshkarashoro.000webhostapp.com$all
Filter updated: Wed, 07 Oct 2020 00:06:26 UTC
2020-10-07 00:06:27 +00:00
||osmaslo.ru$all
Filter updated: Tue, 07 Sep 2021 00:01:46 +0000
2021-09-07 00:01:46 +00:00
||ostrichmemory.top$all
Filter updated: Fri, 19 Feb 2021 00:06:27 UTC
2021-02-19 00:06:28 +00:00
||osun.cz$all
Filter updated: Wed, 15 Sep 2021 12:01:46 +0000
2021-09-15 12:01:46 +00:00
||ot-directory.com$all
Filter updated: Sat, 28 Aug 2021 00:33:51 +0000
2021-08-28 00:33:51 +00:00
||otherfinal.top$all
Filter updated: Sat, 07 Nov 2020 00:06:40 UTC
2020-11-07 00:06:40 +00:00
||otomoto-h229.net$all
Filter updated: Fri, 12 Feb 2021 00:06:27 UTC
2021-02-12 00:06:27 +00:00
||otomoto-konto54875424.eu$all
Filter updated: Fri, 04 Dec 2020 00:06:15 UTC
2020-12-04 00:06:16 +00:00
||otomoto3452.com$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||otvbhu.top/py6x3b8n/dbs-wa/$all
Filter updated: Wed, 15 Sep 2021 12:01:46 +0000
2021-09-15 12:01:46 +00:00
||ouniswap.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||ouraring-my.sharepoint.com/personal/tanja_kuusela_ouraring_com/_layouts/15/doc.aspx?sourcedoc$all
||ouraring-my.sharepoint.com/personal/tanja_kuusela_ouraring_com/_layouts/15/doc.aspx?sourcedoc={6dfd36f7-86e9-46d3-b9cc-33ba7e8a7540}&action=default&slrid=4a49409f-2030-2000-55c3-0f6b60771e27&originalpath=ahr0chm6ly9vdxjhcmluzy1tes5zagfyzxbvaw50lmnvbs86bzovcc90yw5qyv9rdxvzzwxhl0v2yzjfvznwahror3vjd3p1bjzlzfvbqm9nd1yxegftx05ly3h6ekxkbvhruue_cnrpbwu9ylp0ujd2tewxmgc&cid=18ed1537-8fab-4a88-9a51-f62af2ba3e85$all
||ouraring-my.sharepoint.com/personal/tanja_kuusela_ouraring_com/_layouts/15/doc.aspx?sourcedoc={6dfd36f7-86e9-46d3-b9cc-33ba7e8a7540}&action=default&slrid=7448409f-907f-2000-55b9-8b3856a492d0&originalpath=ahr0chm6ly9vdxjhcmluzy1tes5zagfyzxbvaw50lmnvbs86bzovcc90yw5qyv9rdxvzzwxhl0v2yzjfvznwahror3vjd3p1bjzlzfvbqm9nd1yxegftx05ly3h6ekxkbvhruue_cnrpbwu9bjdxazvqrewxmgc&cid=17aea50f-0cad-4a24-8ca6-2b3aba94e944$all
||ouraring-my.sharepoint.com/personal/tanja_kuusela_ouraring_com/_layouts/15/doc.aspx?sourcedoc={6dfd36f7-86e9-46d3-b9cc-33ba7e8a7540}&action=default&slrid=e3083d9f-70d3-2000-e93a-b2a109d8122f&originalpath=ahr0chm6ly9vdxjhcmluzy1tes5zagfyzxbvaw50lmnvbs86bzovcc90yw5qyv9rdxvzzwxhl0v2yzjfvznwahror3vjd3p1bjzlzfvbqm9nd1yxegftx05ly3h6ekxkbvhruue_cnrpbwu9mnjsznrbteuxmgc&cid=ce3f6183-644d-4c2c-b9c5-e59d8ec48d03$all
||ouraring-my.sharepoint.com/personal/tanja_kuusela_ouraring_com/_layouts/15/doc.aspx?sourcedoc={6dfd36f7-86e9-46d3-b9cc-33ba7e8a7540}&action=default&slrid=e5083d9f-a047-2000-523d-f23a7ab7042b&originalpath=ahr0chm6ly9vdxjhcmluzy1tes5zagfyzxbvaw50lmnvbs86bzovcc90yw5qyv9rdxvzzwxhl0v2yzjfvznwahror3vjd3p1bjzlzfvbqm9nd1yxegftx05ly3h6ekxkbvhruue_cnrpbwu9tvlqc3r3teuxmgc&cid=06a207b4-652a-4300-9385-5d89a890e4fe$all
Filter updated: Wed, 31 Mar 2021 00:06:46 UTC
2021-03-31 00:06:46 +00:00
||ourlovmess.wordpress.com$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||ousumi.co-jp.rjkaksnid.co$all
Filter updated: Thu, 03 Sep 2020 12:06:37 UTC
2020-09-03 12:06:37 +00:00
||outlook-mailer.com$all
Filter updated: Tue, 07 Sep 2021 00:01:46 +0000
2021-09-07 00:01:46 +00:00
||outlook-microsoftlogin98uqwuuw8as.questionpro.com$all
Filter updated: Tue, 31 Aug 2021 00:01:55 +0000
2021-08-31 00:01:55 +00:00
||outlook.b-cdn.net$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||outlook.lmkt.com/owa/auth/logon.aspx?url=https://outlook.lmkt.com/owa&reason=0$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||outlook12861.activehosted.com$all
Filter updated: Sat, 03 Oct 2020 00:06:51 UTC
2020-10-03 00:06:51 +00:00
||outlook1541489.webcindario.com$all
Filter updated: Sat, 01 May 2021 12:06:37 UTC
2021-05-01 12:06:37 +00:00
||outlookcom119.yolasite.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||outlookcom168.yolasite.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||outlookhelpdesk.activehosted.com$all
Filter updated: Wed, 22 Sep 2021 00:02:26 +0000
2021-09-22 00:02:26 +00:00
||outlookmsnhotmail.weebly.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||outravantagem.com$all
Filter updated: Fri, 24 Sep 2021 00:01:50 +0000
2021-09-24 00:01:51 +00:00
||ouverturecompte.lbp-eer-int.fr$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||ov74x.codesandbox.io$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||ow.ly/lcqx30cdfcg$all
Filter updated: Mon, 20 Sep 2021 00:01:41 +0000
2021-09-20 00:01:41 +00:00
||ow.yestojudge.cn$all
Filter updated: Thu, 29 Jul 2021 00:01:57 +0000
2021-07-29 00:01:57 +00:00
||owaauthmail.sitey.me$all
Filter updated: Sat, 31 Jul 2021 12:01:55 +0000
2021-07-31 12:01:55 +00:00
||owablu84349439434.web.app$all
Filter updated: Sat, 06 Feb 2021 00:06:52 UTC
2021-02-06 00:06:53 +00:00
||owambewww.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||owaupgradeservice3.myfreesites.net$all
Filter updated: Tue, 15 Jun 2021 00:06:35 UTC
2021-06-15 00:06:35 +00:00
||ozxl0q.webwave.dev$all
Filter updated: Thu, 03 Sep 2020 12:06:37 UTC
2020-09-03 12:06:37 +00:00
||p.wpage.cc$all
Filter updated: Thu, 10 Jun 2021 00:06:48 UTC
2021-06-10 00:06:48 +00:00
||p1.pagewiz.net$all
Filter updated: Thu, 15 Apr 2021 00:06:48 UTC
2021-04-15 00:06:48 +00:00
||p1c.servleboncoinser.com$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||p1ch14nga.byethost6.com$all
Filter updated: Fri, 10 Sep 2021 12:02:02 +0000
2021-09-10 12:02:02 +00:00
||p3i.lp3.ulm.ac.id$all
Filter updated: Tue, 29 Jun 2021 00:01:48 +0000
2021-06-29 00:01:48 +00:00
||p402s.codesandbox.io$all
Filter updated: Wed, 07 Apr 2021 12:23:11 UTC
2021-04-07 12:23:12 +00:00
||p84ig.csb.app$all
Filter updated: Mon, 15 Mar 2021 12:43:24 UTC
2021-03-15 12:43:24 +00:00
||paavos.in$all
Filter updated: Sat, 10 Jul 2021 00:01:42 +0000
2021-07-10 00:01:42 +00:00
||packlevovd.byethost32.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||padlet-uploads.storage.googleapis.com/610964646/d0a82b340ac6b4eb2fed334399fe2e84/palad.html$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||page-active004.000webhostapp.com$all
Filter updated: Thu, 23 Sep 2021 00:02:18 +0000
2021-09-23 00:02:18 +00:00
||page-appeal-unpublish1253631.web.app$all
Filter updated: Mon, 22 Mar 2021 12:06:55 UTC
2021-03-22 12:06:55 +00:00
||page-dashboard-option-2021.my.id$all
||page-dashboard-option.my.id$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||page-revertion.000webhostapp.com$all
Filter updated: Sun, 30 May 2021 00:06:24 UTC
2021-05-30 00:06:25 +00:00
||page-updates-and-protection.web.id$all
Filter updated: Sat, 12 Jun 2021 00:25:37 UTC
2021-06-12 00:25:37 +00:00
||pages-and-community-service.pp.ua$all
Filter updated: Fri, 07 May 2021 12:12:56 UTC
2021-05-07 12:12:56 +00:00
||pages-help-center-2021.my.id$all
Filter updated: Sat, 04 Sep 2021 12:01:40 +0000
2021-09-04 12:01:40 +00:00
||pageshelpandsupportcenter.co.vu$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||pageshelpincserfivetypages.co.vu$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||pageshelpincserfivetyuasssss.co.vu$all
||pagesldentitypollcylssue.co.vu$all
Filter updated: Thu, 08 Jul 2021 12:02:13 +0000
2021-07-08 12:02:14 +00:00
||pagespolicycenter-0000053926367388.support$all
Filter updated: Wed, 03 Feb 2021 00:06:20 UTC
2021-02-03 00:06:20 +00:00
||pagincolm.com$all
Filter updated: Fri, 10 Sep 2021 00:02:17 +0000
2021-09-10 00:02:17 +00:00
||pahav.ae$all
Filter updated: Wed, 28 Jul 2021 12:01:46 +0000
2021-07-28 12:01:46 +00:00
||paiement-leboncoin-fr.com$all
Filter updated: Wed, 18 Aug 2021 00:01:50 +0000
2021-08-18 00:01:50 +00:00
||paiementsecuriser-portefeuille-leboncoin.com$all
Filter updated: Wed, 02 Jun 2021 00:06:23 UTC
2021-06-02 00:06:23 +00:00
||paincurephysio.com$all
Filter updated: Wed, 22 Sep 2021 12:01:56 +0000
2021-09-22 12:01:56 +00:00
||pakkeleifreung.wpengine.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||pancaikeswap-finance.com$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||pancakaswap.cam$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||pancakaswap.financial$all
Filter updated: Thu, 22 Jul 2021 00:01:54 +0000
2021-07-22 00:01:54 +00:00
||pancakesswapfinance.com$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||pancakesswapfinance.net$all
Filter updated: Mon, 20 Sep 2021 12:02:05 +0000
2021-09-20 12:02:05 +00:00
||pancakeswaip.finance$all
Filter updated: Sat, 11 Sep 2021 12:01:27 +0000
2021-09-11 12:01:27 +00:00
||pancakeswap.betav2.com$all
Filter updated: Sun, 19 Sep 2021 00:02:16 +0000
2021-09-19 00:02:17 +00:00
||pancakeswap.finance-reserve.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||pancakeswap.finance-syrup-pools.site$all
||pancakeswap.finances.alloneservices.com$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||pancakeswap.finances.amplifydynamics.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||pancakeswap.finances.andereggmedia.com$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||pancakeswap.finances.andrewollick.com$all
||pancakeswap.finances.aplansx1688.com$all
Filter updated: Thu, 23 Sep 2021 00:02:18 +0000
2021-09-23 00:02:18 +00:00
||pancakeswap.finances.baylysimmo.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||pancakeswap.finances.bonus110aroma.com$all
||pancakeswap.finances.bookdiffer.com$all
||pancakeswap.finances.bshelen.com$all
Filter updated: Thu, 23 Sep 2021 00:02:18 +0000
2021-09-23 00:02:18 +00:00
||pancakeswap.finances.clckb.com$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||pancakeswap.finances.engravedsticks.com$all
||pancakeswap.finances.ewhiterealestate.com$all
||pancakeswap.finances.expeditiouslystore.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||pancakeswap.finances.expertfatburner.com$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||pancakeswap.finances.exponentialsteps.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||pancakeswap.finances.fandomconcerts.com$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||pancakeswap.finances.mysticplug.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||pancakeswap.finances.mysunnycorner.com$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||pancakeswap.finances.mytemari.com$all
||pancakeswap.finances.mythicalmerch.com$all
||pancakeswap.finances.mythikoutdoors.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||pancakeswap.finances.mythostherapy.com$all
||pancakeswap.finances.naledijackson.com$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||pancakeswap.finances.netsoftportal.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||pancakeswap.finances.newsfourindiana.com$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||pancakeswap.finances.olifund.com$all
||pancakeswap.finances.outdoorreturn.com$all
||pancakeswap.finances.outletconnector.com$all
||pancakeswap.finances.pandocompany.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||pancakeswap.finances.panglobalforex.com$all
||pancakeswap.finances.timetotale.com$all
||pancakeswap.finances.trackercards.com$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||pancakeswap.finances.travelareo.com$all
||pancakeswap.finances.trendette.com$all
||pancakeswap.finances.trichomecapital.com$all
||pancakeswap.finances.truckrepairsalbuquerque.com$all
||pancakeswap.finances.truthtubeuncensored.com$all
Filter updated: Tue, 07 Sep 2021 12:01:49 +0000
2021-09-07 12:01:49 +00:00
||pancakeswap.win96.io$all
Filter updated: Wed, 22 Sep 2021 00:02:26 +0000
2021-09-22 00:02:26 +00:00
||pancakeswapp.su$all
Filter updated: Mon, 20 Sep 2021 12:02:05 +0000
2021-09-20 12:02:05 +00:00
||pancakeswaps-finances.com$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||pancakeswaps.info$all
Filter updated: Wed, 08 Sep 2021 12:01:51 +0000
2021-09-08 12:01:51 +00:00
||pancakeswop.com$all
Filter updated: Sat, 18 Sep 2021 00:14:48 +0000
2021-09-18 00:14:48 +00:00
||pandaskin.ru.com$all
Filter updated: Tue, 19 Jan 2021 00:06:28 UTC
2021-01-19 00:06:28 +00:00
||panelweb-4cae2.web.app$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||pantekkau.duckdns.org$all
Filter updated: Sun, 19 Sep 2021 00:02:16 +0000
2021-09-19 00:02:17 +00:00
||panterpro.com$all
Filter updated: Sat, 11 Sep 2021 12:01:27 +0000
2021-09-11 12:01:27 +00:00
||parcel-tracking-235xl845236235234x.ru$all
Filter updated: Sun, 19 Sep 2021 00:02:16 +0000
2021-09-19 00:02:17 +00:00
||pardot.assemblecommunities.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||parentwrite.top$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||parg.co$all
Filter updated: Tue, 06 Jul 2021 00:01:42 +0000
2021-07-06 00:01:42 +00:00
||parkerwayland.com$all
Filter updated: Wed, 07 Jul 2021 00:01:56 +0000
2021-07-07 00:01:57 +00:00
||parkfans.nl$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||parmacityschooldistrict-my.sharepoint.com/:x:/r/personal/rosee_parmacityschools_org/_layouts/15/wopiframe.aspx?guestaccesstoken=amgmrypee2b3%2fq5mcsf%2bmqat2vaamt9idaj1njxwdpe%3d&docid=1_1514e14043e894d289ec8998e5536118b&wdformid=%7beb853daf%2d5ba6%2d40dd%2dbf99%2d970f5cf41327%7d&action=formsubmit$all
Filter updated: Tue, 27 Jul 2021 00:02:10 +0000
2021-07-27 00:02:10 +00:00
||parnamg.info/index.php$all
Filter updated: Wed, 15 Sep 2021 00:01:54 +0000
2021-09-15 00:01:55 +00:00
||parqueuniversitario.com$all
Filter updated: Mon, 05 Jul 2021 00:01:57 +0000
2021-07-05 00:01:57 +00:00
||parroquiajesucristoredentor.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||particuliers.client-ssl.com$all
Filter updated: Tue, 19 Jan 2021 00:06:28 UTC
2021-01-19 00:06:28 +00:00
||passionfruit4576261.brizy.site$all
Filter updated: Wed, 21 Jul 2021 12:01:49 +0000
2021-07-21 12:01:49 +00:00
||passproa.byethost7.com$all
Filter updated: Fri, 10 Sep 2021 00:02:17 +0000
2021-09-10 00:02:17 +00:00
||pasteeshirt.biz$all
Filter updated: Sat, 21 Nov 2020 12:06:40 UTC
2020-11-21 12:06:40 +00:00
||pastelink.net/25qk2$all
Filter updated: Sat, 07 Nov 2020 00:06:40 UTC
2020-11-07 00:06:40 +00:00
||pastelink.net/26c30$all
Filter updated: Wed, 11 Nov 2020 12:06:45 UTC
2020-11-11 12:06:45 +00:00
||pastelink.net/26dcc$all
Filter updated: Sat, 07 Nov 2020 00:06:40 UTC
2020-11-07 00:06:40 +00:00
||pastelink.net/26e8w$all
Filter updated: Wed, 11 Nov 2020 12:06:45 UTC
2020-11-11 12:06:45 +00:00
||pastelink.net/278zi$all
||pastelink.net/27tk1$all
Filter updated: Fri, 04 Dec 2020 12:06:51 UTC
2020-12-04 12:06:51 +00:00
||pastelink.net/2884c$all
Filter updated: Tue, 17 Nov 2020 12:06:54 UTC
2020-11-17 12:06:54 +00:00
||pastelink.net/28eek$all
Filter updated: Fri, 04 Dec 2020 12:06:51 UTC
2020-12-04 12:06:51 +00:00
||pastelink.net/2980b$all
||pastelink.net/29igl$all
Filter updated: Thu, 26 Nov 2020 12:06:43 UTC
2020-11-26 12:06:43 +00:00
||pastelink.net/29jzn$all
Filter updated: Sat, 05 Dec 2020 00:06:43 UTC
2020-12-05 00:06:43 +00:00
||pastelink.net/29n5y$all
Filter updated: Fri, 04 Dec 2020 12:06:51 UTC
2020-12-04 12:06:51 +00:00
||pastelink.net/29vnj$all
||pastelink.net/2a9kr$all
||pastelink.net/2ae9m$all
||pastelink.net/2ae9x$all
Filter updated: Thu, 10 Dec 2020 12:06:41 UTC
2020-12-10 12:06:42 +00:00
||pastelink.net/2amyg$all
||pastelink.net/2btlc$all
Filter updated: Mon, 04 Jan 2021 12:06:21 UTC
2021-01-04 12:06:21 +00:00
||pastelink.net/2bxht$all
Filter updated: Thu, 10 Dec 2020 12:06:41 UTC
2020-12-10 12:06:42 +00:00
||pastelink.net/2c1g8$all
||pastelink.net/2c396$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||patanjaliforages.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||pateltutorials.com$all
Filter updated: Sat, 03 Oct 2020 00:06:51 UTC
2020-10-03 00:06:51 +00:00
||pathikareps.com$all
Filter updated: Thu, 16 Sep 2021 12:02:15 +0000
2021-09-16 12:02:15 +00:00
||patient-cell-40f5.updatedlogmylogin.workers.dev$all
Filter updated: Wed, 01 Sep 2021 00:02:20 +0000
2021-09-01 00:02:20 +00:00
||patriciaeqths-wa.gq$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||patrickkestens-my.sharepoint.com/:o:/g/personal/patrick_kestens_kepa_be/ek6ptmfi3rbpl0okvukyovobz5voxh1dgbqr66js29e06w?e=zytfn9$all
||patrickkestens-my.sharepoint.com/personal/patrick_kestens_kepa_be/_layouts/15/doc.aspx?sourcedoc={c74ca94e-dee2-4fb0-9743-a4bd4932395a}&action=default&slrid=53537f9f-8020-2000-6402-9094cd7180b6&originalpath=ahr0chm6ly9wyxryawnra2vzdgvucy1tes5zagfyzxbvaw50lmnvbs86bzovzy9wzxjzb25hbc9wyxryawnrx2tlc3rlbnnfa2vwyv9izs9fazzwve1matnyqlbsme9rdlvreu9wb0janvzvwggxredicvi2nkptmjllmdz3p3j0aw1lpun2vwfidhbsmkvn&cid=3dd22632-4961-431e-befd-a875d08cde81$all
Filter updated: Sat, 21 Nov 2020 12:06:40 UTC
2020-11-21 12:06:40 +00:00
||paulmitchellforcongress.com$all
Filter updated: Sun, 15 Aug 2021 00:01:57 +0000
2021-08-15 00:01:57 +00:00
||paws.org.au$all
Filter updated: Sun, 19 Sep 2021 12:01:34 +0000
2021-09-19 12:01:35 +00:00
||paxful-click.com$all
Filter updated: Thu, 23 Sep 2021 00:02:18 +0000
2021-09-23 00:02:18 +00:00
||paxful-trade.com$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||pay-acc-security.codeanyapp.com$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||pay-pal.newconfig-solana.docsaboutnewrestricted.ltd$all
Filter updated: Tue, 19 Jan 2021 00:06:28 UTC
2021-01-19 00:06:28 +00:00
||pay-sera.web.app$all
Filter updated: Fri, 19 Feb 2021 00:06:27 UTC
2021-02-19 00:06:28 +00:00
||pay.moban.com$all
Filter updated: Wed, 17 Mar 2021 12:07:39 UTC
2021-03-17 12:07:39 +00:00
||pay16-olx.pl$all
Filter updated: Wed, 08 Sep 2021 00:02:08 +0000
2021-09-08 00:02:08 +00:00
||pay4pictures.com$all
Filter updated: Wed, 13 Jan 2021 12:06:45 UTC
2021-01-13 12:06:45 +00:00
||payee-my-hali.com$all
Filter updated: Wed, 03 Mar 2021 12:14:44 UTC
2021-03-03 12:14:44 +00:00
||payee-securityerror.com$all
Filter updated: Tue, 12 Jan 2021 00:06:08 UTC
2021-01-12 00:06:08 +00:00
||payeenew-hali.com$all
Filter updated: Thu, 12 Aug 2021 12:01:52 +0000
2021-08-12 12:01:53 +00:00
||payment-hsbc.eu$all
Filter updated: Mon, 19 Jul 2021 12:01:46 +0000
2021-07-19 12:01:46 +00:00
||payment.irs.benefit.marypoesia.com$all
Filter updated: Thu, 02 Sep 2021 12:02:02 +0000
2021-09-02 12:02:02 +00:00
||payment.mishooshow.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||paymentfailure-assistant.com$all
||paymentnotificationnow.blogspot.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||paypal-caseid24786.com$all
Filter updated: Mon, 20 Sep 2021 00:01:41 +0000
2021-09-20 00:01:41 +00:00
||paypal-caseid331.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||paypal-caseid42536.com$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||paypal-caseid63257.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||paypal-caseid85472.com$all
Filter updated: Sat, 12 Jun 2021 00:25:37 UTC
2021-06-12 00:25:37 +00:00
||paypal-customer-service.business.site$all
Filter updated: Thu, 04 Feb 2021 00:06:18 UTC
2021-02-04 00:06:18 +00:00
||paypal-inc-userupdatenuber7925570844.blogspot.com/2021/02/blog-post.html$all
Filter updated: Wed, 17 Feb 2021 12:06:49 UTC
2021-02-17 12:06:49 +00:00
||paypal-me-alessandra-martini.com$all
Filter updated: Thu, 03 Sep 2020 12:06:37 UTC
2020-09-03 12:06:37 +00:00
||paypal-merchantloyalty.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||paypal-my.sharepoint.com/personal/keyu_paypal_com/documents/delivering%20certainty%20presentation/delivering%20certainty%20roadmap%20presentation%204.18.19%20v11%20(shared).pptx$all
Filter updated: Sat, 11 Sep 2021 00:34:15 +0000
2021-09-11 00:34:15 +00:00
||paypal-opladen.be$all
Filter updated: Sat, 14 Aug 2021 00:01:49 +0000
2021-08-14 00:01:49 +00:00
||paypal-security-payment.7867888.com$all
Filter updated: Thu, 12 Aug 2021 12:01:52 +0000
2021-08-12 12:01:53 +00:00
||paypal-security-payment.xkzfc.com$all
Filter updated: Sat, 07 Aug 2021 00:20:48 +0000
2021-08-07 00:20:48 +00:00
||paypal-security-payment.zcygczz.com$all
Filter updated: Fri, 13 Aug 2021 12:01:44 +0000
2021-08-13 12:01:44 +00:00
||paypal-security-payment.zwangke.com$all
Filter updated: Thu, 03 Sep 2020 12:06:37 UTC
2020-09-03 12:06:37 +00:00
||paypal-test.projektumfeld.de$all
||paypal.ca.purchasekindle.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||paypal.co.uk.useriazi6bqgssb.settingsppup.com$all
Filter updated: Thu, 03 Sep 2020 12:06:37 UTC
2020-09-03 12:06:37 +00:00
||paypal.com.0.security-confirmation.d72b69c8e37aec662e13e39d929d6e3d.as2.2u.se$all
Filter updated: Fri, 19 Feb 2021 00:06:27 UTC
2021-02-19 00:06:28 +00:00
||paypal.com.update.service.verify.freeget.net$all
Filter updated: Fri, 02 Apr 2021 00:06:35 UTC
2021-04-02 00:06:36 +00:00
||paypalforex.co.ke$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||paypalticket134235.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||paypalvsgooglecheckout.com/countries$all
Filter updated: Thu, 03 Sep 2020 12:06:37 UTC
2020-09-03 12:06:37 +00:00
||paypalvsgooglecheckout.com/countries/$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||paypay-login.jp$all
Filter updated: Sat, 18 Sep 2021 12:01:34 +0000
2021-09-18 12:01:34 +00:00
||paypay-net.cn$all
Filter updated: Mon, 23 Aug 2021 00:01:47 +0000
2021-08-23 00:01:47 +00:00
||paypei.co$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||payplchhkin.org$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||payplsupport164951390.info$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||paytheinput.updatethejpamazon.buzz$all
Filter updated: Sun, 08 Aug 2021 12:01:35 +0000
2021-08-08 12:01:35 +00:00
||payu.okta-emea.com$all
Filter updated: Fri, 05 Feb 2021 12:06:59 UTC
2021-02-05 12:06:59 +00:00
||pbi.unsam.ac.id$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||pbox.photobox.co.uk/dynclick/photobox-uk/?eml-publisher=photobox-uk&eml-name=phx_t_uk_new_crn_e2_bau_all&uid=67912768&eurl=http://photobox-mkt-prod1-t.campaign.adobe.com/r/?id=h4e5ec0b9,69a17086,5eb6e68f&utm_source=photobox&utm_medium=email&utm_campaign=t_all_w26_20200623_uk_crn_tips-and-trading-plan_2_bau_ac1982206_web_1772187782&_c1v=crm&_c2v=trigger&_c3v=creation&_c4id=1982206&_c5id=1772187782&_c6id=all&_c7id=acc&_cdt=2020-06-23&_ceh=b79bed2958568ab17f18979440690c16a1c6f09f5afc870aacd7ecb1e408488c&_cleh=b79bed2958568ab17f18979440690c16a1c6f09f5afc870aacd7ecb1e408488c&p1=ak-x.shop/?e=zg91z2xhc0btewnvbxbhbnltywdhemluzs5jb20=%23/my/creations$all
Filter updated: Wed, 25 Aug 2021 00:01:57 +0000
2021-08-25 00:01:57 +00:00
||pbpro3453file.gb.net$all
Filter updated: Tue, 18 May 2021 00:06:34 UTC
2021-05-18 00:06:34 +00:00
||pc.tc$all
Filter updated: Tue, 24 Aug 2021 00:02:23 +0000
2021-08-24 00:02:24 +00:00
||pcbacweb.webcindario.com$all
||pcbacweblogin.webcindario.com$all
Filter updated: Sun, 15 Aug 2021 00:01:57 +0000
2021-08-15 00:01:57 +00:00
||pcbc-webalert03.ultimatefreehost.in$all
Filter updated: Sun, 13 Jun 2021 12:06:36 UTC
2021-06-13 12:06:36 +00:00
||pchnaasdban.byethost33.com$all
Filter updated: Sat, 04 Sep 2021 00:17:00 +0000
2021-09-04 00:17:00 +00:00
||pchnchabanc.ultimatefreehost.in$all
Filter updated: Tue, 21 Sep 2021 00:01:40 +0000
2021-09-21 00:01:40 +00:00
||pcpcontacts.granadoemurahara.com.br$all
Filter updated: Tue, 31 Aug 2021 00:01:55 +0000
2021-08-31 00:01:55 +00:00
||pcsnissin.com$all
Filter updated: Thu, 05 Aug 2021 12:01:57 +0000
2021-08-05 12:01:57 +00:00
||pdf-cloud-document.weeblysite.com$all
Filter updated: Tue, 14 Sep 2021 12:01:44 +0000
2021-09-14 12:01:44 +00:00
||pdf-sharefile-doc.weeblysite.com$all
Filter updated: Fri, 03 Sep 2021 00:01:54 +0000
2021-09-03 00:01:55 +00:00
||pdp.eue.mybluehost.me$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||peared.servehttp.com$all
Filter updated: Wed, 25 Aug 2021 12:02:06 +0000
2021-08-25 12:02:07 +00:00
||pearlfilms.com$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||pec.libero.it.robotake.com$all
Filter updated: Wed, 28 Jul 2021 12:01:46 +0000
2021-07-28 12:01:46 +00:00
||pecgradsyjpgfayrvqcfvibvog-dot-gowa11111111.rj.r.appspot.com$all
Filter updated: Tue, 08 Dec 2020 12:06:43 UTC
2020-12-08 12:06:44 +00:00
||peer.yourluv.co$all
Filter updated: Tue, 31 Aug 2021 00:01:55 +0000
2021-08-31 00:01:55 +00:00
||pelhaf041984.byethost9.com$all
Filter updated: Thu, 02 Sep 2021 12:02:02 +0000
2021-09-02 12:02:02 +00:00
||pemersatu-bangsaa-18plus.duckdns.org$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||pencakecwap.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||pendas.pascasarjana.ump.ac.id$all
Filter updated: Wed, 22 Sep 2021 12:01:56 +0000
2021-09-22 12:01:56 +00:00
||pendentecaixa.blob.core.windows.net$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||pensiontransfer.ca$all
Filter updated: Thu, 09 Sep 2021 00:01:56 +0000
2021-09-09 00:01:56 +00:00
||pentelican-amusemen.000webhostapp.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||pepsicola1-my.sharepoint.com/:x:/r/personal/rmutyaba_pepsi-cola_co_ug/_layouts/15/wopiframe.aspx?guestaccesstoken=q1xrx9cq6omueu0gw5ech36jcmrq7yl45zuzcxjws54%3d&docid=1_182d7ec9b7ef240e7b33e879a44314f92&wdformid=%7b0692719f%2d1981%2d4f26%2db7cd%2da0e252746cb1%7d&action=formsubmit$all
||perabetgirs.blogspot.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||perfectliker.net$all
Filter updated: Wed, 18 Aug 2021 00:01:50 +0000
2021-08-18 00:01:50 +00:00
||perfectlybuilt.ca$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||perfectpacing.com$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||perfectwill.vi$all
Filter updated: Wed, 22 Sep 2021 12:01:56 +0000
2021-09-22 12:01:56 +00:00
||perfumesway.rw$all
Filter updated: Fri, 28 May 2021 12:06:27 UTC
2021-05-28 12:06:27 +00:00
||perinasas.it$all
Filter updated: Wed, 21 Jul 2021 00:01:57 +0000
2021-07-21 00:01:57 +00:00
||peringatanakunfb2k214.webnode.com$all
Filter updated: Mon, 01 Mar 2021 12:08:04 UTC
2021-03-01 12:08:04 +00:00
||permajacktulsa.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||permajacktulsa.com/ahogan@zookfarmequipment.com_invoice104603_open_onedriveportal/updated_drive_shared_securely_online%20-%20copy$all
||permajacktulsa.com/ahogan@zookfarmequipment.com_invoice104603_open_onedriveportal/updated_drive_shared_securely_online%20-%20copy/$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||peronaci.it$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||persistent.serveirc.com$all
Filter updated: Fri, 15 Jan 2021 00:06:14 UTC
2021-01-15 00:06:14 +00:00
||perso.menara.ma$all
Filter updated: Thu, 29 Jul 2021 00:01:57 +0000
2021-07-29 00:01:57 +00:00
||personal.ultimatefreehost.in$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||pertinae.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||peru.payulatam.com$all
Filter updated: Wed, 11 Nov 2020 12:06:45 UTC
2020-11-11 12:06:45 +00:00
||peruzonazonasegvra-bnweb29.com$all
Filter updated: Mon, 10 May 2021 12:06:32 UTC
2021-05-10 12:06:32 +00:00
||pesc.pw/amazon-jp$all
Filter updated: Wed, 01 Sep 2021 00:02:20 +0000
2021-09-01 00:02:20 +00:00
||petesappliancesllc.com$all
Filter updated: Fri, 24 Sep 2021 12:02:36 +0000
2021-09-24 12:02:36 +00:00
||petrolpumpservice.in$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||pharmaglobiz.com$all
Filter updated: Thu, 05 Aug 2021 00:02:05 +0000
2021-08-05 00:02:05 +00:00
||phc56741.wixsite.com$all
Filter updated: Sun, 07 Mar 2021 00:06:38 UTC
2021-03-07 00:06:38 +00:00
||phillipmill176545.clickfunnels.com$all
Filter updated: Wed, 18 Aug 2021 00:01:50 +0000
2021-08-18 00:01:50 +00:00
||phiphicocobella.com$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||phiphihotelgroup.com$all
Filter updated: Fri, 17 Sep 2021 00:01:45 +0000
2021-09-17 00:01:46 +00:00
||phonegiftsin.blogspot.com$all
Filter updated: Wed, 14 Jul 2021 12:02:08 +0000
2021-07-14 12:02:08 +00:00
||phongvuexpress.vn$all
Filter updated: Fri, 02 Jul 2021 00:01:50 +0000
2021-07-02 00:01:51 +00:00
||photoartstavrinos.com$all
Filter updated: Sun, 03 Jan 2021 00:06:41 UTC
2021-01-03 00:06:41 +00:00
||photographybyallen.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||phreshphoto.com$all
Filter updated: Thu, 08 Jul 2021 00:02:02 +0000
2021-07-08 00:02:02 +00:00
||phynxzit.com/covidapprove/attachment%20name%2020210312_2049.pdf.html$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||piandizano.it$all
Filter updated: Sat, 04 Sep 2021 00:17:00 +0000
2021-09-04 00:17:00 +00:00
||pichiactivate711.ultimatefreehost.in$all
||pichin-web.ihostfull.com$all
Filter updated: Sat, 22 May 2021 12:07:44 UTC
2021-05-22 12:07:44 +00:00
||pichincalog00.ihostfull.com$all
Filter updated: Wed, 26 May 2021 00:06:29 UTC
2021-05-26 00:06:29 +00:00
||pichincha-msj.byethost7.com$all
Filter updated: Wed, 11 Aug 2021 00:01:55 +0000
2021-08-11 00:01:55 +00:00
||pichincha.conlinux.net$all
Filter updated: Tue, 13 Jul 2021 00:02:30 +0000
2021-07-13 00:02:30 +00:00
||pichinchal.byethost24.com$all
Filter updated: Wed, 21 Jul 2021 00:01:57 +0000
2021-07-21 00:01:57 +00:00
||pichinchaonline.byethost6.com$all
Filter updated: Fri, 16 Jul 2021 00:01:53 +0000
2021-07-16 00:01:53 +00:00
||pichinchaq.byethost4.com$all
Filter updated: Wed, 30 Jun 2021 00:01:58 +0000
2021-06-30 00:01:58 +00:00
||pichinchasdirecu.byethost7.com$all
Filter updated: Sun, 13 Jun 2021 12:06:36 UTC
2021-06-13 12:06:36 +00:00
||pichinchasss.freecluster.eu$all
Filter updated: Sat, 10 Jul 2021 00:01:42 +0000
2021-07-10 00:01:42 +00:00
||pichinchaweb-ecu.byethost7.com$all
Filter updated: Thu, 29 Jul 2021 00:01:57 +0000
2021-07-29 00:01:57 +00:00
||pichinchawebline.byethost7.com$all
Filter updated: Tue, 13 Jul 2021 00:02:30 +0000
2021-07-13 00:02:30 +00:00
||pichinchawebsite.2host.me$all
Filter updated: Sat, 22 May 2021 00:06:19 UTC
2021-05-22 00:06:19 +00:00
||pichinotificpin1.ihostfull.com$all
Filter updated: Tue, 07 Sep 2021 12:01:49 +0000
2021-09-07 12:01:49 +00:00
||pichnchaaban134.ihostfull.com$all
Filter updated: Thu, 18 Mar 2021 12:07:19 UTC
2021-03-18 12:07:19 +00:00
||picnic.industries$all
Filter updated: Fri, 13 Nov 2020 12:06:52 UTC
2020-11-13 12:06:52 +00:00
||pics.lookatmynewphotos.com$all
Filter updated: Fri, 30 Apr 2021 00:08:30 UTC
2021-04-30 00:08:30 +00:00
||pideciisa.com$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||piena.fun$all
Filter updated: Tue, 03 Aug 2021 00:01:58 +0000
2021-08-03 00:01:58 +00:00
||pijkeowa.tk$all
Filter updated: Thu, 23 Sep 2021 00:02:18 +0000
2021-09-23 00:02:18 +00:00
||pikaresailing.com$all
Filter updated: Fri, 21 May 2021 00:06:36 UTC
2021-05-21 00:06:36 +00:00
||pil.nxn.mybluehost.me$all
Filter updated: Fri, 20 Aug 2021 12:01:48 +0000
2021-08-20 12:01:48 +00:00
||pilotofficial.mfs.gg$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||pinkoliveentertainment.com/wp-messages/css/login.htm?email=&email&$all
Filter updated: Fri, 12 Mar 2021 12:07:45 UTC
2021-03-12 12:07:45 +00:00
||pinkoliveentertainment.com/wp-messages/passport%20alibaba/index.html$all
Filter updated: Sat, 13 Mar 2021 00:09:54 UTC
2021-03-13 00:09:54 +00:00
||pinkoliveentertainment.com/wp-messages/passport%20alibaba/index.html?email=&email&flag=isle&tracelog=edmfooter&biz_type=&crm_mtn_tracelog_template=200412047&crm_mtn_tracelog_task_id=a72ad2ca-ce11-4a70-b2e8-76fb3ff77ddc&crm_mtn_tracelog_from_sys=service_feedback&crm_mtn_tracelog_log_id=15532788161$all
||pinkoliveentertainment.com/wp-messages/passport%20alibaba/index.html?email=&email&tracelog=notification20160310&biz_type=&crm_mtn_tracelog_template=200412047&crm_mtn_tracelog_task_id=a72ad2ca-ce11-4a70-b2e8-76fb3ff77ddc&crm_mtn_tracelog_from_sys=service_feedback&crm_mtn_tracelog_log_id=15532788161$all
||pinkoliveentertainment.com/wp-messages/passport%20alibaba/index.html?email=&email&tracelog=notificationtips2016310&biz_type=&crm_mtn_tracelog_template=200412047&crm_mtn_tracelog_task_id=a72ad2ca-ce11-4a70-b2e8-76fb3ff77ddc&crm_mtn_tracelog_from_sys=service_feedback&crm_mtn_tracelog_log_id=15532788161$all
||pinkoliveentertainment.com/wp-messages/passport%20alibaba/index.html?email=&email&url_type=footer_privacy&biz_type=&crm_mtn_tracelog_template=200412047&crm_mtn_tracelog_task_id=a72ad2ca-ce11-4a70-b2e8-76fb3ff77ddc&crm_mtn_tracelog_from_sys=service_feedback&crm_mtn_tracelog_log_id=15532788161$all
||pinkoliveentertainment.com/wp-messages/passport%20alibaba/index.html?email=&email&url_type=footer_term&biz_type=&crm_mtn_tracelog_template=200412047&crm_mtn_tracelog_task_id=a72ad2ca-ce11-4a70-b2e8-76fb3ff77ddc&crm_mtn_tracelog_from_sys=service_feedback&crm_mtn_tracelog_log_id=15532788161$all
||pinkoliveentertainment.com/wp-messages/passport%20alibaba/index.html?url_type=header_homepage&biz_type=&crm_mtn_tracelog_template=200412047&crm_mtn_tracelog_task_id=a72ad2ca-ce11-4a70-b2e8-76fb3ff77ddc&crm_mtn_tracelog_from_sys=service_feedback&crm_mtn_tracelog_log_id=15532788161$all
Filter updated: Fri, 17 Sep 2021 12:01:51 +0000
2021-09-17 12:01:52 +00:00
||pipesanddrape.com$all
Filter updated: Wed, 19 May 2021 00:06:43 UTC
2021-05-19 00:06:44 +00:00
||pips.fkip.ulm.ac.id$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||pixelbenchmarks.com$all
Filter updated: Wed, 07 Apr 2021 12:23:11 UTC
2021-04-07 12:23:12 +00:00
||pizfirepizzacafe.com$all
Filter updated: Sun, 15 Aug 2021 12:01:40 +0000
2021-08-15 12:01:40 +00:00
||pkk.depok.go.id$all
Filter updated: Sun, 12 Sep 2021 00:02:13 +0000
2021-09-12 00:02:13 +00:00
||pl-19.ru$all
Filter updated: Mon, 26 Apr 2021 12:07:30 UTC
2021-04-26 12:07:30 +00:00
||pl.pl2021.ru$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||plain-bush-2ed3.dhlcaredmxcarelogin.workers.dev$all
Filter updated: Wed, 17 Mar 2021 12:07:39 UTC
2021-03-17 12:07:39 +00:00
||plan-o2-monthlypayments.com$all
Filter updated: Fri, 20 Aug 2021 00:01:56 +0000
2021-08-20 00:01:56 +00:00
||plantamariaeugenia.com$all
Filter updated: Wed, 11 Aug 2021 00:01:55 +0000
2021-08-11 00:01:55 +00:00
||plasifell44.freecluster.eu$all
Filter updated: Wed, 18 Aug 2021 00:01:50 +0000
2021-08-18 00:01:50 +00:00
||plasma.tamu.edu$all
Filter updated: Sun, 04 Apr 2021 12:06:34 UTC
2021-04-04 12:06:34 +00:00
||plasticaindia.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||plataformaeducativa.se.jalisco.gob.mx$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||playnlearntogether.com$all
||plodjjks.com$all
Filter updated: Sat, 05 Jun 2021 12:06:16 UTC
2021-06-05 12:06:17 +00:00
||plush.my$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||plytecfi-my.sharepoint.com/:o:/g/personal/pasi_puumalainen_plytec_fi/eviubi-o5_rgorvtg1ptinyb5th9mqv-2ev_l8ujkorojg?e=5%3a8603ib&at=9$all
||plytecfi-my.sharepoint.com/personal/pasi_puumalainen_plytec_fi/_layouts/15/wopiframe.aspx?sourcedoc={8f0414f2-e7a8-46f4-a2bb-d38353ed20d6}&action=default&originalpath=ahr0chm6ly9wbhl0zwnmas1tes5zagfyzxbvaw50lmnvbs86bzovzy9wzxjzb25hbc9wyxnpx3b1dw1hbgfpbmvux3bsexrly19mas9fdklvqkktbzvfukdvcnzuzzfqdelowui1vgg5bxf2ltjlvl9mohvka09sb2pnp3j0aw1lpxvysjgtvnb2mtbn$all
Filter updated: Fri, 24 Sep 2021 12:02:36 +0000
2021-09-24 12:02:36 +00:00
||pmboulevard.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||pmiconnect-my.sharepoint.com$all
Filter updated: Wed, 11 Aug 2021 12:01:50 +0000
2021-08-11 12:01:50 +00:00
||pms-uipro.co.in$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||pn-mempawah.go.id$all
||pnckeswap.com$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||pnrmericasnm.byethost22.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||po-trackparcelfee.com$all
Filter updated: Fri, 16 Apr 2021 00:06:41 UTC
2021-04-16 00:06:41 +00:00
||po.do$all
Filter updated: Thu, 05 Aug 2021 00:02:05 +0000
2021-08-05 00:02:05 +00:00
||poc-rewards-program-c2dfc.web.app$all
Filter updated: Fri, 24 Sep 2021 00:01:50 +0000
2021-09-24 00:01:51 +00:00
||poczta-order.pl-id18901816.xyz$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||poczta-order.pl-id29458764.xyz$all
Filter updated: Tue, 21 Sep 2021 12:02:11 +0000
2021-09-21 12:02:11 +00:00
||poczta-order.pl-id53061369.xyz$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||poczta-order.pl-id67594295.xyz$all
Filter updated: Wed, 22 Sep 2021 00:02:26 +0000
2021-09-22 00:02:26 +00:00
||poczta-order.pl-id89096441.xyz$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||poczta.pl-id97118124.xyz$all
Filter updated: Thu, 29 Jul 2021 00:01:57 +0000
2021-07-29 00:01:57 +00:00
||podpiska-darom.ru$all
Filter updated: Sun, 11 Apr 2021 00:06:52 UTC
2021-04-11 00:06:52 +00:00
||pokajca.web.app$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||polen-esquadrias.blogspot.com$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||policyfest.com/logs/sup/index.php$all
||policyfest.com/verify$all
Filter updated: Sun, 15 Aug 2021 12:01:40 +0000
2021-08-15 12:01:40 +00:00
||poligrafiapias.com$all
Filter updated: Sun, 05 Sep 2021 12:01:36 +0000
2021-09-05 12:01:37 +00:00
||polkadot-france.fr$all
Filter updated: Mon, 14 Jun 2021 12:06:44 UTC
2021-06-14 12:06:44 +00:00
||polkastarter.com.co$all
Filter updated: Wed, 26 May 2021 12:06:39 UTC
2021-05-26 12:06:39 +00:00
||polkastarter.group$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||polkastarter.one$all
Filter updated: Fri, 23 Jul 2021 00:03:07 +0000
2021-07-23 00:03:07 +00:00
||polomcapital.com$all
Filter updated: Thu, 04 Feb 2021 12:06:49 UTC
2021-02-04 12:06:49 +00:00
||pomoc.o2.pl/polityka-prywatnosci$all
Filter updated: Sun, 05 Sep 2021 12:01:36 +0000
2021-09-05 12:01:37 +00:00
||poniatowscy.xpx.pl$all
Filter updated: Thu, 03 Sep 2020 12:06:37 UTC
2020-09-03 12:06:37 +00:00
||pontofrio.webpremios.com.br$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||pontsbschool.dev$all
Filter updated: Thu, 29 Jul 2021 00:01:57 +0000
2021-07-29 00:01:57 +00:00
||pope0w.webwave.dev$all
||portal.mailsphere.co.uk$all
||portal.mailsphere.co.uk/archives/%3c17bb1b72.aa4aabambdsaachbnjiaaagn5iaaaaaajbganduyabbhkabgnaaw%40mailjet.com%3e%7cxntjjt7d%2bpgxnycpm8zjag%3d%3d$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||portal.vodlix.com$all
Filter updated: Fri, 06 Aug 2021 12:01:57 +0000
2021-08-06 12:01:57 +00:00
||portal57406531456576.weeblysite.com$all
Filter updated: Tue, 21 Sep 2021 00:01:40 +0000
2021-09-21 00:01:40 +00:00
||portalemps-controllo-dispositivo.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||portalppc.com.br$all
Filter updated: Wed, 30 Sep 2020 12:06:32 UTC
2020-09-30 12:06:32 +00:00
||posadalalucia.com.ar$all
Filter updated: Sat, 28 Aug 2021 00:33:51 +0000
2021-08-28 00:33:51 +00:00
||posdiepay.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||poseidonsweatru.com$all
Filter updated: Thu, 01 Jul 2021 00:01:46 +0000
2021-07-01 00:01:46 +00:00
||poshqd.classsizecounts.com$all
Filter updated: Thu, 26 Aug 2021 12:02:31 +0000
2021-08-26 12:02:31 +00:00
||post-myitem.com$all
Filter updated: Wed, 02 Jun 2021 00:06:23 UTC
2021-06-02 00:06:23 +00:00
||post-secu.fr$all
Filter updated: Sat, 12 Jun 2021 00:25:37 UTC
2021-06-12 00:25:37 +00:00
||post-track.ch$all
Filter updated: Wed, 22 Sep 2021 00:02:26 +0000
2021-09-22 00:02:26 +00:00
||posta.sk.u1480692.cp.regruhosting.ru$all
Filter updated: Wed, 02 Jun 2021 00:06:23 UTC
2021-06-02 00:06:23 +00:00
||postaledsp2.conexion.fr.savealifemw.org$all
Filter updated: Mon, 23 Aug 2021 12:02:18 +0000
2021-08-23 12:02:19 +00:00
||postalfees-uk.com$all
Filter updated: Tue, 03 Nov 2020 12:06:52 UTC
2020-11-03 12:06:52 +00:00
||postchtrackingorder.com$all
Filter updated: Wed, 07 Apr 2021 12:23:11 UTC
2021-04-07 12:23:12 +00:00
||posten-post.it$all
Filter updated: Thu, 29 Jul 2021 00:01:57 +0000
2021-07-29 00:01:57 +00:00
||postlogistics.datacoll.net$all
Filter updated: Tue, 03 Aug 2021 00:01:58 +0000
2021-08-03 00:01:58 +00:00
||postoffice-company.com$all
Filter updated: Tue, 17 Aug 2021 12:01:39 +0000
2021-08-17 12:01:39 +00:00
||postoffice-deliveryupdates.com$all
Filter updated: Mon, 13 Sep 2021 12:01:52 +0000
2021-09-13 12:01:52 +00:00
||postoffice-fees.co.uk$all
Filter updated: Thu, 12 Aug 2021 00:01:53 +0000
2021-08-12 00:01:54 +00:00
||postoffice-issue-redelivery.com$all
Filter updated: Fri, 24 Sep 2021 12:02:36 +0000
2021-09-24 12:02:36 +00:00
||postoffice-payfees.co.uk$all
Filter updated: Tue, 03 Aug 2021 00:01:58 +0000
2021-08-03 00:01:58 +00:00
||postoffice-tracking-update.com$all
Filter updated: Tue, 17 Aug 2021 12:01:39 +0000
2021-08-17 12:01:39 +00:00
||postoffice.co.uk-billing.delivery$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||postoffice61-t.neolane.net$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||postsfb-6ezkatz2.novitium.ca$all
||postsfb-6zwhloyt53.novitium.ca$all
||postsfb-9soee65d.novitium.ca$all
||postsfb-bdt8k0rlrb.novitium.ca$all
Filter updated: Wed, 30 Jun 2021 12:01:58 +0000
2021-06-30 12:01:58 +00:00
||postsfb-bjrc0kfq.novitium.ca$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||postsfb-bknl7e7qjc.novitium.ca$all
||postsfb-bm2al55kpv.novitium.ca$all
||postsfb-cjrwtpygk.novitium.ca$all
||postsfb-cpo2lrz2.novitium.ca$all
||postsfb-kziaf8v64.novitium.ca$all
||postsfb-nct69zjh2.novitium.ca$all
||postsfb-nfwmcy84.novitium.ca$all
||postsfb-wxafk4022w.novitium.ca$all
||pot.servehttp.com$all
Filter updated: Tue, 09 Mar 2021 00:10:02 UTC
2021-03-09 00:10:02 +00:00
||poverty.monespace.net$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||powercase.shoplineapp.com$all
Filter updated: Wed, 22 Sep 2021 12:01:56 +0000
2021-09-22 12:01:56 +00:00
||powertrusion.com$all
Filter updated: Mon, 26 Apr 2021 00:08:39 UTC
2021-04-26 00:08:39 +00:00
||powr.io/form-builder/i/28221802#page$all
Filter updated: Thu, 29 Apr 2021 00:07:24 UTC
2021-04-29 00:07:24 +00:00
||powr.io/form-builder/i/28221802$all
Filter updated: Mon, 26 Jul 2021 00:02:16 +0000
2021-07-26 00:02:17 +00:00
||powr.io/form-builder/i/29149732#page$all
Filter updated: Tue, 06 Jul 2021 00:01:42 +0000
2021-07-06 00:01:42 +00:00
||powr.io/form-builder/i/29291212#page$all
Filter updated: Mon, 13 Sep 2021 12:01:52 +0000
2021-09-13 12:01:52 +00:00
||pp-aid.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||pphwm.app.link$all
Filter updated: Sun, 19 Sep 2021 00:02:16 +0000
2021-09-19 00:02:17 +00:00
||ppkalqudwah.ulm.ac.id$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||ppnovel.club$all
Filter updated: Wed, 04 Aug 2021 00:02:10 +0000
2021-08-04 00:02:10 +00:00
||prdqonl.cluster030.hosting.ovh.net$all
Filter updated: Sat, 28 Aug 2021 12:01:47 +0000
2021-08-28 12:01:47 +00:00
||predirect.net/kd_nz/?show_pop=1&pname=bitcoin%20code&affiliate_id=1864&offer_id=104&sys_id=1&aff_sub=466491&aff_sub2=15402544&aff_sub3=466491&aff_sub4=5ecb81115fbe34549af602a570d1ab6e&aff_sub5=1454474&source=adsterra_41&entity=super$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||premiumnoidaescorts.com$all
Filter updated: Thu, 04 Mar 2021 12:07:52 UTC
2021-03-04 12:07:52 +00:00
||preppingconfidence.com$all
Filter updated: Fri, 10 Sep 2021 12:02:02 +0000
2021-09-10 12:02:02 +00:00
||prevencionvialbcpzonasegura.esc-pons.com$all
Filter updated: Sat, 11 Sep 2021 12:01:27 +0000
2021-09-11 12:01:27 +00:00
||prevencionvialbcpzonaseguras.esc-pons.com$all
Filter updated: Sat, 18 Sep 2021 12:01:34 +0000
2021-09-18 12:01:34 +00:00
||preview-doc-oicone.tk$all
Filter updated: Wed, 08 Sep 2021 00:02:08 +0000
2021-09-08 00:02:08 +00:00
||preview-docs-ncdps.ml$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||prikany.com$all
Filter updated: Wed, 28 Jul 2021 00:02:03 +0000
2021-07-28 00:02:03 +00:00
||prikolnaya.com$all
Filter updated: Mon, 20 Sep 2021 12:02:05 +0000
2021-09-20 12:02:05 +00:00
||primeshopee.com$all
Filter updated: Fri, 24 Sep 2021 00:01:50 +0000
2021-09-24 00:01:51 +00:00
||principal.servehalflife.com$all
Filter updated: Sun, 13 Dec 2020 00:06:49 UTC
2020-12-13 00:06:49 +00:00
||printtoner.com.mx$all
Filter updated: Tue, 23 Mar 2021 12:16:28 UTC
2021-03-23 12:16:28 +00:00
||privacy-notification-checkiing-page-recovery.my.id$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||privacy-observation-5587921365694256903.tk$all
||privacy-observation-5587921365694256906.tk$all
||privacy-observation-5587921365694256907.tk$all
||privacy-observation-5587921365694256908.tk$all
Filter updated: Thu, 02 Sep 2021 00:01:59 +0000
2021-09-02 00:01:59 +00:00
||privacy-revocerio-identitty-page-prtecti-updatse.web.id$all
Filter updated: Fri, 18 Jun 2021 12:06:25 +0000
2021-06-18 12:06:25 +00:00
||privacy-update-page-protections-recovry-association.web.id$all
Filter updated: Thu, 17 Jun 2021 12:06:40 +0000
2021-06-17 12:06:40 +00:00
||privacy-update-recovry-page-protections-association-secu.web.id$all
Filter updated: Sat, 21 Aug 2021 00:01:53 +0000
2021-08-21 00:01:54 +00:00
||privacy-update-secu-recovriy-page-protection-association.web.id$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||privacy-update-secu-recovry-page-protection-association.web.id$all
Filter updated: Mon, 06 Sep 2021 00:01:54 +0000
2021-09-06 00:01:54 +00:00
||privacypolicypagesecure.co.vu$all
Filter updated: Sat, 21 Aug 2021 12:02:04 +0000
2021-08-21 12:02:04 +00:00
||privacys-page-updatee-protection-recovry-associatiion.web.id$all
Filter updated: Thu, 23 Sep 2021 00:02:18 +0000
2021-09-23 00:02:18 +00:00
||privatewealth.academy/elite-tax-secrets?affiliate_id=3264153$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||productkeyforfree.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||professional-house-cleaning.ca$all
Filter updated: Tue, 21 Sep 2021 12:02:11 +0000
2021-09-21 12:02:11 +00:00
||programasbeta.com$all
Filter updated: Sat, 21 Aug 2021 00:01:53 +0000
2021-08-21 00:01:54 +00:00
||programe-alba.ro$all
Filter updated: Wed, 28 Apr 2021 12:07:34 UTC
2021-04-28 12:07:34 +00:00
||prok.webd.pl$all
Filter updated: Sat, 11 Sep 2021 00:34:15 +0000
2021-09-11 00:34:15 +00:00
||prolevelsignage.com$all
Filter updated: Thu, 22 Jul 2021 00:01:54 +0000
2021-07-22 00:01:54 +00:00
||promaclive00.byethost7.com$all
Filter updated: Wed, 25 Nov 2020 12:06:48 UTC
2020-11-25 12:06:48 +00:00
||promehedinti.ro$all
Filter updated: Tue, 24 Aug 2021 00:02:23 +0000
2021-08-24 00:02:24 +00:00
||promeric4.webcindario.com$all
Filter updated: Tue, 03 Aug 2021 12:01:54 +0000
2021-08-03 12:01:54 +00:00
||promerica-final.byethost12.com$all
Filter updated: Thu, 22 Jul 2021 00:01:54 +0000
2021-07-22 00:01:54 +00:00
||promerica-web2.byethost7.com$all
||promerica-web4.byethost24.com$all
Filter updated: Wed, 21 Jul 2021 00:01:57 +0000
2021-07-21 00:01:57 +00:00
||promericaa0.byethost12.com$all
Filter updated: Sat, 17 Jul 2021 12:01:37 +0000
2021-07-17 12:01:37 +00:00
||promericad.byethost6.com$all
Filter updated: Tue, 24 Aug 2021 00:02:23 +0000
2021-08-24 00:02:24 +00:00
||promericaisn.ultimatefreehost.in$all
Filter updated: Thu, 22 Jul 2021 00:01:54 +0000
2021-07-22 00:01:54 +00:00
||promericaonlifd.byethost15.com$all
Filter updated: Sat, 17 Jul 2021 12:01:37 +0000
2021-07-17 12:01:37 +00:00
||promericaonline.byethost6.com$all
Filter updated: Sun, 18 Jul 2021 00:02:04 +0000
2021-07-18 00:02:04 +00:00
||promericaonlint.byethost17.com$all
Filter updated: Wed, 08 Sep 2021 12:01:51 +0000
2021-09-08 12:01:51 +00:00
||promericasv.eb2a.com$all
Filter updated: Fri, 23 Jul 2021 00:03:07 +0000
2021-07-23 00:03:07 +00:00
||promericsvonli.byethost18.com$all
Filter updated: Wed, 21 Jul 2021 00:01:57 +0000
2021-07-21 00:01:57 +00:00
||promeriicaenline.ultimatefreehost.in$all
Filter updated: Thu, 22 Jul 2021 00:01:54 +0000
2021-07-22 00:01:54 +00:00
||promexsv000.byethost7.com$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||pronouncement-reconfrim-5537412698564562305.tk$all
Filter updated: Wed, 21 Jul 2021 00:01:57 +0000
2021-07-21 00:01:57 +00:00
||proomericaenline.ultimatefreehost.in$all
Filter updated: Thu, 02 Sep 2021 00:01:59 +0000
2021-09-02 00:01:59 +00:00
||property-ads-marketplace.libidokala.com$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||prophetwilson.com$all
Filter updated: Sun, 25 Apr 2021 12:06:35 UTC
2021-04-25 12:06:35 +00:00
||proprofs.com/survey/t/?title=1rt3s$all
Filter updated: Thu, 10 Jun 2021 00:06:48 UTC
2021-06-10 00:06:48 +00:00
||proprofs.com/survey/t/?title=4j21b$all
Filter updated: Thu, 08 Jul 2021 00:02:02 +0000
2021-07-08 00:02:02 +00:00
||proprofs.com/survey/t/?title=bt-broadband-and-private-policy-support_2$all
Filter updated: Tue, 17 Aug 2021 00:02:45 +0000
2021-08-17 00:02:45 +00:00
||proprofs.com/survey/t/?title=bt-broadband-and-private-policy-support_20$all
Filter updated: Fri, 16 Jul 2021 12:01:57 +0000
2021-07-16 12:01:57 +00:00
||proprofs.com/survey/t/?title=bt-broadband-and-private-policy-support_9$all
Filter updated: Thu, 22 Jul 2021 00:01:54 +0000
2021-07-22 00:01:54 +00:00
||proprofs.com/survey/t/?title=bt-broadband-uk$all
Filter updated: Wed, 12 May 2021 00:06:26 UTC
2021-05-12 00:06:26 +00:00
||proprofs.com/survey/t/?title=bt-broadband_1$all
Filter updated: Sun, 02 May 2021 12:06:33 UTC
2021-05-02 12:06:33 +00:00
||proprofs.com/survey/t/?title=bt-broardband-services$all
Filter updated: Thu, 29 Jul 2021 00:01:57 +0000
2021-07-29 00:01:57 +00:00
||proprofs.com/survey/t/?title=diaa0$all
Filter updated: Tue, 17 Aug 2021 00:02:45 +0000
2021-08-17 00:02:45 +00:00
||proprofs.com/survey/t/?title=hiatb$all
Filter updated: Mon, 20 Sep 2021 12:02:05 +0000
2021-09-20 12:02:05 +00:00
||proprofs.com/survey/t/?title=what-is-the-usage-policy-for-bt-email_2$all
Filter updated: Thu, 05 Aug 2021 00:02:05 +0000
2021-08-05 00:02:05 +00:00
||proprofs.com/survey/t/?title=x5wo8$all
Filter updated: Mon, 26 Jul 2021 00:02:16 +0000
2021-07-26 00:02:17 +00:00
||proprofs.com/survey/t/?title=xnvq4$all
Filter updated: Fri, 22 Jan 2021 00:06:31 UTC
2021-01-22 00:06:31 +00:00
||prosto-i-vkusno.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||prosupportteamdhlexp.com$all
Filter updated: Mon, 16 Aug 2021 12:01:42 +0000
2021-08-16 12:01:42 +00:00
||prosxsiuser.myfreesites.net$all
Filter updated: Wed, 22 Sep 2021 12:01:56 +0000
2021-09-22 12:01:56 +00:00
||protect-4d56vca.surge.sh$all
Filter updated: Mon, 08 Feb 2021 00:06:40 UTC
2021-02-08 00:06:40 +00:00
||protect.sabzgoltab.com$all
Filter updated: Wed, 07 Oct 2020 00:06:26 UTC
2020-10-07 00:06:27 +00:00
||protect.theresortweddings.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||protect2.fireeye.com/url?k=1d4614ec17334d4a.1d465a2d-45b66b5f372e82c4&u=http://www.standrew.co.kr/bluead/editor/uploaded/img/caslog1/cas.auth.sc.edu/uofsc.html$all
Filter updated: Sun, 27 Dec 2020 12:06:31 UTC
2020-12-27 12:06:31 +00:00
||protection-newpayee-halifax.com$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||protectyouraccount.updatethejpamazon.club$all
Filter updated: Tue, 31 Aug 2021 00:01:55 +0000
2021-08-31 00:01:55 +00:00
||proteksion-accts1321sdsd.cf$all
Filter updated: Sat, 06 Feb 2021 00:06:52 UTC
2021-02-06 00:06:53 +00:00
||protelesis.cl$all
Filter updated: Sat, 29 May 2021 12:06:18 UTC
2021-05-29 12:06:19 +00:00
||proton-mail.fr$all
Filter updated: Mon, 24 May 2021 00:06:37 UTC
2021-05-24 00:06:37 +00:00
||provideronline.site$all
Filter updated: Sat, 11 Sep 2021 00:34:15 +0000
2021-09-11 00:34:15 +00:00
||provimedsupplies.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||proxima-net.com/0193/webscr$all
Filter updated: Thu, 03 Sep 2020 12:06:37 UTC
2020-09-03 12:06:37 +00:00
||proxima-net.com/0193/webscr/$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||proxxx18th.duckdns.org$all
Filter updated: Sun, 18 Jul 2021 00:02:04 +0000
2021-07-18 00:02:04 +00:00
||pruebamaricoyo.hostfree.pw$all
||pruebaparami.hostfree.pw$all
||pruebaparayo.byethost7.com$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||pruebassitio.unaux.com$all
Filter updated: Wed, 19 May 2021 00:06:43 UTC
2021-05-19 00:06:44 +00:00
||pse.is/amazon_co_jp$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||psupport.apple.com.pple.com$all
Filter updated: Mon, 26 Jul 2021 00:02:16 +0000
2021-07-26 00:02:17 +00:00
||pt08.com$all
Filter updated: Wed, 23 Jun 2021 00:06:32 +0000
2021-06-23 00:06:32 +00:00
||ptn.co.id$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||pub43.bravenet.com/emailfwd/show.php?usernum=3669541711&formid=3811$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||pubg88.com$all
||pubgmcleren.mrslove.com$all
||pubgmxrunict.com$all
Filter updated: Wed, 21 Jul 2021 00:01:57 +0000
2021-07-21 00:01:57 +00:00
||publisan6373.byethost14.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||publishers.chloedigital.com$all
Filter updated: Thu, 22 Jul 2021 00:01:54 +0000
2021-07-22 00:01:54 +00:00
||puciss.hyperphp.com$all
Filter updated: Thu, 28 Jan 2021 12:06:44 UTC
2021-01-28 12:06:44 +00:00
||puffing.com.pk$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||pulsebounce.top$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||punchdancestudio.com$all
Filter updated: Sun, 28 Mar 2021 00:07:02 UTC
2021-03-28 00:07:03 +00:00
||puntobohemio.com$all
Filter updated: Mon, 20 Sep 2021 12:02:05 +0000
2021-09-20 12:02:05 +00:00
||purgerassociateships.info$all
||purgerdivulsed.info$all
Filter updated: Fri, 27 Aug 2021 00:01:47 +0000
2021-08-27 00:01:47 +00:00
||puroteksion-acctssds1321d.cf$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||purusharthsociety.org$all
Filter updated: Sun, 11 Jul 2021 12:01:37 +0000
2021-07-11 12:01:38 +00:00
||purves-jcatkinson.co.uk$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||pusat-facebook43.webnode.com$all
Filter updated: Tue, 31 Aug 2021 12:01:54 +0000
2021-08-31 12:01:54 +00:00
||putsubtle.top$all
Filter updated: Sat, 14 Aug 2021 00:01:49 +0000
2021-08-14 00:01:49 +00:00
||puul.ga$all
Filter updated: Sat, 29 May 2021 12:06:18 UTC
2021-05-29 12:06:19 +00:00
||pvgzfgmab0j.typeform.com$all
Filter updated: Wed, 28 Jul 2021 12:01:46 +0000
2021-07-28 12:01:46 +00:00
||pvppphpodkeipndncukxwvisym-dot-goff039302032323.rj.r.appspot.com$all
Filter updated: Thu, 20 May 2021 00:06:43 UTC
2021-05-20 00:06:44 +00:00
||pwpbzbyhpxjfaaufoeqzqpqmj.rockcoastclothing.com$all
Filter updated: Sat, 11 Sep 2021 00:34:15 +0000
2021-09-11 00:34:15 +00:00
||pxlme.me/eg8osty0/$all
Filter updated: Sat, 04 Sep 2021 12:01:40 +0000
2021-09-04 12:01:40 +00:00
||pxlme.me/pfbgzhkd$all
Filter updated: Fri, 25 Jun 2021 00:06:14 +0000
2021-06-25 00:06:14 +00:00
||pxlme.me/umjjyvmr$all
Filter updated: Mon, 05 Apr 2021 12:06:40 UTC
2021-04-05 12:06:40 +00:00
||pytlo.com$all
Filter updated: Wed, 22 Sep 2021 12:01:56 +0000
2021-09-22 12:01:56 +00:00
||pzzjg.cn$all
Filter updated: Sat, 12 Sep 2020 00:07:13 UTC
2020-09-12 00:07:13 +00:00
||q06huk.webwave.dev$all
Filter updated: Fri, 30 Jul 2021 12:01:52 +0000
2021-07-30 12:01:52 +00:00
||q5ar4.skipdns.link$all
Filter updated: Mon, 16 Aug 2021 12:01:42 +0000
2021-08-16 12:01:42 +00:00
||q6g474zyu9y.typeform.com$all
Filter updated: Wed, 09 Sep 2020 12:06:53 UTC
2020-09-09 12:06:53 +00:00
||qare.nl$all
||qare.nl/0/?i=i&0=info@google.com$all
Filter updated: Sun, 18 Apr 2021 12:06:55 UTC
2021-04-18 12:06:55 +00:00
||qbocd.csb.app$all
Filter updated: Tue, 31 Aug 2021 00:01:55 +0000
2021-08-31 00:01:55 +00:00
||qlgu1.codesandbox.io$all
Filter updated: Sat, 04 Sep 2021 00:17:00 +0000
2021-09-04 00:17:00 +00:00
||qpladccdthtvvpig-dot-sync-request-web-support.uk.r.appspot.com$all
Filter updated: Mon, 16 Aug 2021 00:01:59 +0000
2021-08-16 00:01:59 +00:00
||qrew5i.tk$all
Filter updated: Fri, 15 Jan 2021 00:06:14 UTC
2021-01-15 00:06:14 +00:00
||qsdqsx.ns12-wistee.fr$all
Filter updated: Sat, 09 Jan 2021 12:06:41 UTC
2021-01-09 12:06:41 +00:00
||quad-as.de$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||quadfabrik.de$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||qualitasc-my.sharepoint.com/personal/lrodriguez_qualita_es/_layouts/15/wopiframe.aspx?guestaccesstoken=x6egjunw ncgnemfdqjrmoajqkuc9c41sq13edqfoeu=&docid=1_16dc35173dd06466fa8c37e332833f0bd&wdformid={67d0feef-08d4-4d0a-8a25-0d2c9b0a2eed}/&action=formsubmit$all
||qualitasc-my.sharepoint.com/personal/lrodriguez_qualita_es/_layouts/15/wopiframe.aspx?guestaccesstoken=x6egjunw%2bncgnemfdqjrmoajqkuc9c41sq13edqfoeu%3d&docid=1_16dc35173dd06466fa8c37e332833f0bd&wdformid=%7b67d0feef%2d08d4%2d4d0a%2d8a25%2d0d2c9b0a2eed%7d%2f&action=formsubmit$all
||qualitasc-my.sharepoint.com/personal/lrodriguez_qualita_es/_layouts/15/wopiframe.aspx?guestaccesstoken=x6egjunw%2bncgnemfdqjrmoajqkuc9c41sq13edqfoeu%3d&docid=1_16dc35173dd06466fa8c37e332833f0bd&wdformid=%7b67d0feef%2d08d4%2d4d0a%2d8a25%2d0d2c9b0a2eed%7d%3e%2f&action=formsubmit$all
||qualitasc-my.sharepoint.com/personal/lrodriguez_qualita_es/_layouts/15/wopiframe.aspx?guestaccesstoken=x6egjunw%2bncgnemfdqjrmoajqkuc9c41sq13edqfoeu%3d&docid=1_16dc35173dd06466fa8c37e332833f0bd&wdformid=%7b67d0feef%2d08d4%2d4d0a%2d8a25%2d0d2c9b0a2eed%7d&action=formsubmit$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||qualitroge.weebly.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||qubectravel.com$all
Filter updated: Fri, 24 Sep 2021 00:01:50 +0000
2021-09-24 00:01:51 +00:00
||quiet-moji-1452.gonna.jp$all
Filter updated: Fri, 25 Sep 2020 12:06:47 UTC
2020-09-25 12:06:47 +00:00
||quinaroja.com$all
Filter updated: Sat, 06 Feb 2021 00:06:52 UTC
2021-02-06 00:06:53 +00:00
||quintanaevents.co$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||quip.com/qv7malu8n7cz/you-have-some-messages-pending$all
Filter updated: Sun, 19 Sep 2021 00:02:16 +0000
2021-09-19 00:02:17 +00:00
||quipianura.bg.it$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||quota.creatorlink.net$all
Filter updated: Sat, 13 Feb 2021 00:06:47 UTC
2021-02-13 00:06:47 +00:00
||qw4g5w3sl31.typeform.com$all
Filter updated: Sat, 08 May 2021 12:06:36 UTC
2021-05-08 12:06:36 +00:00
||qwikkar.com$all
Filter updated: Thu, 09 Sep 2021 12:02:27 +0000
2021-09-09 12:02:27 +00:00
||qwywtxyyzmmztxiznpecgvngnv-dot-goff039302032323.rj.r.appspot.com$all
Filter updated: Wed, 02 Jun 2021 00:06:23 UTC
2021-06-02 00:06:23 +00:00
||r-web-2a3a9.web.app#bucky@prepaidlegal.com$all
||r-web-2a3a9.web.app#ewhalley@prepaidlegal.com$all
Filter updated: Wed, 21 Jul 2021 12:01:49 +0000
2021-07-21 12:01:49 +00:00
||r-web-2a3a9.web.app#mike_tracy@prepaidlegal.com$all
Filter updated: Wed, 02 Jun 2021 00:06:23 UTC
2021-06-02 00:06:23 +00:00
||r-web-2a3a9.web.app#verg_yazzie@prepaidlegal.com$all
Filter updated: Fri, 21 May 2021 12:06:31 UTC
2021-05-21 12:06:31 +00:00
||r.nl.enamora.de$all
Filter updated: Tue, 01 Jun 2021 12:06:34 UTC
2021-06-01 12:06:34 +00:00
||r.smore.com/c?u=https://yanamholidays.com/b00-b26n5-82m-c04b-o84v-13h-e66-t38e-c90?m5=eric.stockland@iextrading.com$all
Filter updated: Fri, 24 Sep 2021 12:02:36 +0000
2021-09-24 12:02:36 +00:00
||r.versorecto.org$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||r2.ddlnk.net$all
Filter updated: Tue, 17 Aug 2021 00:02:45 +0000
2021-08-17 00:02:45 +00:00
||r2.dotdigital-pages.com/p/74kv-45k$all
Filter updated: Fri, 23 Oct 2020 00:06:28 UTC
2020-10-23 00:06:29 +00:00
||r2l.com.mx$all
Filter updated: Wed, 01 Sep 2021 00:02:20 +0000
2021-09-01 00:02:20 +00:00
||r3g34.fra1.digitaloceanspaces.com/77ll23ween.html$all
Filter updated: Fri, 24 Sep 2021 00:01:50 +0000
2021-09-24 00:01:51 +00:00
||r3qp3rcsrrch044psduser.sgp1.digitaloceanspaces.com/index.html$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||r7vfe.csb.app$all
Filter updated: Sat, 28 Aug 2021 00:33:51 +0000
2021-08-28 00:33:51 +00:00
||ra12s.hyperphp.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||rabofree.blogspot.com$all
Filter updated: Thu, 18 Feb 2021 12:07:12 UTC
2021-02-18 12:07:12 +00:00
||rabofree.blogspot.com/2020/05$all
||rabofree.blogspot.com/2020/05?m=1$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||rabofree.blogspot.com/2020?m=1$all
Filter updated: Mon, 08 Mar 2021 00:11:13 UTC
2021-03-08 00:11:13 +00:00
||rabofree.blogspot.li$all
Filter updated: Sat, 06 Mar 2021 12:06:21 UTC
2021-03-06 12:06:21 +00:00
||rackenfordlabs.com$all
Filter updated: Tue, 18 May 2021 00:06:34 UTC
2021-05-18 00:06:34 +00:00
||racuncinta-indonesia.com$all
Filter updated: Sat, 13 Feb 2021 12:06:55 UTC
2021-02-13 12:06:55 +00:00
||radforddoors.cl$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||raising-fresh-consensus-assumptions.trycloudflare.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||rajwebtechnology.com$all
Filter updated: Fri, 27 Aug 2021 12:01:40 +0000
2021-08-27 12:01:40 +00:00
||rakoten-co-jp.auqu0ei.cf$all
Filter updated: Wed, 15 Sep 2021 12:01:46 +0000
2021-09-15 12:01:46 +00:00
||rakoten-co-jp.az4mod.ml$all
Filter updated: Wed, 18 Aug 2021 00:01:50 +0000
2021-08-18 00:01:50 +00:00
||rakoten-co-jp.hsb0ku.cf$all
Filter updated: Thu, 09 Sep 2021 12:02:27 +0000
2021-09-09 12:02:27 +00:00
||rakoten-co-jp.ldx3f7.cf$all
Filter updated: Fri, 27 Aug 2021 00:01:47 +0000
2021-08-27 00:01:47 +00:00
||rakoten-co-jp.ltwqbq8.gq$all
Filter updated: Wed, 22 Sep 2021 12:01:56 +0000
2021-09-22 12:01:56 +00:00
||rakoten-co-jp.ow8bda1.cf$all
||rakoten-co-jp.ow8bda1.ga$all
Filter updated: Thu, 26 Aug 2021 12:02:31 +0000
2021-08-26 12:02:31 +00:00
||rakoten-co-jp.ow8bda1.gq$all
Filter updated: Sat, 24 Jul 2021 12:01:38 +0000
2021-07-24 12:01:38 +00:00
||rakoten.co.ip.8euq3pq.gq$all
Filter updated: Mon, 02 Aug 2021 00:02:18 +0000
2021-08-02 00:02:18 +00:00
||rakoten.co.ip.8euq3pq.ml$all
Filter updated: Sat, 24 Jul 2021 12:01:38 +0000
2021-07-24 12:01:38 +00:00
||rakoten.co.ip.w2qtjwo.cf$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||rakotol.cf$all
||rakotol.ga$all
||rakotol.gq$all
||rakotol.ml$all
||rakotsv.ga$all
||rakotvn.tk$all
Filter updated: Thu, 17 Jun 2021 00:06:32 +0000
2021-06-17 00:06:32 +00:00
||raktraphyp.byethost7.com$all
Filter updated: Wed, 07 Jul 2021 12:01:55 +0000
2021-07-07 12:01:56 +00:00
||rakuten.co.jp.oadkxoe.cf$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||ramgarhiamatrimonial.ca$all
Filter updated: Tue, 22 Jun 2021 12:06:51 +0000
2021-06-22 12:06:51 +00:00
||ranchosanantonio5m.com$all
Filter updated: Fri, 24 Sep 2021 12:02:36 +0000
2021-09-24 12:02:36 +00:00
||ranjplay.com$all
Filter updated: Thu, 19 Aug 2021 12:02:33 +0000
2021-08-19 12:02:33 +00:00
||rap.coffee$all
Filter updated: Tue, 14 Sep 2021 00:01:48 +0000
2021-09-14 00:01:48 +00:00
||rappel-authentification-ecoute.freeweb.pk$all
Filter updated: Wed, 18 Aug 2021 12:02:35 +0000
2021-08-18 12:02:36 +00:00
||razcdf.ultimatefreehost.in$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||rb.gy/n9mu3v/$all
Filter updated: Thu, 26 Aug 2021 12:02:31 +0000
2021-08-26 12:02:31 +00:00
||rbcmontgomery.com$all
Filter updated: Wed, 22 Sep 2021 00:02:26 +0000
2021-09-22 00:02:26 +00:00
||rbcroyalbanc.com$all
Filter updated: Thu, 09 Sep 2021 00:01:56 +0000
2021-09-09 00:01:56 +00:00
||rcproductionsjm.com$all
Filter updated: Thu, 05 Aug 2021 12:01:57 +0000
2021-08-05 12:01:57 +00:00
||rcweb-domain.web.app#living@zilch.nl$all
Filter updated: Thu, 26 Nov 2020 00:06:18 UTC
2020-11-26 00:06:18 +00:00
||rd8um.app.link$all
Filter updated: Wed, 20 Jan 2021 12:06:49 UTC
2021-01-20 12:06:49 +00:00
||rdeshapriya.com$all
Filter updated: Sat, 06 Feb 2021 00:06:52 UTC
2021-02-06 00:06:53 +00:00
||re-direct-me.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||re-redirection-acc-id923872635122.blogspot.com$all
||re-redirection-pp-account-id98763432.blogspot.com$all
Filter updated: Tue, 13 Apr 2021 12:07:03 UTC
2021-04-13 12:07:03 +00:00
||re4nm.csb.app$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||react-ba2roi.stackblitz.io$all
Filter updated: Tue, 13 Apr 2021 00:06:31 UTC
2021-04-13 00:06:31 +00:00
||real-estate-page-id-8821973834.theblucompany.com$all
Filter updated: Mon, 23 Nov 2020 12:06:43 UTC
2020-11-23 12:06:44 +00:00
||real.de.seller.bookings.siharkaboy.boyolali.go.id$all
Filter updated: Tue, 01 Dec 2020 12:06:48 UTC
2020-12-01 12:06:48 +00:00
||realclub.de$all
Filter updated: Fri, 13 Nov 2020 12:06:52 UTC
2020-11-13 12:06:52 +00:00
||realcodashopfreediamonds.freeddns.com$all
Filter updated: Sat, 10 Apr 2021 12:07:15 UTC
2021-04-10 12:07:15 +00:00
||realestate-page-homes.com$all
Filter updated: Fri, 30 Apr 2021 00:08:30 UTC
2021-04-30 00:08:30 +00:00
||realestateagentlisting.tv$all
Filter updated: Wed, 14 Apr 2021 12:07:09 UTC
2021-04-14 12:07:09 +00:00
||realfrischegarantie.de$all
||realhypermarket.me$all
Filter updated: Sun, 13 Dec 2020 12:06:42 UTC
2020-12-13 12:06:42 +00:00
||realmoneysend.com$all
Filter updated: Fri, 27 Nov 2020 12:06:59 UTC
2020-11-27 12:06:59 +00:00
||realrenderstudio.it$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||rebrand.ly/3ads20$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||rebrand.ly/4ewuy20$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||rebrand.ly/4yc7w4o$all
||rebrand.ly/668b5$all
Filter updated: Wed, 21 Oct 2020 12:06:42 UTC
2020-10-21 12:06:42 +00:00
||rebrand.ly/8k8kt$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||rebrand.ly/96s871$all
||rebrand.ly/a7n4y3x$all
Filter updated: Wed, 16 Sep 2020 12:06:34 UTC
2020-09-16 12:06:34 +00:00
||rebrand.ly/ahcz51u$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||rebrand.ly/k544hkl$all
||rebrand.ly/kt913mi$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||rebrand.ly/w1lrupp$all
Filter updated: Tue, 13 Jul 2021 00:02:30 +0000
2021-07-13 00:02:30 +00:00
||rebrand.ly/wjqi04k$all
Filter updated: Mon, 19 Apr 2021 00:06:54 UTC
2021-04-19 00:06:54 +00:00
||rebrand.ly/z83ig2n?rb.routing.mode=proxy&rb.routing.signature=123 836$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||rebrand.ly/zikqv8f?email=eimaste@stinpriza.org&domain=stinpriza.orgwebapp*$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||rebrand.ly/zitln6v$all
Filter updated: Wed, 15 Sep 2021 00:01:54 +0000
2021-09-15 00:01:55 +00:00
||recallvapor.top$all
Filter updated: Fri, 10 Sep 2021 00:02:17 +0000
2021-09-10 00:02:17 +00:00
||recapitulex.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||rechovaliyah.com$all
Filter updated: Mon, 16 Aug 2021 12:01:42 +0000
2021-08-16 12:01:42 +00:00
||recidivism-apostrop.000webhostapp.com$all
Filter updated: Tue, 06 Apr 2021 00:06:40 UTC
2021-04-06 00:06:40 +00:00
||reconfirmpost287846656.us$all
Filter updated: Fri, 24 Sep 2021 00:01:50 +0000
2021-09-24 00:01:51 +00:00
||records-tokyo.servepics.com$all
Filter updated: Thu, 22 Jul 2021 00:01:54 +0000
2021-07-22 00:01:54 +00:00
||recoveraccount0.byethost3.com$all
Filter updated: Mon, 12 Apr 2021 12:08:04 UTC
2021-04-12 12:08:04 +00:00
||recovered-activity-page-cover.my.id$all
Filter updated: Tue, 23 Feb 2021 00:06:26 UTC
2021-02-23 00:06:26 +00:00
||recoverinst.ru$all
Filter updated: Thu, 04 Feb 2021 00:06:18 UTC
2021-02-04 00:06:18 +00:00
||recso.org$all
Filter updated: Fri, 27 Aug 2021 12:01:40 +0000
2021-08-27 12:01:40 +00:00
||recuperoradiosondeitalia.eu$all
Filter updated: Fri, 15 Jan 2021 00:06:14 UTC
2021-01-15 00:06:14 +00:00
||redbysfrgroupebox.myfreesites.net$all
Filter updated: Wed, 07 Oct 2020 00:06:26 UTC
2020-10-07 00:06:27 +00:00
||reddotarms.com$all
Filter updated: Tue, 07 Sep 2021 00:01:46 +0000
2021-09-07 00:01:46 +00:00
||redeem-microsoft-code.sitey.me$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||rediractionid547012016089540218057.blogspot.com$all
Filter updated: Tue, 31 Aug 2021 12:01:54 +0000
2021-08-31 12:01:54 +00:00
||redirect.viglink.com/?ed&key=fd5de1d096b38be9fffd6ddc1948df4f&u=%61%70%69%2e%61%64%64%74%68%69%73%2e%63%6f%6d%2f%6f%65%78%63%68%61%6e%67%65%2f%30%2e%38%2f%77%72%61%70%2f%6f%70%65%6e%67%72%61%70%68%e2%80%8c%75%72%6c%3dahr0chm6ly9ua3yuchvil3h5nt9sdwvlchpyanvtegtvdnpjzxhqehn2dgdnzm5hbhntewp3bwtwdnb0cxl2awvozxnjewnvdxvkywzkcm9za2tqamviyxpnjmfsdd1tzwrpysnkmlzpyldgemrhvnlrr04xym1rdvkzbz0=$all
Filter updated: Thu, 05 Aug 2021 12:01:57 +0000
2021-08-05 12:01:57 +00:00
||redirect.viglink.com?%uf%rj%fx%u3&key=fd5de1d096b38be9fffd6ddc1948df4f&u=%61%70%69%2e%61%64%64%74%68%69%73%2e%63%6f%6d%2f%6f%65%78%63%68%61%6e%67%65%2f%30%2e%38%2f%77%72%61%70%2f%6f%70%65%6e%67%72%61%70%68%e2%80%8c%75%72%6c%3dahr0chm6ly9ua3yuchvil3h5nt83oet4elzsag1mzndzjmfsdd1tzwrpysnav2x0wvhomfpvqnpkr2x1y0hkcgvtrxvim0puolbcy3ppmu4yzgrladg2ennfduhvdu02qxphujjmuhv5zw5ork5ecvu=$all
Filter updated: Tue, 31 Aug 2021 12:01:54 +0000
2021-08-31 12:01:54 +00:00
||redirect.voici-news.fr$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||redirect.voici-news.fr/p-351075-95303b56fd8597a1946dc433811ae477-239262-78/?cl=1&n=39&l=o&u=https%3a%2f%2fwww.google.com%2furl%3fsa%3dt%26rct%3dj%26q%3d%26esrc%3ds%26source%3dweb%26cd%3d%26cad%3drja%26uact%3d8%26ved%3d2ahukewiz1pcljixqahweoxekhqkhbggqfjacegqiarab%26url%3dhttps%253a%252f%252fwww.lab4rent.it%252fofferte%252fhonda-sh-150-abs-bauletto-e-parabrezza%252f%26usg%3daovvaw0uufychhtdy_ozq1pxdtip$all
Filter updated: Tue, 14 Sep 2021 12:01:44 +0000
2021-09-14 12:01:44 +00:00
||reditscbydeden82.duckdns.org$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||redlinerecruitment353-my.sharepoint.com:443/:o:/g/personal/beverley_latham_redlinerecruitment_com/elyngikq5ufbqvwgcsqwtt4b1njgntt_lj45lr_y-735iw?e=5%3ajitv78&at=9$all
||redlinerecruitment353-my.sharepoint.com:443/:o:/g/personal/beverley_latham_redlinerecruitment_com/elyngikq5ufbqvwgcsqwtt4b1njgntt_lj45lr_y-735iw?e=5:jitv78&at=9$all
Filter updated: Wed, 11 Aug 2021 00:01:55 +0000
2021-08-11 00:01:55 +00:00
||redpichinfa.byethost7.com$all
Filter updated: Mon, 20 Sep 2021 12:02:05 +0000
2021-09-20 12:02:05 +00:00
||redtoptegmina.info$all
Filter updated: Fri, 19 Feb 2021 00:06:27 UTC
2021-02-19 00:06:28 +00:00
||reebe.snprobbx.pbz.r.de.a2ip.ru$all
Filter updated: Fri, 07 May 2021 12:12:56 UTC
2021-05-07 12:12:56 +00:00
||referral.hosannahfministry.com.ng$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||reg-tool.europe-air-sports.org$all
Filter updated: Fri, 24 Sep 2021 00:01:50 +0000
2021-09-24 00:01:51 +00:00
||regeninfraservices.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||regina.ninetendev.com$all
Filter updated: Sun, 04 Jul 2021 12:01:42 +0000
2021-07-04 12:01:42 +00:00
||regionpostalelogsession.zyrosite.com$all
Filter updated: Sat, 06 Mar 2021 00:09:39 UTC
2021-03-06 00:09:39 +00:00
||register-my-device.com$all
Filter updated: Fri, 02 Apr 2021 00:06:35 UTC
2021-04-02 00:06:36 +00:00
||register-page-certificated-000447.my.id$all
Filter updated: Sat, 22 May 2021 12:07:44 UTC
2021-05-22 12:07:44 +00:00
||registerpichinch.ihostfull.com$all
Filter updated: Fri, 23 Jul 2021 00:03:07 +0000
2021-07-23 00:03:07 +00:00
||registery001.byethost6.com$all
Filter updated: Sat, 29 May 2021 00:06:23 UTC
2021-05-29 00:06:23 +00:00
||registrdatapichi.ihostfull.com$all
Filter updated: Thu, 23 Sep 2021 00:02:18 +0000
2021-09-23 00:02:18 +00:00
||registroslbknet.com/cliente$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||regrets.fun$all
Filter updated: Wed, 21 Jul 2021 00:01:57 +0000
2021-07-21 00:01:57 +00:00
||reistermyrushcard.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||rekapuolam.blogspot.com$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||rektuen.nunmou.com$all
Filter updated: Fri, 24 Sep 2021 12:02:36 +0000
2021-09-24 12:02:36 +00:00
||rekutanjpy.jp$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||release-8373-mime-cast-e737737.s3.us-west-002.backblazeb2.com$all
Filter updated: Thu, 01 Apr 2021 00:06:39 UTC
2021-04-01 00:06:40 +00:00
||relevant.systems$all
Filter updated: Tue, 14 Sep 2021 00:01:48 +0000
2021-09-14 00:01:48 +00:00
||reliabletaxservices.net$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||remedy-towns-dust-insects.trycloudflare.com$all
Filter updated: Thu, 22 Apr 2021 12:08:20 UTC
2021-04-22 12:08:20 +00:00
||remillardconsulting.com$all
Filter updated: Wed, 10 Mar 2021 12:10:46 UTC
2021-03-10 12:10:46 +00:00
||remittance369297292749.goshly.com$all
Filter updated: Fri, 12 Feb 2021 00:06:27 UTC
2021-02-12 00:06:27 +00:00
||remove-device.shop$all
Filter updated: Sat, 06 Mar 2021 12:06:21 UTC
2021-03-06 12:06:21 +00:00
||rempitem.agilecrm.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||remsy.app.link$all
||rencon.ch.net2care.com$all
Filter updated: Fri, 20 Aug 2021 00:01:56 +0000
2021-08-20 00:01:56 +00:00
||rendangunitutie.com$all
Filter updated: Tue, 14 Sep 2021 00:01:48 +0000
2021-09-14 00:01:48 +00:00
||renew.trusted-travelers-online.com$all
Filter updated: Fri, 24 Sep 2021 12:02:36 +0000
2021-09-24 12:02:36 +00:00
||rentalconnectioninc-rz.tk$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||repl-mess.myfreesites.net$all
Filter updated: Sat, 10 Jul 2021 00:01:42 +0000
2021-07-10 00:01:42 +00:00
||replilixecupiac0.byethost15.com$all
Filter updated: Mon, 22 Mar 2021 12:06:55 UTC
2021-03-22 12:06:55 +00:00
||replug.link$all
Filter updated: Wed, 03 Mar 2021 00:08:05 UTC
2021-03-03 00:08:05 +00:00
||request-payee-now.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||resbet.blogspot.com$all
||resbetsgiris.blogspot.com$all
Filter updated: Wed, 18 Aug 2021 00:01:50 +0000
2021-08-18 00:01:50 +00:00
||rescueforgivenreliefprogram.org$all
Filter updated: Fri, 19 Feb 2021 00:06:27 UTC
2021-02-19 00:06:28 +00:00
||reset-billing-address.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||restbetgir1.blogspot.com$all
||restbetgirisadresimiz.blogspot.com$all
||restbetgirisadresimiz1.blogspot.com$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||restorenetfllx.com$all
Filter updated: Mon, 04 Jan 2021 12:06:21 UTC
2021-01-04 12:06:21 +00:00
||restricted-newonline-payee.net$all
Filter updated: Sun, 17 Jan 2021 00:06:45 UTC
2021-01-17 00:06:45 +00:00
||restricted-newpayee.com$all
Filter updated: Tue, 13 Jul 2021 00:02:30 +0000
2021-07-13 00:02:30 +00:00
||resu.page.link$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||resuco.net/images/dir/ing/$all
Filter updated: Tue, 01 Dec 2020 12:06:48 UTC
2020-12-01 12:06:48 +00:00
||retraiteenaction.ca$all
Filter updated: Wed, 15 Sep 2021 00:01:54 +0000
2021-09-15 00:01:55 +00:00
||retrospectiveplanningenforcementwestsussex.co.uk$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||return.serveftp.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||reurl.cc/1xrr1y$all
||reurl.cc/brkoqe$all
Filter updated: Mon, 26 Apr 2021 12:07:30 UTC
2021-04-26 12:07:30 +00:00
||reurl.cc/dvk4gd$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||reurl.cc/gvjolp?co=muj3e$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||reurl.cc/jdegy2$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||reurl.cc/oleeqj$all
||reurl.cc/qd7na2$all
Filter updated: Fri, 30 Apr 2021 00:08:30 UTC
2021-04-30 00:08:30 +00:00
||reurl.cc/xgmxr1$all
Filter updated: Wed, 25 Aug 2021 12:02:06 +0000
2021-08-25 12:02:07 +00:00
||review-guilfordcountync.tk$all
Filter updated: Wed, 10 Mar 2021 12:10:46 UTC
2021-03-10 12:10:46 +00:00
||review-mynew-device.com$all
Filter updated: Wed, 24 Mar 2021 12:06:42 UTC
2021-03-24 12:06:42 +00:00
||review-page-activation-2021.my.id$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||revisioneconfigurazione-clienti.000webhostapp.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||revrosary.org$all
Filter updated: Sun, 19 Sep 2021 00:02:16 +0000
2021-09-19 00:02:17 +00:00
||reward-garena-freefireff.blogspot.com$all
Filter updated: Tue, 18 May 2021 00:06:34 UTC
2021-05-18 00:06:34 +00:00
||rewindingshop.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||rextraening.dk$all
Filter updated: Mon, 19 Apr 2021 00:06:54 UTC
2021-04-19 00:06:54 +00:00
||rguga.ro$all
Filter updated: Tue, 03 Aug 2021 00:01:58 +0000
2021-08-03 00:01:58 +00:00
||rhinodriedfruit.co.za/xwixwixwixwi$all
Filter updated: Tue, 03 Aug 2021 12:01:54 +0000
2021-08-03 12:01:54 +00:00
||rhinodriedfruit.co.za/xwixwixwixwi/$all
Filter updated: Wed, 14 Apr 2021 12:07:09 UTC
2021-04-14 12:07:09 +00:00
||rhinomultimedia.com$all
Filter updated: Sat, 31 Jul 2021 00:01:51 +0000
2021-07-31 00:01:51 +00:00
||rhrinternational.carambola.cl$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||riattiva-credem.000webhostapp.com$all
Filter updated: Mon, 07 Jun 2021 12:06:42 UTC
2021-06-07 12:06:42 +00:00
||richardbashara.com$all
Filter updated: Tue, 02 Mar 2021 00:09:11 UTC
2021-03-02 00:09:11 +00:00
||riderctposten.blogspot.com/2021/02/blog-post.html$all
Filter updated: Sat, 28 Aug 2021 00:33:51 +0000
2021-08-28 00:33:51 +00:00
||rightdiary.top$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||riptideoperation.com$all
Filter updated: Fri, 16 Jul 2021 12:01:57 +0000
2021-07-16 12:01:57 +00:00
||ritik33.github.io$all
Filter updated: Sat, 10 Apr 2021 00:06:30 UTC
2021-04-10 00:06:30 +00:00
||riversweeps.org$all
Filter updated: Tue, 24 Nov 2020 12:06:52 UTC
2020-11-24 12:06:52 +00:00
||rizkyinterior.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||rj1kx.app.link$all
Filter updated: Sat, 04 Sep 2021 00:17:00 +0000
2021-09-04 00:17:00 +00:00
||rjagqp.work$all
Filter updated: Tue, 07 Sep 2021 12:01:49 +0000
2021-09-07 12:01:49 +00:00
||rkanet.com$all
Filter updated: Fri, 19 Feb 2021 00:06:27 UTC
2021-02-19 00:06:28 +00:00
||rkgreany-seg3-2.kk.sopqa.arg.r.de.a2ip.ru$all
Filter updated: Thu, 02 Sep 2021 00:01:59 +0000
2021-09-02 00:01:59 +00:00
||rkhotels.in$all
Filter updated: Tue, 14 Sep 2021 00:01:48 +0000
2021-09-14 00:01:48 +00:00
||rlink.vn$all
Filter updated: Mon, 24 May 2021 12:06:37 UTC
2021-05-24 12:06:37 +00:00
||rm-parcel11429-uk.com$all
Filter updated: Tue, 15 Jun 2021 12:29:08 UTC
2021-06-15 12:29:08 +00:00
||rm-shippingprocess.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||rmact-my.sharepoint.com/:x:/r/personal/srichlin_rmact_com/_layouts/15/wopiframe.aspx?guestaccesstoken=492wqqtzlbznzq7qdpemrme%2bi%2bhghqqnqlo250fbc9i%3d&docid=1_10c4e2ffbd9ec47cbbc6f0253baa7b64d&wdformid=%7b914c12ed%2d68e0%2d4419%2db8b0%2ded5f7e09de29%7d&action=formsubmit$all
Filter updated: Fri, 11 Dec 2020 12:06:48 UTC
2020-12-11 12:06:48 +00:00
||rmsfcc.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||rmzengenharia.blogspot.com$all
Filter updated: Sat, 29 May 2021 12:06:18 UTC
2021-05-29 12:06:19 +00:00
||rn3pc9bqfbv.typeform.com$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||rndom-vifd01.duckdns.org$all
Filter updated: Tue, 20 Apr 2021 00:06:42 UTC
2021-04-20 00:06:42 +00:00
||roadgo.co.uk$all
Filter updated: Tue, 13 Apr 2021 00:06:31 UTC
2021-04-13 00:06:31 +00:00
||roccobonheur1-my-cheetah-website-copy.cheetah.builderall.com$all
Filter updated: Thu, 02 Sep 2021 12:02:02 +0000
2021-09-02 12:02:02 +00:00
||rocketees.com$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||rocouaigiycsrueydjujronuaafrwncedmbuehht.yljxzx.cn$all
Filter updated: Fri, 05 Mar 2021 12:06:38 UTC
2021-03-05 12:06:38 +00:00
||rodinagermaniya.ru$all
Filter updated: Fri, 24 Sep 2021 12:02:36 +0000
2021-09-24 12:02:36 +00:00
||roisnoob.github.io$all
Filter updated: Tue, 17 Aug 2021 00:02:45 +0000
2021-08-17 00:02:45 +00:00
||roitcou.hyperphp.com$all
Filter updated: Tue, 13 Oct 2020 12:06:53 UTC
2020-10-13 12:06:53 +00:00
||rokutanm-ctmrrj.cc$all
Filter updated: Thu, 15 Oct 2020 00:06:34 UTC
2020-10-15 00:06:34 +00:00
||rokutanm-rrbrb.cc$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||roldanlogistica2-my.sharepoint.com/:o:/g/personal/comercial1_rolcoshipping_com1/eruuxky76yxlk7vzdfzrfzybicm0kmv7-914pwcpo9g4mq?e=ppogt$all
Filter updated: Mon, 12 Apr 2021 00:06:48 UTC
2021-04-12 00:06:48 +00:00
||rolinadd.surveysparrow.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||romatermit.ro$all
Filter updated: Sat, 12 Dec 2020 00:06:30 UTC
2020-12-12 00:06:30 +00:00
||rondelbarrilito.com$all
Filter updated: Sat, 30 Jan 2021 12:06:39 UTC
2021-01-30 12:06:39 +00:00
||ronigelo.blogspot.com/2020/10/roni-gelo.html$all
Filter updated: Mon, 13 Sep 2021 12:01:52 +0000
2021-09-13 12:01:52 +00:00
||rootburr.com$all
Filter updated: Tue, 20 Oct 2020 00:06:21 UTC
2020-10-20 00:06:21 +00:00
||rosalinas-initial-project-30ac52.webflow.io$all
Filter updated: Tue, 10 Aug 2021 00:01:49 +0000
2021-08-10 00:01:49 +00:00
||rotf.lol/verifikasifacebook$all
Filter updated: Sun, 17 Jan 2021 00:06:45 UTC
2021-01-17 00:06:45 +00:00
||rotimi.pandaform.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||rotseezunft.ch.tcorner.fr$all
Filter updated: Tue, 27 Jul 2021 00:02:10 +0000
2021-07-27 00:02:10 +00:00
||roundcube-production-cf.tx1.mailhostbox.com$all
Filter updated: Thu, 23 Sep 2021 00:02:18 +0000
2021-09-23 00:02:18 +00:00
||roundtreeconsulting.net$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||roupakids.blogspot.com$all
||roxburycommunitycolleg798-my.sharepoint.com:443/:b:/g/personal/enebelitsky_rcc_mass_edu/er4mnitiqezdprvsiljksn4bexpjqkfwl8c3bunhudv4ww?e=4%3a2anva6&at=9$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||royalpostcards.be$all
Filter updated: Sun, 15 Aug 2021 00:01:57 +0000
2021-08-15 00:01:57 +00:00
||royalwindsorpub.com$all
Filter updated: Tue, 31 Aug 2021 12:01:54 +0000
2021-08-31 12:01:54 +00:00
||rplg.co$all
Filter updated: Sun, 11 Oct 2020 12:06:44 UTC
2020-10-11 12:06:44 +00:00
||rreeufffsaussaa3.app.link$all
Filter updated: Sun, 01 Aug 2021 12:01:43 +0000
2021-08-01 12:01:43 +00:00
||rsdxpjtgqrzlacfootsbzolaqh-dot-gowa11111111.rj.r.appspot.com$all
Filter updated: Sun, 02 May 2021 00:06:30 UTC
2021-05-02 00:06:30 +00:00
||rseauxmobile01.ulcraft.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||rstools.club$all
Filter updated: Mon, 16 Aug 2021 12:01:42 +0000
2021-08-16 12:01:42 +00:00
||rudraksha-rsudraksh-rudrakshabead-rudrakshabeads.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||ruekrew.com$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||runescape-bond-event.com$all
Filter updated: Thu, 03 Sep 2020 12:06:37 UTC
2020-09-03 12:06:37 +00:00
||runescapeapk.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||runescapeservices.com$all
Filter updated: Sun, 15 Aug 2021 00:01:57 +0000
2021-08-15 00:01:57 +00:00
||runni24.byethost7.com$all
Filter updated: Fri, 09 Jul 2021 00:01:59 +0000
2021-07-09 00:01:59 +00:00
||runningbrooks.top$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||rush.myvnc.com$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||russianzimbragg.000webhostapp.com$all
Filter updated: Tue, 14 Sep 2021 00:01:48 +0000
2021-09-14 00:01:48 +00:00
||rust-charge.com$all
Filter updated: Wed, 08 Sep 2021 12:01:51 +0000
2021-09-08 12:01:51 +00:00
||rvices.runescape.com-m.ru$all
Filter updated: Wed, 22 Sep 2021 12:01:56 +0000
2021-09-22 12:01:56 +00:00
||ryonstravel.com$all
Filter updated: Sat, 13 Feb 2021 00:06:47 UTC
2021-02-13 00:06:47 +00:00
||s-paypalinfo.ml$all
Filter updated: Wed, 22 Sep 2021 12:01:56 +0000
2021-09-22 12:01:56 +00:00
||s-sniffer.ru$all
Filter updated: Thu, 03 Sep 2020 12:06:37 UTC
2020-09-03 12:06:37 +00:00
||s.free.fr$all
||s.id/2019conta$all
Filter updated: Thu, 03 Dec 2020 12:07:06 UTC
2020-12-03 12:07:06 +00:00
||s.id/abngeleid$all
Filter updated: Tue, 21 Sep 2021 00:01:40 +0000
2021-09-21 00:01:40 +00:00
||s.id/amex-homemerchant$all
Filter updated: Thu, 22 Jul 2021 00:01:54 +0000
2021-07-22 00:01:54 +00:00
||s.id/aoeje$all
Filter updated: Wed, 12 May 2021 12:06:30 UTC
2021-05-12 12:06:30 +00:00
||s.id/aw12n$all
Filter updated: Fri, 25 Jun 2021 12:06:17 +0000
2021-06-25 12:06:17 +00:00
||s.id/b-6ni$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||s.id/blessedhotega$all
Filter updated: Wed, 04 Aug 2021 00:02:10 +0000
2021-08-04 00:02:10 +00:00
||s.id/bnk2n$all
Filter updated: Tue, 22 Jun 2021 00:06:28 +0000
2021-06-22 00:06:29 +00:00
||s.id/brueh$all
Filter updated: Mon, 05 Jul 2021 12:02:12 +0000
2021-07-05 12:02:12 +00:00
||s.id/ck48o$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||s.id/cnivi$all
Filter updated: Tue, 13 Jul 2021 12:01:57 +0000
2021-07-13 12:01:57 +00:00
||s.id/cx6bz$all
Filter updated: Sat, 07 Aug 2021 00:20:48 +0000
2021-08-07 00:20:48 +00:00
||s.id/d4pyp/$all
Filter updated: Thu, 03 Sep 2020 12:06:37 UTC
2020-09-03 12:06:37 +00:00
||s.id/eelog$all
Filter updated: Mon, 19 Apr 2021 00:06:54 UTC
2021-04-19 00:06:54 +00:00
||s.id/fb_login$all
Filter updated: Thu, 09 Sep 2021 00:01:56 +0000
2021-09-09 00:01:56 +00:00
||s.id/fhzgr$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||s.id/fx9xc$all
Filter updated: Mon, 20 Sep 2021 12:02:05 +0000
2021-09-20 12:02:05 +00:00
||s.id/gi3wg$all
Filter updated: Fri, 24 Sep 2021 12:02:36 +0000
2021-09-24 12:02:36 +00:00
||s.id/gi3zf$all
Filter updated: Sun, 25 Apr 2021 00:06:33 UTC
2021-04-25 00:06:33 +00:00
||s.id/ing-update$all
Filter updated: Sat, 28 Aug 2021 12:01:47 +0000
2021-08-28 12:01:47 +00:00
||s.id/international-services$all
Filter updated: Mon, 21 Jun 2021 00:06:20 +0000
2021-06-21 00:06:20 +00:00
||s.id/kerosine8$all
Filter updated: Sun, 31 Jan 2021 00:06:53 UTC
2021-01-31 00:06:53 +00:00
||s.id/kpkkpkkpk$all
Filter updated: Tue, 06 Apr 2021 00:06:40 UTC
2021-04-06 00:06:40 +00:00
||s.id/login-fb$all
Filter updated: Mon, 19 Apr 2021 00:06:54 UTC
2021-04-19 00:06:54 +00:00
||s.id/login-fb?$all
Filter updated: Sun, 13 Dec 2020 00:06:49 UTC
2020-12-13 00:06:49 +00:00
||s.id/onlnedesk$all
Filter updated: Sat, 01 May 2021 12:06:37 UTC
2021-05-01 12:06:37 +00:00
||s.id/peringatan-fb$all
Filter updated: Tue, 03 Aug 2021 00:01:58 +0000
2021-08-03 00:01:58 +00:00
||s.id/roadrun3$all
Filter updated: Sat, 13 Feb 2021 00:06:47 UTC
2021-02-13 00:06:47 +00:00
||s.id/sparka-de$all
Filter updated: Wed, 25 Aug 2021 12:02:06 +0000
2021-08-25 12:02:07 +00:00
||s.id/super-cocovnla/$all
Filter updated: Sat, 30 Jan 2021 00:06:43 UTC
2021-01-30 00:06:43 +00:00
||s.id/woning$all
Filter updated: Thu, 11 Feb 2021 00:06:15 UTC
2021-02-11 00:06:15 +00:00
||s.id/woning-web$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||s.id/wpyih$all
||s.id/xsdbx$all
||s.id/xzod5$all
Filter updated: Tue, 02 Mar 2021 12:07:41 UTC
2021-03-02 12:07:42 +00:00
||s.id/yqnun$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||s.id/ytk-r$all
||s.id/yw5o-$all
||s.id/yz3zs$all
Filter updated: Thu, 15 Apr 2021 00:06:48 UTC
2021-04-15 00:06:48 +00:00
||s.id/zrg9b$all
Filter updated: Thu, 03 Sep 2020 12:06:37 UTC
2020-09-03 12:06:37 +00:00
||s.kekk.is$all
Filter updated: Mon, 30 Aug 2021 12:01:50 +0000
2021-08-30 12:01:51 +00:00
||s.luwank.com$all
Filter updated: Wed, 08 Sep 2021 00:02:08 +0000
2021-09-08 00:02:08 +00:00
||s.runescape.com-ov.ru$all
Filter updated: Sat, 18 Sep 2021 12:01:34 +0000
2021-09-18 12:01:34 +00:00
||s.yam.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||s2m3neweven.se.ke$all
Filter updated: Tue, 06 Jul 2021 00:01:42 +0000
2021-07-06 00:01:42 +00:00
||s3.amazonaws.com/progressivebank-uat/index.html$all
Filter updated: Tue, 21 Sep 2021 00:01:40 +0000
2021-09-21 00:01:40 +00:00
||s4flemon.z13.web.core.windows.net$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||s92673tu.beget.tech$all
Filter updated: Tue, 20 Jul 2021 12:01:48 +0000
2021-07-20 12:01:48 +00:00
||sa-www4-irs-gov-refund-irfof-wmsp.unaux.com$all
Filter updated: Sat, 10 Jul 2021 12:01:35 +0000
2021-07-10 12:01:35 +00:00
||sa-www4-irs-gov.movementsinmotion.com$all
Filter updated: Tue, 01 Jun 2021 12:06:34 UTC
2021-06-01 12:06:34 +00:00
||saatvikhomes.com$all
Filter updated: Fri, 30 Apr 2021 00:08:30 UTC
2021-04-30 00:08:30 +00:00
||sabaicabins.com$all
Filter updated: Thu, 09 Sep 2021 12:02:27 +0000
2021-09-09 12:02:27 +00:00
||saborperuanomiami.com$all
Filter updated: Fri, 14 May 2021 12:06:36 UTC
2021-05-14 12:06:36 +00:00
||sabssyndicate.com.bd$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||sacekimifiyatlari.biz$all
Filter updated: Thu, 22 Jul 2021 00:01:54 +0000
2021-07-22 00:01:54 +00:00
||sachpazis.xyz/https/$all
Filter updated: Sun, 19 Sep 2021 00:02:16 +0000
2021-09-19 00:02:17 +00:00
||saclamb.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||sadervoyages.intnet.mu$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||safe-page-active.000webhostapp.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||safetyconsultantehs.com$all
Filter updated: Fri, 24 Sep 2021 12:02:36 +0000
2021-09-24 12:02:36 +00:00
||safetyinformations.000webhostapp.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||safirbetgirisadresimiz.blogspot.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||safirbetgiristikla.blogspot.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||sagliklisuaritmacihazi.com$all
Filter updated: Sat, 08 May 2021 00:06:32 UTC
2021-05-08 00:06:32 +00:00
||sahc892190jf19y83.yicori5768-t0ypy-yy.workers.dev$all
Filter updated: Thu, 15 Apr 2021 12:07:36 UTC
2021-04-15 12:07:36 +00:00
||sahyacollege.com$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||saibooksdemo.saitechnosolutions.net$all
||said.servegame.com$all
Filter updated: Mon, 16 Aug 2021 12:01:42 +0000
2021-08-16 12:01:42 +00:00
||saintbarkleyshoes.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||sajkd12.blogspot.com$all
Filter updated: Fri, 19 Feb 2021 00:06:27 UTC
2021-02-19 00:06:28 +00:00
||sajkd12.blogspot.com/?m=0$all
Filter updated: Tue, 06 Apr 2021 12:07:02 UTC
2021-04-06 12:07:02 +00:00
||saldospc.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||sam250746.wixsite.com$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||samaetio.com$all
Filter updated: Wed, 15 Sep 2021 00:01:54 +0000
2021-09-15 00:01:55 +00:00
||sambhullar.ca$all
Filter updated: Sun, 15 Aug 2021 00:01:57 +0000
2021-08-15 00:01:57 +00:00
||samcool.org$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||samducksports.com$all
Filter updated: Sun, 31 Jan 2021 12:06:51 UTC
2021-01-31 12:06:51 +00:00
||samircanel20.com$all
Filter updated: Sun, 18 Apr 2021 12:06:55 UTC
2021-04-18 12:06:55 +00:00
||samnetakademi.com.tr$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||samo.st$all
Filter updated: Tue, 07 Sep 2021 00:01:46 +0000
2021-09-07 00:01:46 +00:00
||sampharm.uz$all
Filter updated: Fri, 16 Jul 2021 00:01:53 +0000
2021-07-16 00:01:53 +00:00
||samvaadlife.com$all
Filter updated: Tue, 26 Jan 2021 12:06:26 UTC
2021-01-26 12:06:26 +00:00
||sanasunty.site$all
Filter updated: Fri, 10 Sep 2021 12:02:02 +0000
2021-09-10 12:02:02 +00:00
||sandboxww.top$all
Filter updated: Sun, 05 Sep 2021 12:01:36 +0000
2021-09-05 12:01:37 +00:00
||sandeeppk03.github.io$all
Filter updated: Thu, 18 Feb 2021 12:07:12 UTC
2021-02-18 12:07:12 +00:00
||sandert12.blogspot.com/p/la-banque-postale.html$all
Filter updated: Fri, 13 Aug 2021 12:01:44 +0000
2021-08-13 12:01:44 +00:00
||sandiegooutdoorlivingca.com$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||sandygift.com/we/wetransfer/?email=info@diehl-patent.de$all
Filter updated: Thu, 09 Sep 2021 00:01:56 +0000
2021-09-09 00:01:56 +00:00
||sangahqw1.ultimatefreehost.in$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||sanjilkumar.com$all
||sanjoaquinvalleybrewfest.com/backup/wp-content/plugins/dude/configuration/themes/mak/index.php?email=&amp$all
||sanjoaquinvalleybrewfest.com/backup/wp-content/plugins/dude/configuration/themes/mak/index.php?email=contact@ironscales.com&id=432526cfdsd6567656dgvdhytdfbhjgff4536365353$all
Filter updated: Thu, 19 Aug 2021 00:01:47 +0000
2021-08-19 00:01:47 +00:00
||sanjosewebdeveloper.com$all
Filter updated: Tue, 10 Aug 2021 00:01:49 +0000
2021-08-10 00:01:49 +00:00
||sannittt.ultimatefreehost.in$all
Filter updated: Wed, 22 Sep 2021 00:02:26 +0000
2021-09-22 00:02:26 +00:00
||sanru.cd$all
Filter updated: Mon, 26 Jul 2021 00:02:16 +0000
2021-07-26 00:02:17 +00:00
||santandaerbank.com$all
Filter updated: Fri, 13 Aug 2021 00:01:48 +0000
2021-08-13 00:01:48 +00:00
||santander-arriba.hostfree.pw$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||santander-way.myvnc.com$all
Filter updated: Wed, 22 Sep 2021 00:02:26 +0000
2021-09-22 00:02:26 +00:00
||santanderpersonal.com$all
Filter updated: Tue, 31 Aug 2021 12:01:54 +0000
2021-08-31 12:01:54 +00:00
||santanderpl.com$all
Filter updated: Thu, 19 Aug 2021 00:01:47 +0000
2021-08-19 00:01:47 +00:00
||santanderusduyu.hostfree.pw$all
Filter updated: Fri, 30 Jul 2021 00:01:47 +0000
2021-07-30 00:01:47 +00:00
||santandhsflgh.byethost8.com$all
Filter updated: Tue, 17 Aug 2021 00:02:45 +0000
2021-08-17 00:02:45 +00:00
||santaninfover.byethost33.com$all
Filter updated: Sat, 14 Aug 2021 00:01:49 +0000
2021-08-14 00:01:49 +00:00
||santtandeerrronl.byethost17.com$all
Filter updated: Fri, 10 Sep 2021 00:02:17 +0000
2021-09-10 00:02:17 +00:00
||saranlar.com$all
Filter updated: Tue, 30 Mar 2021 12:06:32 UTC
2021-03-30 12:06:33 +00:00
||saritapariyar.com.np$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||sateegourmet.com/sbot$all
Filter updated: Wed, 22 Sep 2021 12:01:56 +0000
2021-09-22 12:01:56 +00:00
||savingsfordentalcare.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||sawowoshailam.000webhostapp.com$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||sbemskanila.com$all
Filter updated: Wed, 22 Sep 2021 12:01:56 +0000
2021-09-22 12:01:56 +00:00
||sbi.mx$all
Filter updated: Sat, 19 Jun 2021 12:06:28 +0000
2021-06-19 12:06:28 +00:00
||sbpichinchaol.2host.in$all
Filter updated: Thu, 01 Jul 2021 00:01:46 +0000
2021-07-01 00:01:46 +00:00
||sc0714e7134.byethost11.com$all
Filter updated: Thu, 06 May 2021 12:07:07 UTC
2021-05-06 12:07:07 +00:00
||scb9813h918fh9831821yh.pefecim563-oiuyt-oijh.workers.dev$all
Filter updated: Sun, 22 Aug 2021 12:01:41 +0000
2021-08-22 12:01:41 +00:00
||scgrotto.org$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||schaaf.ch.net2care.com$all
||schroffenstein.online.fr$all
Filter updated: Tue, 20 Oct 2020 12:06:38 UTC
2020-10-20 12:06:38 +00:00
||schule-niederrohrdorf.ch$all
Filter updated: Sun, 19 Sep 2021 00:02:16 +0000
2021-09-19 00:02:17 +00:00
||scomp00000.temp.swtest.ru$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||sconsumer.e-pagos.cl$all
Filter updated: Mon, 09 Aug 2021 12:01:58 +0000
2021-08-09 12:01:58 +00:00
||scooterarena.nl$all
Filter updated: Fri, 03 Sep 2021 12:01:48 +0000
2021-09-03 12:01:48 +00:00
||scotiabank-yieldmorefinancing.ca$all
Filter updated: Wed, 24 Feb 2021 00:06:23 UTC
2021-02-24 00:06:23 +00:00
||scouts.org.sv$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||script.google.com/macros/s/akfycbwc6y7yuxmti0kr8e5d3m62ucmsuhkihk-zzxby7xngxeopneyy/exec$all
Filter updated: Fri, 24 Sep 2021 12:02:36 +0000
2021-09-24 12:02:36 +00:00
||sd8sd88ds8sdf8sdf9sdfsdf9dfs0ds9dfs.s3.eu-west-1.amazonaws.com$all
Filter updated: Fri, 17 Sep 2021 00:01:45 +0000
2021-09-17 00:01:46 +00:00
||sdadadjewrjweudgjhxjsajshgjhcvnvveugticvbsdk.my-board.org$all
||sdsdfdsfddkgfkkgjhjhjljrhtrujvgg.my-board.org$all
Filter updated: Tue, 13 Apr 2021 00:06:31 UTC
2021-04-13 00:06:31 +00:00
||se-connecter-au-webmail-la-poste--lapostenet0.yolasite.com$all
Filter updated: Wed, 21 Apr 2021 00:07:05 UTC
2021-04-21 00:07:05 +00:00
||seacoastsurgery.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||seahoss.com$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||searchandco-origin.dev.tenpixls.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||sebat-dhl.blogspot.com$all
Filter updated: Sat, 18 Sep 2021 12:01:34 +0000
2021-09-18 12:01:34 +00:00
||sebene27.github.io$all
Filter updated: Sat, 07 Aug 2021 00:20:48 +0000
2021-08-07 00:20:48 +00:00
||seceta.ro$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||secret-group.duckdns.org$all
Filter updated: Tue, 23 Mar 2021 00:10:01 UTC
2021-03-23 00:10:01 +00:00
||secur-recovery-standardcommunity-identity.my.id$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||secure-21dir.duckdns.org$all
Filter updated: Tue, 31 Aug 2021 12:01:54 +0000
2021-08-31 12:01:54 +00:00
||secure-blogs.com$all
Filter updated: Wed, 15 Sep 2021 12:01:46 +0000
2021-09-15 12:01:46 +00:00
||secure-doc-sbcisd-net.tk$all
Filter updated: Tue, 09 Feb 2021 12:06:34 UTC
2021-02-09 12:06:34 +00:00
||secure-halifax-device.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||secure-halifaxaccount.com$all
Filter updated: Fri, 30 Jul 2021 12:01:52 +0000
2021-07-30 12:01:52 +00:00
||secure-monitor.com$all
Filter updated: Thu, 14 Jan 2021 00:06:20 UTC
2021-01-14 00:06:20 +00:00
||secure-myaccountdetails.com$all
Filter updated: Sat, 06 Mar 2021 00:09:39 UTC
2021-03-06 00:09:39 +00:00
||secure-mynew-devices.com$all
Filter updated: Fri, 15 Jan 2021 00:06:14 UTC
2021-01-15 00:06:14 +00:00
||secure-mytransfer.com$all
Filter updated: Thu, 14 Jan 2021 00:06:20 UTC
2021-01-14 00:06:20 +00:00
||secure-online-payeemagement.com/halifax$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||secure-online-payeemagement.com/halifax/login.php$all
Filter updated: Tue, 16 Feb 2021 00:06:20 UTC
2021-02-16 00:06:20 +00:00
||secure-onlinepayee.link$all
Filter updated: Thu, 14 Jan 2021 00:06:20 UTC
2021-01-14 00:06:20 +00:00
||secure-payeeremoval.com$all
Filter updated: Wed, 11 Aug 2021 00:01:55 +0000
2021-08-11 00:01:55 +00:00
||secure-runescape.xgm.rnp.mybluehost.me$all
Filter updated: Thu, 03 Sep 2020 12:06:37 UTC
2020-09-03 12:06:37 +00:00
||secure-ssl-cdn.com$all
||secure.bankofamerica.com-login-sign-in-signonv2screen.go.suzukihaiphong.com.vn$all
||secure.captisa.com$all
Filter updated: Thu, 18 Feb 2021 12:07:12 UTC
2021-02-18 12:07:12 +00:00
||secure.facebook.com.de.a2ip.ru$all
Filter updated: Thu, 03 Sep 2020 12:06:37 UTC
2020-09-03 12:06:37 +00:00
||secure.legalmetric.com$all
Filter updated: Tue, 15 Jun 2021 00:06:35 UTC
2021-06-15 00:06:35 +00:00
||secure.runescape.com-cn.ru$all
Filter updated: Sun, 20 Jun 2021 12:06:22 +0000
2021-06-20 12:06:22 +00:00
||secure.runescape.com-gb.ru$all
Filter updated: Tue, 26 Jan 2021 00:06:20 UTC
2021-01-26 00:06:20 +00:00
||secure.runescape.com-oc.ru$all
Filter updated: Wed, 03 Feb 2021 12:06:43 UTC
2021-02-03 12:06:43 +00:00
||secure.runescape.com-ro.ru$all
Filter updated: Thu, 21 Jan 2021 00:06:19 UTC
2021-01-21 00:06:19 +00:00
||secure.runescape.com-vc.ru$all
Filter updated: Tue, 21 Sep 2021 12:02:11 +0000
2021-09-21 12:02:11 +00:00
||secure.runescape.com-vzla.ru$all
Filter updated: Mon, 23 Aug 2021 00:01:47 +0000
2021-08-23 00:01:47 +00:00
||secure.runescapev.com$all
Filter updated: Sun, 05 Sep 2021 12:01:36 +0000
2021-09-05 12:01:37 +00:00
||secure.westernvasttrust.com$all
Filter updated: Sat, 18 Sep 2021 00:14:48 +0000
2021-09-18 00:14:48 +00:00
||secure03r-chase.herokuapp.com$all
Filter updated: Sat, 29 May 2021 00:06:23 UTC
2021-05-29 00:06:23 +00:00
||secure270.inmotionhosting.com$all
Filter updated: Tue, 06 Jul 2021 12:02:08 +0000
2021-07-06 12:02:09 +00:00
||secure271.servconfig.com$all
Filter updated: Thu, 29 Apr 2021 12:07:55 UTC
2021-04-29 12:07:55 +00:00
||secure279.inmotionhosting.com$all
Filter updated: Mon, 06 Sep 2021 12:01:50 +0000
2021-09-06 12:01:50 +00:00
||secure285.inmotionhosting.com$all
Filter updated: Fri, 28 May 2021 12:06:27 UTC
2021-05-28 12:06:27 +00:00
||secure290.inmotionhosting.com$all
Filter updated: Tue, 17 Aug 2021 12:01:39 +0000
2021-08-17 12:01:39 +00:00
||secure300.inmotionhosting.com$all
Filter updated: Mon, 04 Jan 2021 12:06:21 UTC
2021-01-04 12:06:21 +00:00
||secured-mypayee.com$all
Filter updated: Thu, 02 Sep 2021 12:02:02 +0000
2021-09-02 12:02:02 +00:00
||securefaxing.knorish.com$all
Filter updated: Fri, 04 Jun 2021 12:07:04 UTC
2021-06-04 12:07:04 +00:00
||securefilefromyourcontact.macleayindoorsports.com.au$all
Filter updated: Wed, 17 Mar 2021 00:06:16 UTC
2021-03-17 00:06:16 +00:00
||securelloyd-help-app.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||securematicsrecruitment.co.uk/vendor/phpunit/phpunit/src/util/php/logs.php$all
Filter updated: Tue, 19 Jan 2021 00:06:28 UTC
2021-01-19 00:06:28 +00:00
||securemy-logindetails.com$all
Filter updated: Fri, 09 Apr 2021 00:06:41 UTC
2021-04-09 00:06:41 +00:00
||securesiteapp.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||securevpn.co.uk/3f2b99533752cd703192d30158de5a07$all
||securevpn.co.uk/3f2b99533752cd703192d30158de5a07/qes.php?cmd=_account-details&session=3ae2e833d1ac3eb76927d4d70673def3&dispatch=9de7ce566b3435fdc11f5254fef89840420f3c77$all
||securevpn.co.uk/3f2b99533752cd703192d30158de5a07/security.php?cmd=_account-details&session=c220a00c9d733675bfdbe46776983d94&dispatch=21d99dac26cdc0d26945c9aca9f5e138c5f9c78e$all
||securevpn.co.uk/b64ea32d3c58e80ffccf75fce7a093f8$all
||securevpn.co.uk/b64ea32d3c58e80ffccf75fce7a093f8/qes.php?cmd=_account-details&session=89bb9c369e657b16c87822891a88de3a&dispatch=5da70c0a80d7a4b0133ad1e3755aff338c93991b$all
||securevpn.co.uk/b64ea32d3c58e80ffccf75fce7a093f8/security.php?cmd=_account-details&session=2ec3f8b16d462a1759a55bf621189d78&dispatch=67137c8454db1ad38dc4df3aa8523a284a8203cc$all
Filter updated: Wed, 22 Sep 2021 00:02:26 +0000
2021-09-22 00:02:26 +00:00
||security-page-community-standards.blogspot.com$all
Filter updated: Tue, 31 Aug 2021 12:01:54 +0000
2021-08-31 12:01:54 +00:00
||security-pages-fb.blogspot.com/2021/07/blog-post.html$all
Filter updated: Thu, 15 Jul 2021 12:01:53 +0000
2021-07-15 12:01:53 +00:00
||securitycode2021.hostfree.pw$all
Filter updated: Fri, 12 Feb 2021 12:06:36 UTC
2021-02-12 12:06:37 +00:00
||securityupdatereview-365online.com$all
Filter updated: Mon, 09 Aug 2021 00:02:27 +0000
2021-08-09 00:02:27 +00:00
||securty-supporrt.sun2seauvprotection.com.au$all
Filter updated: Sat, 17 Jul 2021 00:01:47 +0000
2021-07-17 00:01:47 +00:00
||secutityreport00.byethost16.com$all
Filter updated: Mon, 21 Jun 2021 00:06:20 +0000
2021-06-21 00:06:20 +00:00
||seenpichinchaot.2host.in$all
Filter updated: Fri, 03 Sep 2021 00:01:54 +0000
2021-09-03 00:01:55 +00:00
||seetheworldtravels.com.au$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||segu.cl$all
Filter updated: Sat, 10 Jul 2021 00:01:42 +0000
2021-07-10 00:01:42 +00:00
||seguranca-online.byethost11.com$all
Filter updated: Wed, 22 Sep 2021 00:02:26 +0000
2021-09-22 00:02:26 +00:00
||segurancaparavc.me$all
Filter updated: Wed, 01 Sep 2021 12:01:58 +0000
2021-09-01 12:01:58 +00:00
||seguraweb4646373.hostfree.pw$all
Filter updated: Fri, 23 Jul 2021 12:01:47 +0000
2021-07-23 12:01:47 +00:00
||seguridad27.byethost18.com$all
Filter updated: Thu, 16 Sep 2021 00:01:52 +0000
2021-09-16 00:01:52 +00:00
||seguridad89822.webcindario.com$all
Filter updated: Thu, 05 Aug 2021 12:01:57 +0000
2021-08-05 12:01:57 +00:00
||seguridadba.byethost6.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||seguridadbbva.net$all
Filter updated: Sat, 10 Jul 2021 00:01:42 +0000
2021-07-10 00:01:42 +00:00
||seguridadecuador.byethost17.com$all
Filter updated: Thu, 15 Jul 2021 00:02:02 +0000
2021-07-15 00:02:03 +00:00
||seguridadi0001.byethost3.com$all
Filter updated: Wed, 14 Jul 2021 00:03:28 +0000
2021-07-14 00:03:28 +00:00
||seguridprom82711.byethost13.com$all
||seguridprom82711.byethost6.com$all
Filter updated: Mon, 28 Jun 2021 12:06:20 +0000
2021-06-28 12:06:20 +00:00
||seguropichinchae.2host.in$all
Filter updated: Sun, 15 Aug 2021 00:01:57 +0000
2021-08-15 00:01:57 +00:00
||sehzademarket.com/nmj.php$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||sekabetgiriss.blogspot.com$all
||sekabetgiriss1.blogspot.com$all
||sekabetgirissitemiz.blogspot.com$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||select.rw$all
Filter updated: Sun, 18 Apr 2021 00:07:02 UTC
2021-04-18 00:07:02 +00:00
||sellrego.com$all
Filter updated: Sat, 04 Sep 2021 00:17:00 +0000
2021-09-04 00:17:00 +00:00
||sem.my-drs.co.uk$all
Filter updated: Thu, 03 Sep 2020 12:06:37 UTC
2020-09-03 12:06:37 +00:00
||sen-manole.firebaseapp.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||sendo-meso.firebaseapp.com$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||senten.serveftp.com$all
||sentinelshowcase.com$all
Filter updated: Wed, 10 Mar 2021 00:08:04 UTC
2021-03-10 00:08:05 +00:00
||seonewsservic.blogspot.com/p/postenno_9.html$all
Filter updated: Fri, 24 Sep 2021 12:02:36 +0000
2021-09-24 12:02:36 +00:00
||serpost-pe-pay.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||sertyxese.myfreesites.net$all
Filter updated: Sun, 25 Oct 2020 12:06:32 UTC
2020-10-25 12:06:32 +00:00
||serv-secured-1.com$all
Filter updated: Tue, 21 Sep 2021 12:02:11 +0000
2021-09-21 12:02:11 +00:00
||server-sparkasse.de$all
Filter updated: Wed, 21 Jul 2021 00:01:57 +0000
2021-07-21 00:01:57 +00:00
||server0012.byethost12.com$all
Filter updated: Thu, 15 Jul 2021 00:02:02 +0000
2021-07-15 00:02:03 +00:00
||server003.byethost7.com$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||serverexpres0013.byethost12.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||servermailerwebservices.tk$all
Filter updated: Thu, 15 Oct 2020 12:06:30 UTC
2020-10-15 12:06:30 +00:00
||servernuovaintesa.com$all
Filter updated: Tue, 11 May 2021 12:06:36 UTC
2021-05-11 12:06:36 +00:00
||serversonline.i.ng$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||serverupdate.getforge.io$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||servicabbout.blogspot.com$all
Filter updated: Thu, 22 Apr 2021 12:08:20 UTC
2021-04-22 12:08:20 +00:00
||service-client00-my-cheetah-website.free.builderall.com$all
Filter updated: Fri, 09 Apr 2021 00:06:41 UTC
2021-04-09 00:06:41 +00:00
||service-lkdn2020.gacconstrutora.com.br$all
Filter updated: Tue, 24 Aug 2021 00:02:23 +0000
2021-08-24 00:02:24 +00:00
||service-mailsfr.yolasite.com$all
Filter updated: Tue, 10 Nov 2020 00:06:13 UTC
2020-11-10 00:06:13 +00:00
||serviceclient.site44.com$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||servicecustumor.com$all
Filter updated: Fri, 19 Feb 2021 00:06:27 UTC
2021-02-19 00:06:28 +00:00
||servicefacture.blogspot.com/2020/04/blog-post_10.html$all
Filter updated: Sun, 05 Sep 2021 00:02:15 +0000
2021-09-05 00:02:15 +00:00
||services-leboncoin-paiement.com$all
Filter updated: Tue, 12 Jan 2021 12:06:44 UTC
2021-01-12 12:06:44 +00:00
||services-vodafone.com$all
Filter updated: Fri, 24 Sep 2021 12:02:36 +0000
2021-09-24 12:02:36 +00:00
||services.runescape.com-ak.ru$all
Filter updated: Tue, 29 Dec 2020 00:06:16 UTC
2020-12-29 00:06:16 +00:00
||services.runescape.com-m.cc$all
Filter updated: Wed, 26 May 2021 12:06:39 UTC
2021-05-26 12:06:39 +00:00
||services.runescape.com-mss-forum.totalh.net$all
Filter updated: Tue, 26 Jan 2021 00:06:20 UTC
2021-01-26 00:06:20 +00:00
||services.runescape.com-oc.ru$all
Filter updated: Sun, 07 Feb 2021 12:06:47 UTC
2021-02-07 12:06:47 +00:00
||services.runescape.com-ro.ru$all
Filter updated: Thu, 21 Jan 2021 00:06:19 UTC
2021-01-21 00:06:19 +00:00
||services.runescape.com-vc.ru$all
Filter updated: Sun, 31 Jan 2021 00:06:53 UTC
2021-01-31 00:06:53 +00:00
||services.runescape.com-vzla.ru$all
Filter updated: Tue, 17 Aug 2021 00:02:45 +0000
2021-08-17 00:02:45 +00:00
||services.runescape.com.rs-ds.xyz$all
Filter updated: Fri, 24 Sep 2021 00:01:50 +0000
2021-09-24 00:01:51 +00:00
||services.runescape.rs-cx.xyz$all
Filter updated: Tue, 21 Sep 2021 00:01:40 +0000
2021-09-21 00:01:40 +00:00
||services.runescape.rs-dd.xyz$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||services.runescape.rs-er.xyz$all
||services.runescape.rs-gg.xyz$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||services.runescape.rs-ox.xyz$all
||services.runescape.rs-se.xyz$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||services.runescape.rs-sx.xyz$all
Filter updated: Wed, 22 Sep 2021 00:02:26 +0000
2021-09-22 00:02:26 +00:00
||services.runescape.rs-te.xyz$all
Filter updated: Fri, 17 Sep 2021 12:01:51 +0000
2021-09-17 12:01:52 +00:00
||services.runescape.rs-yy.xyz$all
Filter updated: Thu, 27 May 2021 00:06:23 UTC
2021-05-27 00:06:23 +00:00
||servicesbanpichi.ihostfull.com$all
Filter updated: Wed, 21 Jul 2021 00:01:57 +0000
2021-07-21 00:01:57 +00:00
||servicesonline23.byethost7.com$all
Filter updated: Fri, 03 Sep 2021 00:01:54 +0000
2021-09-03 00:01:55 +00:00
||servicesorange.shop$all
Filter updated: Tue, 17 Aug 2021 12:01:39 +0000
2021-08-17 12:01:39 +00:00
||servicetermopanebucuresti.ro$all
Filter updated: Mon, 15 Feb 2021 00:06:24 UTC
2021-02-15 00:06:24 +00:00
||serviceupdateconfirmation.com$all
Filter updated: Tue, 25 May 2021 00:06:25 UTC
2021-05-25 00:06:25 +00:00
||serviciosbndigitales.com$all
Filter updated: Sat, 17 Apr 2021 12:06:11 UTC
2021-04-17 12:06:11 +00:00
||serviciosenlineasbn.com$all
Filter updated: Mon, 28 Jun 2021 00:06:30 +0000
2021-06-28 00:06:30 +00:00
||servidopichincha.byethost31.com$all
Filter updated: Thu, 15 Jul 2021 12:01:53 +0000
2021-07-15 12:01:53 +00:00
||servidor00006.byethost9.com$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||servidor00016.byethost11.com$all
||servidor0010.byethost11.com$all
Filter updated: Sat, 17 Oct 2020 00:06:56 UTC
2020-10-17 00:06:56 +00:00
||serviziapponline.com$all
Filter updated: Wed, 23 Jun 2021 12:06:29 +0000
2021-06-23 12:06:29 +00:00
||servlces.runescape.com-ov.ru$all
||servlices.runescape.com-ov.ru$all
Filter updated: Thu, 24 Jun 2021 00:06:35 +0000
2021-06-24 00:06:35 +00:00
||servweb.cf$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||setona.main.jp$all
Filter updated: Tue, 29 Jun 2021 12:02:07 +0000
2021-06-29 12:02:07 +00:00
||settingsandprivacy.gq$all
Filter updated: Tue, 17 Aug 2021 00:02:45 +0000
2021-08-17 00:02:45 +00:00
||settlementsclaimz.com$all
Filter updated: Thu, 15 Jul 2021 12:01:53 +0000
2021-07-15 12:01:53 +00:00
||setupdirectory.com$all
||setupmynorton.square.site$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||sevoudryserviciobomail.dudaone.com$all
Filter updated: Thu, 19 Aug 2021 12:02:33 +0000
2021-08-19 12:02:33 +00:00
||sfr-espace-client.ru$all
Filter updated: Thu, 29 Jul 2021 00:01:57 +0000
2021-07-29 00:01:57 +00:00
||sfrpanel.lws.fr$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||sftp.usin.com$all
Filter updated: Mon, 20 Sep 2021 12:02:05 +0000
2021-09-20 12:02:05 +00:00
||sg3plvwcpnl378889.prod.sin3.secureserver.net$all
Filter updated: Sun, 15 Aug 2021 00:01:57 +0000
2021-08-15 00:01:57 +00:00
||sg3plvwcpnl378889.prod.sin3.secureserver.net/~aloyst/index/cpwebmail/index.php?email=afortescue@btinternet.com$all
Filter updated: Fri, 27 Aug 2021 12:01:40 +0000
2021-08-27 12:01:40 +00:00
||sg3plvwcpnl378889.prod.sin3.secureserver.net/~sitcrr/wp-includes/fonts/advance/cpwebmail/index.php?email=a.s.l.campbell@btinternet.com$all
Filter updated: Mon, 02 Aug 2021 00:02:18 +0000
2021-08-02 00:02:18 +00:00
||sgb-pageonline-original.com$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||sgboxb.top$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||sgp1.digitaloceanspaces.com/3gpredrainbowwestrow582brownqwer02im/index.html$all
Filter updated: Fri, 24 Sep 2021 00:01:50 +0000
2021-09-24 00:01:51 +00:00
||sgp1.digitaloceanspaces.com/umwr09west783cumzigvicemxwteus/index.html$all
Filter updated: Thu, 02 Sep 2021 00:01:59 +0000
2021-09-02 00:01:59 +00:00
||sgtbimit.com/public/ckeditor_full/login.html?to=$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||sh199811.website.pl$all
Filter updated: Fri, 28 May 2021 00:06:28 UTC
2021-05-28 00:06:29 +00:00
||shadowpay.pp.ru$all
Filter updated: Tue, 25 May 2021 00:06:25 UTC
2021-05-25 00:06:25 +00:00
||shamajastore.co.ke$all
Filter updated: Fri, 03 Sep 2021 12:01:48 +0000
2021-09-03 12:01:48 +00:00
||shanayashoppy.com$all
Filter updated: Sat, 17 Apr 2021 12:06:11 UTC
2021-04-17 12:06:11 +00:00
||shanedrk.com$all
Filter updated: Wed, 12 May 2021 00:06:26 UTC
2021-05-12 00:06:26 +00:00
||shanestrailertraining.com$all
Filter updated: Wed, 01 Sep 2021 00:02:20 +0000
2021-09-01 00:02:20 +00:00
||share-eu1.hsforms.com$all
Filter updated: Thu, 03 Sep 2020 12:06:37 UTC
2020-09-03 12:06:37 +00:00
||share-relations.de$all
Filter updated: Thu, 10 Sep 2020 12:06:46 UTC
2020-09-10 12:06:46 +00:00
||share.chamaileon.io$all
Filter updated: Fri, 26 Mar 2021 12:07:44 UTC
2021-03-26 12:07:45 +00:00
||share.hsforms.com/1fni_ent2sao6wqv0vzdn7g8nl9d$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||share.hsforms.com/1owoqghkbqdo-dfbltgexeq4g63f$all
Filter updated: Tue, 21 Sep 2021 00:01:40 +0000
2021-09-21 00:01:40 +00:00
||shared-document.com/basic.php?k=d63621ef3dc01735479befc13f97ec7fdb68991d$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||shared-file.square.site$all
Filter updated: Wed, 06 Jan 2021 00:06:10 UTC
2021-01-06 00:06:10 +00:00
||sharefiles.app.link$all
Filter updated: Thu, 10 Dec 2020 00:06:16 UTC
2020-12-10 00:06:16 +00:00
||sharelink.sn.am$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||sharp-kepler.109-71-253-24.plesk.page$all
Filter updated: Thu, 29 Jul 2021 00:01:57 +0000
2021-07-29 00:01:57 +00:00
||shatzadcqpkkmxtinvqpwsakrm-dot-gowa11111111.rj.r.appspot.com$all
Filter updated: Fri, 20 Aug 2021 12:01:48 +0000
2021-08-20 12:01:48 +00:00
||shimamurakoutaro.com$all
Filter updated: Wed, 22 Sep 2021 00:02:26 +0000
2021-09-22 00:02:26 +00:00
||sho.cat/xc$all
Filter updated: Mon, 13 Sep 2021 12:01:52 +0000
2021-09-13 12:01:52 +00:00
||shop.prunescape.com.au$all
Filter updated: Sat, 14 Aug 2021 00:01:49 +0000
2021-08-14 00:01:49 +00:00
||shopee.khogiaodien247.com$all
Filter updated: Tue, 30 Mar 2021 12:06:32 UTC
2021-03-30 12:06:33 +00:00
||shortenlink.top$all
Filter updated: Thu, 16 Sep 2021 00:01:52 +0000
2021-09-16 00:01:52 +00:00
||shortlink.net/verify-atm$all
Filter updated: Mon, 13 Sep 2021 00:02:04 +0000
2021-09-13 00:02:04 +00:00
||shorturl.at/nqgu1$all
Filter updated: Wed, 21 Jul 2021 00:01:57 +0000
2021-07-21 00:01:57 +00:00
||shorturl.at/pdlp9$all
Filter updated: Fri, 02 Apr 2021 12:06:43 UTC
2021-04-02 12:06:43 +00:00
||shoutout.wix.com/so/29nxdzhlu/c?w=6cqhoe6cvp5sgmmsaghxgp5ym3iyanqygauqwdhnqmi.eyj1ijoiahr0chm6ly93yxrhc2lpcmpyawjoys5ibg9ilmnvcmuud2luzg93cy5uzxqvdgvzdgluzy9tcgxuynzjegrmlmh0bwwilcjyijoinzewowuwzgitnjy5mi00ngrhltuzm2qtnjaynzk1zje0ymuxiiwibsi6im1hawwilcjjijoimdawmdawmdatmdawmc0wmdawltawmdatmdawmdawmdawmdawin0#qs=r-agikbadkfkgdhdjaehfdidgafgccdigaehkkdaehkkdababaibadccaccaccjhackcjaibjfhacb$all
Filter updated: Tue, 24 Aug 2021 00:02:23 +0000
2021-08-24 00:02:24 +00:00
||shovalimyoqneam.co.il$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||shrill-waterfall-5eb6.dhlkindupdated.workers.dev$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||shrunken.com/url_redirector.php?url=a6yt8$all
Filter updated: Wed, 18 Aug 2021 12:02:35 +0000
2021-08-18 12:02:36 +00:00
||shtfrrty.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||shtuchki.store$all
Filter updated: Mon, 30 Aug 2021 12:01:50 +0000
2021-08-30 12:01:51 +00:00
||shubhamskinclinic.in$all
Filter updated: Fri, 24 Sep 2021 12:02:36 +0000
2021-09-24 12:02:36 +00:00
||siasky.net/oaddp_mbyvqeyn2a39cojjjejdbbw60b6qye8gntzoyl1g$all
Filter updated: Tue, 27 Apr 2021 00:06:47 UTC
2021-04-27 00:06:47 +00:00
||sibautomation.com/cm.html?id=3693089#trans=0&user_id=1$all
Filter updated: Fri, 07 May 2021 00:06:36 UTC
2021-05-07 00:06:36 +00:00
||sibautomation.com/cm.html?id=3693089#trans=0&user_id=2$all
Filter updated: Wed, 21 Jul 2021 00:01:57 +0000
2021-07-21 00:01:57 +00:00
||sicherheit-spk-psd2.de$all
Filter updated: Sat, 01 May 2021 12:06:37 UTC
2021-05-01 12:06:37 +00:00
||sicherheitsicherheits.de$all
Filter updated: Sat, 31 Jul 2021 00:01:51 +0000
2021-07-31 00:01:51 +00:00
||sicurezza-carte.it$all
Filter updated: Tue, 21 Sep 2021 12:02:11 +0000
2021-09-21 12:02:11 +00:00
||sicurr-mtb.com$all
Filter updated: Thu, 20 May 2021 00:06:43 UTC
2021-05-20 00:06:44 +00:00
||sicurty-login.com$all
Filter updated: Thu, 29 Apr 2021 12:07:55 UTC
2021-04-29 12:07:55 +00:00
||siemik.github.io$all
Filter updated: Tue, 13 Jul 2021 12:01:57 +0000
2021-07-13 12:01:57 +00:00
||signature-notes.com$all
Filter updated: Sat, 28 Aug 2021 12:01:47 +0000
2021-08-28 12:01:47 +00:00
||signin-payeer.com$all
Filter updated: Sat, 13 Mar 2021 12:07:44 UTC
2021-03-13 12:07:44 +00:00
||signin.ebay.de.whyymedia.com.au$all
Filter updated: Thu, 15 Jul 2021 00:02:02 +0000
2021-07-15 00:02:03 +00:00
||signmaxxgh.com$all
Filter updated: Thu, 22 Apr 2021 12:08:20 UTC
2021-04-22 12:08:20 +00:00
||siida-disperindag.kalbarprov.go.id$all
Filter updated: Wed, 11 Nov 2020 12:06:45 UTC
2020-11-11 12:06:45 +00:00
||sikkertnabolag.dk$all
Filter updated: Wed, 16 Jun 2021 12:06:46 +0000
2021-06-16 12:06:46 +00:00
||siklus.net$all
Filter updated: Mon, 06 Sep 2021 12:01:50 +0000
2021-09-06 12:01:50 +00:00
||sil2.duerr-haustechnik.de$all
Filter updated: Sat, 21 Nov 2020 12:06:40 UTC
2020-11-21 12:06:40 +00:00
||sillyabba.com$all
Filter updated: Fri, 04 Dec 2020 12:06:51 UTC
2020-12-04 12:06:51 +00:00
||simp.ly/p/3cd35d$all
Filter updated: Thu, 10 Dec 2020 12:06:41 UTC
2020-12-10 12:06:42 +00:00
||simp.ly/p/h45c89$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||simp.ly/p/hqtfwb$all
||simp.ly/p/jwj7gr$all
||simp.ly/p/jylrtp$all
||simp.ly/p/wlgtvw$all
||simp.ly/publish/xhrdvc$all
Filter updated: Tue, 21 Sep 2021 12:02:11 +0000
2021-09-21 12:02:11 +00:00
||simpledealers.com$all
Filter updated: Thu, 01 Jul 2021 12:02:02 +0000
2021-07-01 12:02:03 +00:00
||simplehostsetup.com$all
Filter updated: Sat, 24 Oct 2020 00:07:02 UTC
2020-10-24 00:07:02 +00:00
||simpletec.cl$all
Filter updated: Fri, 10 Sep 2021 00:02:17 +0000
2021-09-10 00:02:17 +00:00
||singes.es$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||sios.tech$all
Filter updated: Sat, 04 Sep 2021 00:17:00 +0000
2021-09-04 00:17:00 +00:00
||siphen.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||siporados15585.blogspot.com$all
Filter updated: Tue, 01 Jun 2021 12:06:34 UTC
2021-06-01 12:06:34 +00:00
||sirak.se$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||sirdarnell.org$all
Filter updated: Fri, 16 Apr 2021 00:06:41 UTC
2021-04-16 00:06:41 +00:00
||site-4403463-3995-6112.mystrikingly.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||site-5666342-8194-2770.mystrikingly.com$all
Filter updated: Fri, 15 Jan 2021 00:06:14 UTC
2021-01-15 00:06:14 +00:00
||site9423623.92.webydo.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||site9423773.92.webydo.com$all
||site9434107.92.webydo.com$all
||site9548676.92.webydo.com$all
Filter updated: Sun, 15 Aug 2021 00:01:57 +0000
2021-08-15 00:01:57 +00:00
||site9551459.92.webydo.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||site9552191.92.webydo.com$all
Filter updated: Mon, 09 Aug 2021 12:01:58 +0000
2021-08-09 12:01:58 +00:00
||site9605282.92.webydo.com$all
Filter updated: Wed, 15 Sep 2021 00:01:54 +0000
2021-09-15 00:01:55 +00:00
||site9605464.92.webydo.com$all
Filter updated: Tue, 15 Jun 2021 12:29:08 UTC
2021-06-15 12:29:08 +00:00
||sitebuilder130038.dynadot.com$all
Filter updated: Tue, 07 Sep 2021 00:01:46 +0000
2021-09-07 00:01:46 +00:00
||sitebuilder135844.dynadot.com$all
Filter updated: Sun, 05 Sep 2021 12:01:36 +0000
2021-09-05 12:01:37 +00:00
||sitebuilder138648.dynadot.com$all
Filter updated: Fri, 27 Aug 2021 00:01:47 +0000
2021-08-27 00:01:47 +00:00
||sitebuilder140489.dynadot.com$all
Filter updated: Tue, 20 Jul 2021 12:01:48 +0000
2021-07-20 12:01:48 +00:00
||sites.google.com/a/sy4norton.com/setup/home$all
Filter updated: Wed, 12 May 2021 12:06:30 UTC
2021-05-12 12:06:30 +00:00
||sites.google.com/grossohooperlaw.com/grossohooperlaw/home$all
Filter updated: Tue, 20 Jul 2021 12:01:48 +0000
2021-07-20 12:01:48 +00:00
||sites.google.com/site/buayomuarobtp/$all
||sites.google.com/site/cilakourangma/$all
||sites.google.com/site/clamingidentify008754501/$all
||sites.google.com/site/confrimationsacounst/home$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||sites.google.com/site/e9d24c72/23524457$all
||sites.google.com/site/habbotuttogratis$all
||sites.google.com/site/habbotuttogratis/assignments$all
Filter updated: Tue, 20 Jul 2021 12:01:48 +0000
2021-07-20 12:01:48 +00:00
||sites.google.com/site/help74540110104104014100/$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||sites.google.com/site/libretyreserve$all
Filter updated: Thu, 03 Sep 2020 12:06:37 UTC
2020-09-03 12:06:37 +00:00
||sites.google.com/site/libretyreserve/$all
Filter updated: Tue, 20 Jul 2021 12:01:48 +0000
2021-07-20 12:01:48 +00:00
||sites.google.com/site/maxsecureacc564988/$all
Filter updated: Thu, 12 Aug 2021 12:01:52 +0000
2021-08-12 12:01:53 +00:00
||sites.google.com/site/policyclaming99008767/$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||sites.google.com/site/protectedinmprovmnt44/$all
||sites.google.com/site/verifycheckpointpaqes/$all
Filter updated: Tue, 20 Jul 2021 12:01:48 +0000
2021-07-20 12:01:48 +00:00
||sites.google.com/site/wwwinfopages091/$all
Filter updated: Wed, 08 Sep 2021 00:02:08 +0000
2021-09-08 00:02:08 +00:00
||sites.google.com/view/103gn-securefacebook-page$all
Filter updated: Thu, 02 Sep 2021 00:01:59 +0000
2021-09-02 00:01:59 +00:00
||sites.google.com/view/114g/bt$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||sites.google.com/view/122qw/btconneect$all
Filter updated: Mon, 13 Sep 2021 00:02:04 +0000
2021-09-13 00:02:04 +00:00
||sites.google.com/view/1nepmw6/$all
Filter updated: Thu, 12 Aug 2021 12:01:52 +0000
2021-08-12 12:01:53 +00:00
||sites.google.com/view/2021o728/bt$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||sites.google.com/view/23456yu/btconecct?authuser=1$all
Filter updated: Sat, 04 Sep 2021 00:17:00 +0000
2021-09-04 00:17:00 +00:00
||sites.google.com/view/2498475825728fe/bt$all
Filter updated: Thu, 17 Jun 2021 12:06:40 +0000
2021-06-17 12:06:40 +00:00
||sites.google.com/view/276e/bt$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||sites.google.com/view/33wq/btconnecct$all
||sites.google.com/view/344rtfg/btconneec$all
||sites.google.com/view/3uyrdfg/bt$all
Filter updated: Thu, 15 Jul 2021 00:02:02 +0000
2021-07-15 00:02:03 +00:00
||sites.google.com/view/434ef/btcoonneecc$all
Filter updated: Thu, 09 Sep 2021 12:02:27 +0000
2021-09-09 12:02:27 +00:00
||sites.google.com/view/4354hjg/bt$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||sites.google.com/view/435rre/btconneecct$all
||sites.google.com/view/4567yu/btconneect$all
Filter updated: Wed, 16 Jun 2021 00:06:45 +0000
2021-06-16 00:06:45 +00:00
||sites.google.com/view/45ty/bt$all
Filter updated: Thu, 09 Sep 2021 12:02:27 +0000
2021-09-09 12:02:27 +00:00
||sites.google.com/view/47653jgfgfhgf/bt$all
Filter updated: Fri, 20 Aug 2021 12:01:48 +0000
2021-08-20 12:01:48 +00:00
||sites.google.com/view/50898t0tvucjbtbusiness/office365$all
Filter updated: Sat, 19 Jun 2021 00:06:27 +0000
2021-06-19 00:06:27 +00:00
||sites.google.com/view/534rty/btconnecctt$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||sites.google.com/view/56he/btconnect$all
Filter updated: Thu, 09 Sep 2021 12:02:27 +0000
2021-09-09 12:02:27 +00:00
||sites.google.com/view/57ytdf/bt$all
Filter updated: Fri, 20 Aug 2021 12:01:48 +0000
2021-08-20 12:01:48 +00:00
||sites.google.com/view/58658-5795-btrefundoffice365/office365$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||sites.google.com/view/62374ytu/btconnecc?authuser=1$all
||sites.google.com/view/657yttr/btconnecct$all
Filter updated: Sat, 04 Sep 2021 00:17:00 +0000
2021-09-04 00:17:00 +00:00
||sites.google.com/view/7458694584hjgg/bt$all
Filter updated: Tue, 31 Aug 2021 12:01:54 +0000
2021-08-31 12:01:54 +00:00
||sites.google.com/view/76767jkk/btbillpay$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||sites.google.com/view/78578g/btconnnecct$all
Filter updated: Sat, 04 Sep 2021 00:17:00 +0000
2021-09-04 00:17:00 +00:00
||sites.google.com/view/8097tr6e56tyfhgjkl/office$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||sites.google.com/view/98yuk/bt$all
Filter updated: Mon, 26 Jul 2021 00:02:16 +0000
2021-07-26 00:02:17 +00:00
||sites.google.com/view/abtbusinesx/home$all
Filter updated: Thu, 19 Aug 2021 12:02:33 +0000
2021-08-19 12:02:33 +00:00
||sites.google.com/view/access-office-docxpdf-call-net/home$all
Filter updated: Fri, 13 Aug 2021 12:01:44 +0000
2021-08-13 12:01:44 +00:00
||sites.google.com/view/acct-bt-service-upgrade/home$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||sites.google.com/view/accueil-b-p-postale/accueil$all
Filter updated: Thu, 17 Jun 2021 12:06:40 +0000
2021-06-17 12:06:40 +00:00
||sites.google.com/view/adesdaw/bt-business$all
Filter updated: Mon, 20 Sep 2021 12:02:05 +0000
2021-09-20 12:02:05 +00:00
||sites.google.com/view/airaixe$all
Filter updated: Tue, 24 Aug 2021 00:02:23 +0000
2021-08-24 00:02:24 +00:00
||sites.google.com/view/akgthrjfigjiosjfszdio/office365$all
Filter updated: Sat, 28 Aug 2021 00:33:51 +0000
2021-08-28 00:33:51 +00:00
||sites.google.com/view/app-mobile-pages/$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||sites.google.com/view/asddfgfdsdffggghhjjkkhg/bt$all
Filter updated: Tue, 13 Apr 2021 00:06:31 UTC
2021-04-13 00:06:31 +00:00
||sites.google.com/view/asdfghjklhgfdsdfgh/home$all
Filter updated: Wed, 25 Aug 2021 12:02:06 +0000
2021-08-25 12:02:07 +00:00
||sites.google.com/view/askdnhojajs/office365$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||sites.google.com/view/asloke$all
Filter updated: Thu, 26 Aug 2021 00:02:01 +0000
2021-08-26 00:02:01 +00:00
||sites.google.com/view/atguytrewr/home$all
Filter updated: Wed, 21 Jul 2021 00:01:57 +0000
2021-07-21 00:01:57 +00:00
||sites.google.com/view/att-communications/home$all
Filter updated: Tue, 20 Jul 2021 12:01:48 +0000
2021-07-20 12:01:48 +00:00
||sites.google.com/view/att-managements/home$all
Filter updated: Wed, 16 Jun 2021 12:06:46 +0000
2021-06-16 12:06:46 +00:00
||sites.google.com/view/att-yahoomail$all
Filter updated: Thu, 16 Sep 2021 00:01:52 +0000
2021-09-16 00:01:52 +00:00
||sites.google.com/view/attupdatinglog/home$all
Filter updated: Wed, 07 Jul 2021 12:01:55 +0000
2021-07-07 12:01:56 +00:00
||sites.google.com/view/attyahoo-connect/home$all
Filter updated: Thu, 19 Aug 2021 12:02:33 +0000
2021-08-19 12:02:33 +00:00
||sites.google.com/view/audio-call-net/home$all
Filter updated: Sat, 19 Jun 2021 00:06:27 +0000
2021-06-19 00:06:27 +00:00
||sites.google.com/view/ball4l/bt-business$all
Filter updated: Wed, 15 Sep 2021 12:01:46 +0000
2021-09-15 12:01:46 +00:00
||sites.google.com/view/bbtbt-loginnnn/secure-bt-com$all
Filter updated: Wed, 28 Jul 2021 12:01:46 +0000
2021-07-28 12:01:46 +00:00
||sites.google.com/view/bdhfewew/home$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||sites.google.com/view/before-we-proceed-chase$all
Filter updated: Fri, 16 Jul 2021 00:01:53 +0000
2021-07-16 00:01:53 +00:00
||sites.google.com/view/before-we-proceed-chase-com$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||sites.google.com/view/before-we-proceed-chasecom$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||sites.google.com/view/benachrichtigung-sparkasse/accueil$all
Filter updated: Sat, 04 Sep 2021 00:17:00 +0000
2021-09-04 00:17:00 +00:00
||sites.google.com/view/billbtnew/bt$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||sites.google.com/view/billready/btconnect$all
Filter updated: Tue, 21 Sep 2021 12:02:11 +0000
2021-09-21 12:02:11 +00:00
||sites.google.com/view/billsbt/bt$all
Filter updated: Sat, 04 Sep 2021 00:17:00 +0000
2021-09-04 00:17:00 +00:00
||sites.google.com/view/bkjfeghrege438t/bt$all
Filter updated: Tue, 31 Aug 2021 12:01:54 +0000
2021-08-31 12:01:54 +00:00
||sites.google.com/view/boardbrand/home$all
Filter updated: Thu, 09 Sep 2021 12:02:27 +0000
2021-09-09 12:02:27 +00:00
||sites.google.com/view/boardbrandd/home$all
Filter updated: Sun, 05 Sep 2021 00:02:15 +0000
2021-09-05 00:02:15 +00:00
||sites.google.com/view/boardbrands/home$all
Filter updated: Tue, 07 Sep 2021 12:01:49 +0000
2021-09-07 12:01:49 +00:00
||sites.google.com/view/boardbrantd/home$all
Filter updated: Sat, 04 Sep 2021 00:17:00 +0000
2021-09-04 00:17:00 +00:00
||sites.google.com/view/bosiness/home$all
Filter updated: Thu, 19 Aug 2021 12:02:33 +0000
2021-08-19 12:02:33 +00:00
||sites.google.com/view/bradescodigital$all
Filter updated: Tue, 31 Aug 2021 12:01:54 +0000
2021-08-31 12:01:54 +00:00
||sites.google.com/view/brandboardsuppor/home%3e%3chttps:/sites.google.com/view/brandboard/home$all
Filter updated: Fri, 10 Sep 2021 12:02:02 +0000
2021-09-10 12:02:02 +00:00
||sites.google.com/view/broadbrands/home$all
Filter updated: Wed, 21 Jul 2021 00:01:57 +0000
2021-07-21 00:01:57 +00:00
||sites.google.com/view/bt-b/home?authuser=6$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||sites.google.com/view/bt-billlive/bt$all
Filter updated: Tue, 20 Jul 2021 12:01:48 +0000
2021-07-20 12:01:48 +00:00
||sites.google.com/view/bt-cloud-voice-review-voice/bt-voice-cloud$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||sites.google.com/view/bt-cloud-work-work/home?authuser=3$all
Filter updated: Fri, 02 Jul 2021 00:01:50 +0000
2021-07-02 00:01:51 +00:00
||sites.google.com/view/bt-clould-preview000112/voice010101010bt-cloud?authuser=8$all
Filter updated: Wed, 25 Aug 2021 12:02:06 +0000
2021-08-25 12:02:07 +00:00
||sites.google.com/view/bt-defund/bt$all
Filter updated: Fri, 30 Jul 2021 12:01:52 +0000
2021-07-30 12:01:52 +00:00
||sites.google.com/view/bt-jobs-page001/home?authuser=3$all
Filter updated: Thu, 23 Sep 2021 00:02:18 +0000
2021-09-23 00:02:18 +00:00
||sites.google.com/view/bt-log-1/bt$all
Filter updated: Thu, 26 Aug 2021 12:02:31 +0000
2021-08-26 12:02:31 +00:00
||sites.google.com/view/bt-loginbt/bt$all
Filter updated: Thu, 16 Sep 2021 00:01:52 +0000
2021-09-16 00:01:52 +00:00
||sites.google.com/view/bt-newbill/bt$all
Filter updated: Mon, 23 Aug 2021 12:02:18 +0000
2021-08-23 12:02:19 +00:00
||sites.google.com/view/bt-notification/home$all
Filter updated: Mon, 16 Aug 2021 00:01:59 +0000
2021-08-16 00:01:59 +00:00
||sites.google.com/view/bt-pdf-receipt-payment/www-bt-pdf?authuser=8$all
Filter updated: Fri, 24 Sep 2021 12:02:36 +0000
2021-09-24 12:02:36 +00:00
||sites.google.com/view/bt-readybill-/bt$all
Filter updated: Thu, 29 Jul 2021 00:01:57 +0000
2021-07-29 00:01:57 +00:00
||sites.google.com/view/bt-recover-id/home?authuser=1$all
Filter updated: Fri, 13 Aug 2021 12:01:44 +0000
2021-08-13 12:01:44 +00:00
||sites.google.com/view/bt-upgrade2021/home?authuser=1$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||sites.google.com/view/bt-viewmybill/bt$all
Filter updated: Mon, 09 Aug 2021 12:01:58 +0000
2021-08-09 12:01:58 +00:00
||sites.google.com/view/bt-viewyourbill/bt$all
Filter updated: Fri, 21 May 2021 12:06:31 UTC
2021-05-21 12:06:31 +00:00
||sites.google.com/view/bt-voice1010010/bt-voicemesaage10120201002?authuser=8$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||sites.google.com/view/bt1btconnectbusinesss/btconnect$all
||sites.google.com/view/bt1business/btconnect$all
Filter updated: Mon, 23 Aug 2021 12:02:18 +0000
2021-08-23 12:02:19 +00:00
||sites.google.com/view/btaccess-review/bt$all
Filter updated: Tue, 24 Aug 2021 00:02:23 +0000
2021-08-24 00:02:24 +00:00
||sites.google.com/view/btaccess/bt$all
Filter updated: Wed, 25 Aug 2021 12:02:06 +0000
2021-08-25 12:02:07 +00:00
||sites.google.com/view/btaccessnow/bt$all
Filter updated: Thu, 12 Aug 2021 00:01:53 +0000
2021-08-12 00:01:54 +00:00
||sites.google.com/view/btanalystic/home$all
Filter updated: Fri, 27 Aug 2021 00:01:47 +0000
2021-08-27 00:01:47 +00:00
||sites.google.com/view/btbill-/bt$all
Filter updated: Fri, 10 Sep 2021 12:02:02 +0000
2021-09-10 12:02:02 +00:00
||sites.google.com/view/btbill-7/bt$all
Filter updated: Wed, 01 Sep 2021 00:02:20 +0000
2021-09-01 00:02:20 +00:00
||sites.google.com/view/btbill-paymentwu82/bt$all
Filter updated: Thu, 23 Sep 2021 00:02:18 +0000
2021-09-23 00:02:18 +00:00
||sites.google.com/view/btbill-ready/bt$all
Filter updated: Wed, 15 Sep 2021 12:01:46 +0000
2021-09-15 12:01:46 +00:00
||sites.google.com/view/btbillbusiness-1/bt$all
Filter updated: Fri, 02 Jul 2021 12:01:53 +0000
2021-07-02 12:01:53 +00:00
||sites.google.com/view/btbillingbusiness/bt$all
Filter updated: Fri, 10 Sep 2021 12:02:02 +0000
2021-09-10 12:02:02 +00:00
||sites.google.com/view/btbillpayment-bt/bt$all
Filter updated: Wed, 01 Sep 2021 00:02:20 +0000
2021-09-01 00:02:20 +00:00
||sites.google.com/view/btbillpayment/bt$all
Filter updated: Mon, 20 Sep 2021 12:02:05 +0000
2021-09-20 12:02:05 +00:00
||sites.google.com/view/btbillreadynow/bt$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||sites.google.com/view/btbillsecure/btconnect$all
Filter updated: Fri, 27 Aug 2021 12:01:40 +0000
2021-08-27 12:01:40 +00:00
||sites.google.com/view/btbillview/bt$all
Filter updated: Tue, 31 Aug 2021 12:01:54 +0000
2021-08-31 12:01:54 +00:00
||sites.google.com/view/btboardbrand/home$all
||sites.google.com/view/btboardbrands/home$all
Filter updated: Sun, 15 Aug 2021 00:01:57 +0000
2021-08-15 00:01:57 +00:00
||sites.google.com/view/btbrandboarddd/home$all
Filter updated: Fri, 13 Aug 2021 12:01:44 +0000
2021-08-13 12:01:44 +00:00
||sites.google.com/view/btbroadcfbandbills$all
Filter updated: Sun, 15 Aug 2021 00:01:57 +0000
2021-08-15 00:01:57 +00:00
||sites.google.com/view/btbtbt-preview-voice-page-/bt-cloud-voice$all
Filter updated: Sat, 28 Aug 2021 00:33:51 +0000
2021-08-28 00:33:51 +00:00
||sites.google.com/view/btbtbt/bt$all
Filter updated: Tue, 31 Aug 2021 12:01:54 +0000
2021-08-31 12:01:54 +00:00
||sites.google.com/view/btbtbtb-cloud-voice00111/home$all
Filter updated: Mon, 09 Aug 2021 12:01:58 +0000
2021-08-09 12:01:58 +00:00
||sites.google.com/view/btbtbtbtbtb-upgrade-mailbox/bt-com$all
Filter updated: Tue, 13 Apr 2021 00:06:31 UTC
2021-04-13 00:06:31 +00:00
||sites.google.com/view/btbtbtbtbtbtcomm/home$all
Filter updated: Sun, 15 Aug 2021 00:01:57 +0000
2021-08-15 00:01:57 +00:00
||sites.google.com/view/btbtbtbtcloudvoice/bt-cloud-voice$all
Filter updated: Wed, 15 Sep 2021 00:01:54 +0000
2021-09-15 00:01:55 +00:00
||sites.google.com/view/btbuiss/home$all
Filter updated: Sun, 15 Aug 2021 00:01:57 +0000
2021-08-15 00:01:57 +00:00
||sites.google.com/view/btbusiness-bt/home$all
Filter updated: Tue, 24 Aug 2021 00:02:23 +0000
2021-08-24 00:02:24 +00:00
||sites.google.com/view/btbusiness-viewyournewbill/bt$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||sites.google.com/view/btbusinessbillready/btconnect$all
||sites.google.com/view/btbusinesssecures/btconnect$all
Filter updated: Thu, 29 Jul 2021 00:01:57 +0000
2021-07-29 00:01:57 +00:00
||sites.google.com/view/btbusinessx/bt$all
Filter updated: Tue, 31 Aug 2021 12:01:54 +0000
2021-08-31 12:01:54 +00:00
||sites.google.com/view/btcloud-1/bt$all
Filter updated: Tue, 13 Apr 2021 00:06:31 UTC
2021-04-13 00:06:31 +00:00
||sites.google.com/view/btcloudpaymentinvoice202000/httpsbtcloudvm-voice-new?authuser=1$all
Filter updated: Fri, 27 Aug 2021 12:01:40 +0000
2021-08-27 12:01:40 +00:00
||sites.google.com/view/btconnect-group-plc/home$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||sites.google.com/view/btconnect2021/home$all
Filter updated: Mon, 05 Jul 2021 00:01:57 +0000
2021-07-05 00:01:57 +00:00
||sites.google.com/view/btconnectbusiness/btconnect$all
Filter updated: Thu, 09 Sep 2021 12:02:27 +0000
2021-09-09 12:02:27 +00:00
||sites.google.com/view/btconnectgroupplc/home$all
Filter updated: Wed, 25 Aug 2021 12:02:06 +0000
2021-08-25 12:02:07 +00:00
||sites.google.com/view/btconnectmailserver/home$all
Filter updated: Tue, 21 Sep 2021 00:01:40 +0000
2021-09-21 00:01:40 +00:00
||sites.google.com/view/btconnectready-bill/bt$all
Filter updated: Tue, 13 Apr 2021 00:06:31 UTC
2021-04-13 00:06:31 +00:00
||sites.google.com/view/btconnectvoicemail-weebly-com/btconnectvm-com$all
Filter updated: Wed, 21 Jul 2021 00:01:57 +0000
2021-07-21 00:01:57 +00:00
||sites.google.com/view/btdhjjbtbtbusiness/btbusiness$all
Filter updated: Tue, 29 Jun 2021 00:01:48 +0000
2021-06-29 00:01:48 +00:00
||sites.google.com/view/btfhdbsjuhjf/btconnect$all
Filter updated: Fri, 20 Aug 2021 12:01:48 +0000
2021-08-20 12:01:48 +00:00
||sites.google.com/view/btfsdbkmvxcbusinesss/office365$all
Filter updated: Mon, 06 Sep 2021 12:01:50 +0000
2021-09-06 12:01:50 +00:00
||sites.google.com/view/bthomelog1/home$all
Filter updated: Fri, 02 Jul 2021 00:01:50 +0000
2021-07-02 00:01:51 +00:00
||sites.google.com/view/btinserve2/home$all
Filter updated: Tue, 13 Apr 2021 00:06:31 UTC
2021-04-13 00:06:31 +00:00
||sites.google.com/view/btinternetco/home$all
Filter updated: Fri, 20 Aug 2021 12:01:48 +0000
2021-08-20 12:01:48 +00:00
||sites.google.com/view/btinternetconectey/home$all
Filter updated: Wed, 07 Jul 2021 00:01:56 +0000
2021-07-07 00:01:57 +00:00
||sites.google.com/view/btinternetonline/home$all
Filter updated: Tue, 24 Aug 2021 00:02:23 +0000
2021-08-24 00:02:24 +00:00
||sites.google.com/view/btinternetverificatioamil/home$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||sites.google.com/view/btissecurelogin/btconnect$all
Filter updated: Mon, 09 Aug 2021 12:01:58 +0000
2021-08-09 12:01:58 +00:00
||sites.google.com/view/btlogin-n/home$all
Filter updated: Thu, 16 Sep 2021 12:02:15 +0000
2021-09-16 12:02:15 +00:00
||sites.google.com/view/btloginfo/bt$all
Filter updated: Tue, 24 Aug 2021 12:02:00 +0000
2021-08-24 12:02:00 +00:00
||sites.google.com/view/btlsecurelog/bt$all
Filter updated: Tue, 31 Aug 2021 12:01:54 +0000
2021-08-31 12:01:54 +00:00
||sites.google.com/view/btmonthlybill-1/bt$all
||sites.google.com/view/btmonthlybill/bt$all
Filter updated: Thu, 02 Sep 2021 00:01:59 +0000
2021-09-02 00:01:59 +00:00
||sites.google.com/view/btmonthlynewbill/bt$all
||sites.google.com/view/btmonthlynewpayment/bt$all
Filter updated: Tue, 31 Aug 2021 12:01:54 +0000
2021-08-31 12:01:54 +00:00
||sites.google.com/view/btmonthlypayment/bt$all
Filter updated: Sun, 02 May 2021 00:06:30 UTC
2021-05-02 00:06:30 +00:00
||sites.google.com/view/btmv-voice-notice011/btvoicemessage?authuser=8$all
Filter updated: Fri, 20 Aug 2021 00:01:56 +0000
2021-08-20 00:01:56 +00:00
||sites.google.com/view/btnet/home$all
Filter updated: Sat, 04 Sep 2021 00:17:00 +0000
2021-09-04 00:17:00 +00:00
||sites.google.com/view/btnew-bill/bt$all
Filter updated: Thu, 02 Sep 2021 00:01:59 +0000
2021-09-02 00:01:59 +00:00
||sites.google.com/view/btnewbill-1/bt$all
Filter updated: Thu, 02 Sep 2021 12:02:02 +0000
2021-09-02 12:02:02 +00:00
||sites.google.com/view/btnewbill-payment/bt$all
Filter updated: Thu, 02 Sep 2021 00:01:59 +0000
2021-09-02 00:01:59 +00:00
||sites.google.com/view/btnewbill/bt$all
Filter updated: Tue, 14 Sep 2021 12:01:44 +0000
2021-09-14 12:01:44 +00:00
||sites.google.com/view/btnewbills/bt$all
Filter updated: Thu, 16 Sep 2021 00:01:52 +0000
2021-09-16 00:01:52 +00:00
||sites.google.com/view/btnewloginbill/bt$all
Filter updated: Tue, 07 Sep 2021 00:01:46 +0000
2021-09-07 00:01:46 +00:00
||sites.google.com/view/btnewweekbill/bt$all
Filter updated: Tue, 13 Apr 2021 00:06:31 UTC
2021-04-13 00:06:31 +00:00
||sites.google.com/view/btnvm-urgentnotice/btvmnew-note?authuser=1$all
Filter updated: Tue, 24 Aug 2021 12:02:00 +0000
2021-08-24 12:02:00 +00:00
||sites.google.com/view/btoffice-log/bt$all
||sites.google.com/view/btofficeaccess/bt$all
Filter updated: Fri, 20 Aug 2021 12:01:48 +0000
2021-08-20 12:01:48 +00:00
||sites.google.com/view/btoficialbusiness20i21/office365$all
Filter updated: Thu, 12 Aug 2021 12:01:52 +0000
2021-08-12 12:01:53 +00:00
||sites.google.com/view/btonlineserver/btpasswordsector$all
Filter updated: Sun, 15 Aug 2021 00:01:57 +0000
2021-08-15 00:01:57 +00:00
||sites.google.com/view/btooolgoooozzzz/home?authuser=3$all
Filter updated: Thu, 02 Sep 2021 00:01:59 +0000
2021-09-02 00:01:59 +00:00
||sites.google.com/view/btpayment-31st/bt$all
Filter updated: Thu, 16 Sep 2021 12:02:15 +0000
2021-09-16 12:02:15 +00:00
||sites.google.com/view/btpaymentbill/bt$all
Filter updated: Tue, 14 Sep 2021 12:01:44 +0000
2021-09-14 12:01:44 +00:00
||sites.google.com/view/btpaymentnew/bt$all
Filter updated: Mon, 23 Aug 2021 12:02:18 +0000
2021-08-23 12:02:19 +00:00
||sites.google.com/view/btpdfbill-002/bt-home$all
Filter updated: Fri, 10 Sep 2021 12:02:02 +0000
2021-09-10 12:02:02 +00:00
||sites.google.com/view/btpermanentbill/bt$all
Filter updated: Tue, 31 Aug 2021 12:01:54 +0000
2021-08-31 12:01:54 +00:00
||sites.google.com/view/btplcgroup/home$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||sites.google.com/view/btready-bill-/bt$all
Filter updated: Tue, 07 Sep 2021 00:01:46 +0000
2021-09-07 00:01:46 +00:00
||sites.google.com/view/btrequestbill/bt$all
Filter updated: Wed, 25 Aug 2021 12:02:06 +0000
2021-08-25 12:02:07 +00:00
||sites.google.com/view/btreset/bt$all
Filter updated: Thu, 16 Sep 2021 00:01:52 +0000
2021-09-16 00:01:52 +00:00
||sites.google.com/view/btsportl/home$all
Filter updated: Thu, 02 Sep 2021 00:01:59 +0000
2021-09-02 00:01:59 +00:00
||sites.google.com/view/bttboardbrand/home$all
Filter updated: Tue, 13 Apr 2021 00:06:31 UTC
2021-04-13 00:06:31 +00:00
||sites.google.com/view/bttbusinesssss/home$all
Filter updated: Thu, 12 Aug 2021 12:01:52 +0000
2021-08-12 12:01:53 +00:00
||sites.google.com/view/bttnet/home$all
Filter updated: Wed, 25 Aug 2021 12:02:06 +0000
2021-08-25 12:02:07 +00:00
||sites.google.com/view/btupdate-1/bt$all
Filter updated: Tue, 31 Aug 2021 12:01:54 +0000
2021-08-31 12:01:54 +00:00
||sites.google.com/view/btupdate-bill/bt$all
Filter updated: Mon, 16 Aug 2021 12:01:42 +0000
2021-08-16 12:01:42 +00:00
||sites.google.com/view/btupdatepage/bt$all
Filter updated: Mon, 09 Aug 2021 12:01:58 +0000
2021-08-09 12:01:58 +00:00
||sites.google.com/view/btvailmus/home$all
Filter updated: Tue, 21 Sep 2021 12:02:11 +0000
2021-09-21 12:02:11 +00:00
||sites.google.com/view/btview-/bt$all
Filter updated: Fri, 24 Sep 2021 00:01:50 +0000
2021-09-24 00:01:51 +00:00
||sites.google.com/view/btview-bill-bt/bt$all
Filter updated: Wed, 22 Sep 2021 12:01:56 +0000
2021-09-22 12:01:56 +00:00
||sites.google.com/view/btview-bills/bt$all
Filter updated: Fri, 24 Sep 2021 12:02:36 +0000
2021-09-24 12:02:36 +00:00
||sites.google.com/view/btviewbill-/bt$all
Filter updated: Tue, 21 Sep 2021 00:01:40 +0000
2021-09-21 00:01:40 +00:00
||sites.google.com/view/btviewbill-11/bt$all
Filter updated: Fri, 17 Sep 2021 00:01:45 +0000
2021-09-17 00:01:46 +00:00
||sites.google.com/view/btviewbill/bt$all
Filter updated: Fri, 10 Sep 2021 12:02:02 +0000
2021-09-10 12:02:02 +00:00
||sites.google.com/view/btviewebill/bt$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||sites.google.com/view/businesbill-view/bt$all
||sites.google.com/view/businessbtsecure/bt-business$all
Filter updated: Fri, 16 Jul 2021 12:01:57 +0000
2021-07-16 12:01:57 +00:00
||sites.google.com/view/businessofficebt/bt-business$all
Filter updated: Mon, 09 Aug 2021 12:01:58 +0000
2021-08-09 12:01:58 +00:00
||sites.google.com/view/cancel-deactivate/bt-com$all
Filter updated: Fri, 13 Aug 2021 12:01:44 +0000
2021-08-13 12:01:44 +00:00
||sites.google.com/view/capitaloneloginus/home$all
Filter updated: Sat, 03 Jul 2021 00:01:56 +0000
2021-07-03 00:01:56 +00:00
||sites.google.com/view/carinapwapw/bt-business$all
Filter updated: Thu, 19 Aug 2021 12:02:33 +0000
2021-08-19 12:02:33 +00:00
||sites.google.com/view/certicodeplus2/accueil$all
Filter updated: Fri, 27 Aug 2021 00:01:47 +0000
2021-08-27 00:01:47 +00:00
||sites.google.com/view/checkbillbt/bt$all
Filter updated: Fri, 24 Sep 2021 00:01:50 +0000
2021-09-24 00:01:51 +00:00
||sites.google.com/view/checkbt/bt$all
Filter updated: Fri, 17 Sep 2021 12:01:51 +0000
2021-09-17 12:01:52 +00:00
||sites.google.com/view/checkinbt/bt$all
Filter updated: Tue, 24 Aug 2021 12:02:00 +0000
2021-08-24 12:02:00 +00:00
||sites.google.com/view/chjh-yjbucy-nngfv-hnfgmnx-bt/office365$all
Filter updated: Fri, 17 Sep 2021 12:01:51 +0000
2021-09-17 12:01:52 +00:00
||sites.google.com/view/ciix/home$all
Filter updated: Fri, 20 Aug 2021 12:01:48 +0000
2021-08-20 12:01:48 +00:00
||sites.google.com/view/clickbtconnect/home?authuser=1$all
Filter updated: Tue, 14 Sep 2021 00:01:48 +0000
2021-09-14 00:01:48 +00:00
||sites.google.com/view/coinsbuysellswapcryptocurrency/?fbclid=iwar2isl9xfxxgcxtftml2hmcl_dglhshlkfkpdotycyqu-qjqqfdqm9whtfm$all
Filter updated: Tue, 24 Aug 2021 00:02:23 +0000
2021-08-24 00:02:24 +00:00
||sites.google.com/view/communication-serveurrdpg/accueil$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||sites.google.com/view/credit-agricole-faccueilca/accueil$all
Filter updated: Fri, 13 Aug 2021 12:01:44 +0000
2021-08-13 12:01:44 +00:00
||sites.google.com/view/ctz03$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||sites.google.com/view/currentlyatt/home$all
Filter updated: Fri, 13 Aug 2021 12:01:44 +0000
2021-08-13 12:01:44 +00:00
||sites.google.com/view/dashesdl00$all
Filter updated: Wed, 18 Aug 2021 12:02:35 +0000
2021-08-18 12:02:36 +00:00
||sites.google.com/view/dedehyhg/home$all
Filter updated: Tue, 24 Aug 2021 12:02:00 +0000
2021-08-24 12:02:00 +00:00
||sites.google.com/view/dfbjkzdmktmhzlhdjtgzdjzzjs/office365$all
Filter updated: Tue, 13 Apr 2021 00:06:31 UTC
2021-04-13 00:06:31 +00:00
||sites.google.com/view/dfghjhckuyf/home$all
||sites.google.com/view/dfghjhl/home$all
Filter updated: Wed, 25 Aug 2021 12:02:06 +0000
2021-08-25 12:02:07 +00:00
||sites.google.com/view/dfghjkllkgfdfghkljkkjhg/office365$all
Filter updated: Tue, 24 Aug 2021 00:02:23 +0000
2021-08-24 00:02:24 +00:00
||sites.google.com/view/dfhjklkjhgfddfzhxjcjk/office365$all
||sites.google.com/view/djgfdgzogjsm-js-riyavet-hbt/office365$all
Filter updated: Thu, 02 Sep 2021 00:01:59 +0000
2021-09-02 00:01:59 +00:00
||sites.google.com/view/djkfghwug75/bt$all
Filter updated: Fri, 27 Aug 2021 00:01:47 +0000
2021-08-27 00:01:47 +00:00
||sites.google.com/view/djklgfnj-jkjxukyuip97/office365$all
Filter updated: Thu, 22 Jul 2021 00:01:54 +0000
2021-07-22 00:01:54 +00:00
||sites.google.com/view/dododokido/home$all
Filter updated: Thu, 26 Aug 2021 12:02:31 +0000
2021-08-26 12:02:31 +00:00
||sites.google.com/view/dosfdhdgkbmdzgjzoalzgk/office365$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||sites.google.com/view/drakio/bt-business$all
Filter updated: Fri, 20 Aug 2021 12:01:48 +0000
2021-08-20 12:01:48 +00:00
||sites.google.com/view/dsjbnsdkfgndhjfjzoim/365office$all
Filter updated: Sat, 04 Sep 2021 12:01:40 +0000
2021-09-04 12:01:40 +00:00
||sites.google.com/view/dsvhv74t43/bt$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||sites.google.com/view/duf/bt$all
Filter updated: Tue, 24 Aug 2021 00:02:23 +0000
2021-08-24 00:02:24 +00:00
||sites.google.com/view/efdgfkdsdjfvsizobkl/office365$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||sites.google.com/view/ekofederal/bt-business$all
Filter updated: Fri, 20 Aug 2021 12:01:48 +0000
2021-08-20 12:01:48 +00:00
||sites.google.com/view/esfgjdgfshggd58-btbillrepaymnt/office365$all
Filter updated: Wed, 24 Mar 2021 12:06:42 UTC
2021-03-24 12:06:42 +00:00
||sites.google.com/view/espacemessagerieorangesms/accueil$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||sites.google.com/view/esuniketegbe/bt-business$all
Filter updated: Sun, 02 May 2021 00:06:30 UTC
2021-05-02 00:06:30 +00:00
||sites.google.com/view/etyajdnxnskoeprlwyaxbdhfkrituy/btconnect$all
Filter updated: Fri, 27 Aug 2021 00:01:47 +0000
2021-08-27 00:01:47 +00:00
||sites.google.com/view/facturemob-boxligne/accueil$all
Filter updated: Fri, 03 Sep 2021 12:01:48 +0000
2021-09-03 12:01:48 +00:00
||sites.google.com/view/fbs-confrim/$all
Filter updated: Fri, 27 Aug 2021 12:01:40 +0000
2021-08-27 12:01:40 +00:00
||sites.google.com/view/fdbt-bsuinesskbcksfjz/office365$all
Filter updated: Tue, 20 Jul 2021 12:01:48 +0000
2021-07-20 12:01:48 +00:00
||sites.google.com/view/feelblessed/bt-business$all
Filter updated: Thu, 10 Jun 2021 00:06:48 UTC
2021-06-10 00:06:48 +00:00
||sites.google.com/view/ffjhgfnbgbpdjbvduvbwv/bt$all
||sites.google.com/view/fgbhlzjcsn/bt$all
Filter updated: Thu, 02 Sep 2021 00:01:59 +0000
2021-09-02 00:01:59 +00:00
||sites.google.com/view/fggtg/home$all
Filter updated: Tue, 17 Aug 2021 00:02:45 +0000
2021-08-17 00:02:45 +00:00
||sites.google.com/view/fghjgjfhjmmfngc/home$all
Filter updated: Tue, 17 Aug 2021 12:01:39 +0000
2021-08-17 12:01:39 +00:00
||sites.google.com/view/fghjgjfhjmmfngc/home/$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||sites.google.com/view/fhfv-btcoplc/bt$all
Filter updated: Fri, 11 Jun 2021 00:06:40 UTC
2021-06-11 00:06:40 +00:00
||sites.google.com/view/freshtotal/bt$all
Filter updated: Fri, 27 Aug 2021 00:01:47 +0000
2021-08-27 00:01:47 +00:00
||sites.google.com/view/gduhjzfughbfld/office365$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||sites.google.com/view/gfgherbviughegbn/bt$all
Filter updated: Sat, 18 Sep 2021 12:01:34 +0000
2021-09-18 12:01:34 +00:00
||sites.google.com/view/ghdgehe/home?authuser=4$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||sites.google.com/view/ghgjlkhfjgggwgwgr/bt$all
Filter updated: Wed, 22 Sep 2021 12:01:56 +0000
2021-09-22 12:01:56 +00:00
||sites.google.com/view/ghjkuytrdfgh/home$all
Filter updated: Fri, 24 Sep 2021 12:02:36 +0000
2021-09-24 12:02:36 +00:00
||sites.google.com/view/gjhjhkj/home$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||sites.google.com/view/googluxxk/bt-business$all
Filter updated: Tue, 13 Apr 2021 00:06:31 UTC
2021-04-13 00:06:31 +00:00
||sites.google.com/view/hccwc/home$all
Filter updated: Sun, 11 Jul 2021 12:01:37 +0000
2021-07-11 12:01:38 +00:00
||sites.google.com/view/hgdfwer/bt$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||sites.google.com/view/hiudrfsdgh/home$all
Filter updated: Fri, 20 Aug 2021 12:01:48 +0000
2021-08-20 12:01:48 +00:00
||sites.google.com/view/hjyuhijhiukhghjk/home$all
Filter updated: Wed, 25 Aug 2021 12:02:06 +0000
2021-08-25 12:02:07 +00:00
||sites.google.com/view/home-bt-updates/bt-com$all
Filter updated: Fri, 13 Aug 2021 12:01:44 +0000
2021-08-13 12:01:44 +00:00
||sites.google.com/view/home-btconnect-bills/home$all
Filter updated: Tue, 21 Sep 2021 00:01:40 +0000
2021-09-21 00:01:40 +00:00
||sites.google.com/view/homebt/bt-home$all
Filter updated: Wed, 01 Sep 2021 00:02:20 +0000
2021-09-01 00:02:20 +00:00
||sites.google.com/view/hornygirlc/home$all
Filter updated: Tue, 13 Apr 2021 00:06:31 UTC
2021-04-13 00:06:31 +00:00
||sites.google.com/view/htvvss/home?authuser=3$all
Filter updated: Thu, 29 Jul 2021 00:01:57 +0000
2021-07-29 00:01:57 +00:00
||sites.google.com/view/i86edssertuilmjuj00u7trr45r4/home$all
Filter updated: Tue, 15 Jun 2021 12:29:08 UTC
2021-06-15 12:29:08 +00:00
||sites.google.com/view/ichaba-lavish/bt-businexs$all
Filter updated: Fri, 24 Sep 2021 00:01:50 +0000
2021-09-24 00:01:51 +00:00
||sites.google.com/view/identyyc-helpsm20/$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||sites.google.com/view/ieurf/bt$all
Filter updated: Wed, 25 Aug 2021 12:02:06 +0000
2021-08-25 12:02:07 +00:00
||sites.google.com/view/invoice-payment-pdf/home$all
Filter updated: Fri, 13 Aug 2021 12:01:44 +0000
2021-08-13 12:01:44 +00:00
||sites.google.com/view/invoice-payment/home$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||sites.google.com/view/iuyggdt/bt$all
Filter updated: Tue, 13 Apr 2021 00:06:31 UTC
2021-04-13 00:06:31 +00:00
||sites.google.com/view/jcnvvn/home$all
Filter updated: Fri, 27 Aug 2021 00:01:47 +0000
2021-08-27 00:01:47 +00:00
||sites.google.com/view/jfrijsufe0rjgplsvkdm/office365$all
Filter updated: Tue, 24 Aug 2021 12:02:00 +0000
2021-08-24 12:02:00 +00:00
||sites.google.com/view/jgvh-thtssmvvhhvcvyghbjnkgrdty/office365$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||sites.google.com/view/jhddd/bt$all
Filter updated: Thu, 02 Sep 2021 00:01:59 +0000
2021-09-02 00:01:59 +00:00
||sites.google.com/view/jkfdskghw8484/bt$all
Filter updated: Tue, 13 Apr 2021 00:06:31 UTC
2021-04-13 00:06:31 +00:00
||sites.google.com/view/jmjmnhvdc/home$all
Filter updated: Fri, 27 Aug 2021 00:01:47 +0000
2021-08-27 00:01:47 +00:00
||sites.google.com/view/jmnhgdfvasxhjfk/office365$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||sites.google.com/view/johnbullmysonisenttttiyoutosch/home$all
Filter updated: Thu, 26 Aug 2021 12:02:31 +0000
2021-08-26 12:02:31 +00:00
||sites.google.com/view/jsdfkhjfjhfjgkumf-dhf/office365$all
Filter updated: Wed, 25 Aug 2021 12:02:06 +0000
2021-08-25 12:02:07 +00:00
||sites.google.com/view/jsdkfdggstjhkgdfshj-bts-bgnhdg/office365$all
Filter updated: Wed, 04 Aug 2021 00:02:10 +0000
2021-08-04 00:02:10 +00:00
||sites.google.com/view/kayodemi/home$all
Filter updated: Fri, 27 Aug 2021 00:01:47 +0000
2021-08-27 00:01:47 +00:00
||sites.google.com/view/keepcurrentbt/bt$all
Filter updated: Mon, 20 Sep 2021 12:02:05 +0000
2021-09-20 12:02:05 +00:00
||sites.google.com/view/ktaonline$all
Filter updated: Sun, 19 Sep 2021 12:01:34 +0000
2021-09-19 12:01:35 +00:00
||sites.google.com/view/labred-authentification-source/accueil$all
Filter updated: Sat, 03 Jul 2021 00:01:56 +0000
2021-07-03 00:01:56 +00:00
||sites.google.com/view/lateatnight/bt-business$all
Filter updated: Sat, 28 Aug 2021 00:33:51 +0000
2021-08-28 00:33:51 +00:00
||sites.google.com/view/login-bt/bt$all
Filter updated: Sat, 03 Jul 2021 00:01:56 +0000
2021-07-03 00:01:56 +00:00
||sites.google.com/view/loginbt/btconnect$all
Filter updated: Wed, 15 Sep 2021 12:01:46 +0000
2021-09-15 12:01:46 +00:00
||sites.google.com/view/loginyourbill/bt$all
Filter updated: Tue, 31 Aug 2021 12:01:54 +0000
2021-08-31 12:01:54 +00:00
||sites.google.com/view/maillogobt/home$all
Filter updated: Thu, 02 Sep 2021 00:01:59 +0000
2021-09-02 00:01:59 +00:00
||sites.google.com/view/mailnlinkbtmila/home$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||sites.google.com/view/mapeeeeemipaapaodkdjrrddd/home$all
Filter updated: Tue, 13 Apr 2021 00:06:31 UTC
2021-04-13 00:06:31 +00:00
||sites.google.com/view/mcwdbvefjberjrwgnwriviwr/home$all
Filter updated: Mon, 26 Jul 2021 00:02:16 +0000
2021-07-26 00:02:17 +00:00
||sites.google.com/view/micraosaftefficei/bt$all
Filter updated: Tue, 24 Aug 2021 12:02:00 +0000
2021-08-24 12:02:00 +00:00
||sites.google.com/view/mmse/home$all
Filter updated: Tue, 31 Aug 2021 00:01:55 +0000
2021-08-31 00:01:55 +00:00
||sites.google.com/view/mobile-pages-/$all
Filter updated: Sun, 29 Aug 2021 00:01:50 +0000
2021-08-29 00:01:51 +00:00
||sites.google.com/view/mobile-redirect-pages/$all
Filter updated: Wed, 01 Sep 2021 00:02:20 +0000
2021-09-01 00:02:20 +00:00
||sites.google.com/view/monsitewebfacture888/accueil$all
Filter updated: Thu, 16 Sep 2021 12:02:15 +0000
2021-09-16 12:02:15 +00:00
||sites.google.com/view/monthly-bill-reveiw00o0o1/bt-com$all
Filter updated: Fri, 13 Aug 2021 12:01:44 +0000
2021-08-13 12:01:44 +00:00
||sites.google.com/view/mv-voicepage/home?authuser=8$all
Filter updated: Fri, 02 Jul 2021 00:01:50 +0000
2021-07-02 00:01:51 +00:00
||sites.google.com/view/mybillready/btconect$all
Filter updated: Thu, 19 Aug 2021 00:01:47 +0000
2021-08-19 00:01:47 +00:00
||sites.google.com/view/mybt273ehdjsecure/bt-business$all
Filter updated: Fri, 27 Aug 2021 00:01:47 +0000
2021-08-27 00:01:47 +00:00
||sites.google.com/view/mybtbill--1/bt$all
Filter updated: Wed, 01 Sep 2021 00:02:20 +0000
2021-09-01 00:02:20 +00:00
||sites.google.com/view/mybtbill-1/bt$all
Filter updated: Sat, 04 Sep 2021 00:17:00 +0000
2021-09-04 00:17:00 +00:00
||sites.google.com/view/mybtbill-new/bt$all
Filter updated: Thu, 16 Sep 2021 00:01:52 +0000
2021-09-16 00:01:52 +00:00
||sites.google.com/view/mybtbilllogin/bt$all
Filter updated: Wed, 01 Sep 2021 00:02:20 +0000
2021-09-01 00:02:20 +00:00
||sites.google.com/view/mybtbillpayment/bt$all
Filter updated: Thu, 16 Sep 2021 12:02:15 +0000
2021-09-16 12:02:15 +00:00
||sites.google.com/view/mybtnewbill/bt$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||sites.google.com/view/mybtsececurvaytvfcigfdtcvbd/bt$all
Filter updated: Tue, 31 Aug 2021 12:01:54 +0000
2021-08-31 12:01:54 +00:00
||sites.google.com/view/mymailbox/home$all
Filter updated: Sat, 04 Sep 2021 00:17:00 +0000
2021-09-04 00:17:00 +00:00
||sites.google.com/view/new-btbill/bt$all
||sites.google.com/view/newbtbill/bt$all
Filter updated: Tue, 13 Apr 2021 00:06:31 UTC
2021-04-13 00:06:31 +00:00
||sites.google.com/view/newbtmissedcall/home$all
||sites.google.com/view/newvoicemail/home?authuser=1$all
Filter updated: Tue, 14 Sep 2021 00:01:48 +0000
2021-09-14 00:01:48 +00:00
||sites.google.com/view/notificationpublicpage$all
Filter updated: Tue, 13 Apr 2021 00:06:31 UTC
2021-04-13 00:06:31 +00:00
||sites.google.com/view/offiice-voice-com/home$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||sites.google.com/view/oihgf/bt$all
Filter updated: Fri, 11 Jun 2021 00:06:40 UTC
2021-06-11 00:06:40 +00:00
||sites.google.com/view/oiugfdhbjnk/bt$all
Filter updated: Thu, 10 Jun 2021 00:06:48 UTC
2021-06-10 00:06:48 +00:00
||sites.google.com/view/oiuyfdsdfghj/bt$all
Filter updated: Tue, 27 Jul 2021 00:02:10 +0000
2021-07-27 00:02:10 +00:00
||sites.google.com/view/oiuytf/bt$all
Filter updated: Wed, 25 Aug 2021 12:02:06 +0000
2021-08-25 12:02:07 +00:00
||sites.google.com/view/oixdfjdfjzkkbt-76-business/office365$all
Filter updated: Thu, 29 Jul 2021 00:01:57 +0000
2021-07-29 00:01:57 +00:00
||sites.google.com/view/omobabaolowonofitdie/home$all
Filter updated: Fri, 20 Aug 2021 00:01:56 +0000
2021-08-20 00:01:56 +00:00
||sites.google.com/view/operateur-communication999/accueil$all
Filter updated: Tue, 17 Aug 2021 00:02:45 +0000
2021-08-17 00:02:45 +00:00
||sites.google.com/view/orange-bank/accueil$all
Filter updated: Wed, 18 Aug 2021 00:01:50 +0000
2021-08-18 00:01:50 +00:00
||sites.google.com/view/orangebankfrance/accueil?utm_source=newsletter&utm_medium=email&utm_campaign=bienvenue+solde+80%25$all
Filter updated: Mon, 09 Aug 2021 12:01:58 +0000
2021-08-09 12:01:58 +00:00
||sites.google.com/view/orangemsg/accueil$all
Filter updated: Fri, 24 Sep 2021 00:01:50 +0000
2021-09-24 00:01:51 +00:00
||sites.google.com/view/paginadetectada$all
Filter updated: Wed, 25 Aug 2021 12:02:06 +0000
2021-08-25 12:02:07 +00:00
||sites.google.com/view/passoip/accueil$all
Filter updated: Thu, 16 Sep 2021 12:02:15 +0000
2021-09-16 12:02:15 +00:00
||sites.google.com/view/payment-1/bt$all
Filter updated: Wed, 03 Mar 2021 12:14:44 UTC
2021-03-03 12:14:44 +00:00
||sites.google.com/view/paypal-customer-services/$all
Filter updated: Sun, 28 Feb 2021 12:09:19 UTC
2021-02-28 12:09:19 +00:00
||sites.google.com/view/paypal-loginn/$all
Filter updated: Sat, 20 Mar 2021 00:06:31 UTC
2021-03-20 00:06:31 +00:00
||sites.google.com/view/paypalloginsignin$all
||sites.google.com/view/paypalloginsignin/$all
Filter updated: Tue, 21 Sep 2021 12:02:11 +0000
2021-09-21 12:02:11 +00:00
||sites.google.com/view/payyourbill/bt$all
Filter updated: Tue, 13 Apr 2021 00:06:31 UTC
2021-04-13 00:06:31 +00:00
||sites.google.com/view/pfherjwlsnmcyelwudy/home?authuser=3$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||sites.google.com/view/plkbf/bt$all
||sites.google.com/view/plugtopeckham/bt-business$all
Filter updated: Sat, 19 Jun 2021 00:06:27 +0000
2021-06-19 00:06:27 +00:00
||sites.google.com/view/pompomsx/bt-business$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||sites.google.com/view/postacerticodplusaccaccueil/accueil$all
Filter updated: Thu, 01 Jul 2021 12:02:02 +0000
2021-07-01 12:02:03 +00:00
||sites.google.com/view/readybillbt/btconnec$all
Filter updated: Tue, 21 Sep 2021 00:01:40 +0000
2021-09-21 00:01:40 +00:00
||sites.google.com/view/readynewbill/bt$all
Filter updated: Thu, 29 Jul 2021 00:01:57 +0000
2021-07-29 00:01:57 +00:00
||sites.google.com/view/reviewbt/home$all
Filter updated: Tue, 20 Jul 2021 12:01:48 +0000
2021-07-20 12:01:48 +00:00
||sites.google.com/view/richcoff/bt-business$all
Filter updated: Mon, 23 Aug 2021 12:02:18 +0000
2021-08-23 12:02:19 +00:00
||sites.google.com/view/rkgjhfkgnkgfgdkzxkzdx/office365$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||sites.google.com/view/rtsadyffuvfoi/home$all
Filter updated: Wed, 15 Sep 2021 00:01:54 +0000
2021-09-15 00:01:55 +00:00
||sites.google.com/view/s00420122kl-t2$all
Filter updated: Tue, 21 Sep 2021 12:02:11 +0000
2021-09-21 12:02:11 +00:00
||sites.google.com/view/sadsvfghnjdmackngd/office365$all
Filter updated: Mon, 20 Sep 2021 12:02:05 +0000
2021-09-20 12:02:05 +00:00
||sites.google.com/view/sdfhjkjhasdghj/home$all
Filter updated: Mon, 31 May 2021 12:06:30 UTC
2021-05-31 12:06:30 +00:00
||sites.google.com/view/secure-bt-homevoice01010120/home?authuser=8$all
Filter updated: Sun, 11 Jul 2021 12:01:37 +0000
2021-07-11 12:01:38 +00:00
||sites.google.com/view/securebtweebly/bt$all
Filter updated: Sat, 04 Sep 2021 00:17:00 +0000
2021-09-04 00:17:00 +00:00
||sites.google.com/view/securemybt/bt$all
Filter updated: Fri, 13 Aug 2021 12:01:44 +0000
2021-08-13 12:01:44 +00:00
||sites.google.com/view/serveur-communication-box/accueil$all
Filter updated: Sun, 02 May 2021 00:06:30 UTC
2021-05-02 00:06:30 +00:00
||sites.google.com/view/serveur-communication-pro/accueil$all
Filter updated: Thu, 01 Jul 2021 12:02:02 +0000
2021-07-01 12:02:03 +00:00
||sites.google.com/view/sghbjyx/btconnect$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||sites.google.com/view/shootup/bt-business$all
Filter updated: Wed, 25 Aug 2021 12:02:06 +0000
2021-08-25 12:02:07 +00:00
||sites.google.com/view/simpleswapofficialsite/home$all
Filter updated: Fri, 20 Aug 2021 12:01:48 +0000
2021-08-20 12:01:48 +00:00
||sites.google.com/view/soeyankandi5/bt-business$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||sites.google.com/view/strtm-statr/strtym-statr?fbclid=iwar2z7e7ynueypheqdawlqj8xflososlpfqiskb5c2j3lhtn0j-dlmw5pkj0$all
Filter updated: Thu, 29 Jul 2021 00:01:57 +0000
2021-07-29 00:01:57 +00:00
||sites.google.com/view/surveypagelogin/home$all
Filter updated: Fri, 11 Jun 2021 00:06:40 UTC
2021-06-11 00:06:40 +00:00
||sites.google.com/view/tebgbu/bt$all
Filter updated: Sat, 19 Jun 2021 00:06:27 +0000
2021-06-19 00:06:27 +00:00
||sites.google.com/view/tr129/btconneccc$all
Filter updated: Fri, 13 Aug 2021 12:01:44 +0000
2021-08-13 12:01:44 +00:00
||sites.google.com/view/transect/$all
Filter updated: Tue, 24 Aug 2021 12:02:00 +0000
2021-08-24 12:02:00 +00:00
||sites.google.com/view/trjhhklfjzgujsumkgn-bt/office365$all
Filter updated: Sun, 27 Jun 2021 12:06:19 +0000
2021-06-27 12:06:19 +00:00
||sites.google.com/view/trsrthhggfghj/home$all
Filter updated: Sun, 11 Jul 2021 00:02:18 +0000
2021-07-11 00:02:18 +00:00
||sites.google.com/view/ugerfg5bv/bt$all
Filter updated: Fri, 27 Aug 2021 12:01:40 +0000
2021-08-27 12:01:40 +00:00
||sites.google.com/view/uoiytrewsdfgfhjhkjn/office365$all
Filter updated: Thu, 23 Sep 2021 00:02:18 +0000
2021-09-23 00:02:18 +00:00
||sites.google.com/view/updatenewaccess/home$all
Filter updated: Mon, 09 Aug 2021 12:01:58 +0000
2021-08-09 12:01:58 +00:00
||sites.google.com/view/upgrade-bt/home$all
||sites.google.com/view/upgrade-btbtbtb/bt-com$all
Filter updated: Sun, 27 Jun 2021 12:06:19 +0000
2021-06-27 12:06:19 +00:00
||sites.google.com/view/uyfyresfcgvjkl/home$all
Filter updated: Tue, 15 Jun 2021 00:06:35 UTC
2021-06-15 00:06:35 +00:00
||sites.google.com/view/va139/btcomms?authuser=1$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||sites.google.com/view/va779/btcomm?authuser=1$all
Filter updated: Wed, 25 Aug 2021 12:02:06 +0000
2021-08-25 12:02:07 +00:00
||sites.google.com/view/venmo-loginusa/$all
Filter updated: Tue, 13 Apr 2021 00:06:31 UTC
2021-04-13 00:06:31 +00:00
||sites.google.com/view/vfbjf/btconnect$all
Filter updated: Tue, 21 Sep 2021 00:01:40 +0000
2021-09-21 00:01:40 +00:00
||sites.google.com/view/vgjg/bt-business$all
Filter updated: Sun, 25 Jul 2021 00:01:57 +0000
2021-07-25 00:01:58 +00:00
||sites.google.com/view/view%20-your-bills/home$all
Filter updated: Fri, 27 Aug 2021 12:01:40 +0000
2021-08-27 12:01:40 +00:00
||sites.google.com/view/view-btbilll/bt$all
Filter updated: Fri, 27 Aug 2021 00:01:47 +0000
2021-08-27 00:01:47 +00:00
||sites.google.com/view/viewbill-bt-1/bt$all
Filter updated: Thu, 26 Aug 2021 12:02:31 +0000
2021-08-26 12:02:31 +00:00
||sites.google.com/view/viewbill-bt1/bt$all
Filter updated: Fri, 27 Aug 2021 00:01:47 +0000
2021-08-27 00:01:47 +00:00
||sites.google.com/view/viewbillbtnow/bt$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||sites.google.com/view/viewbtbillbusiness/btconnect$all
||sites.google.com/view/viewbtbusinessbill/btconnect$all
||sites.google.com/view/viewmybill/btconnect$all
Filter updated: Thu, 23 Sep 2021 00:02:18 +0000
2021-09-23 00:02:18 +00:00
||sites.google.com/view/viewmybt-/bt$all
Filter updated: Wed, 22 Sep 2021 12:01:56 +0000
2021-09-22 12:01:56 +00:00
||sites.google.com/view/viewmybtbill-2/bt$all
Filter updated: Tue, 13 Apr 2021 00:06:31 UTC
2021-04-13 00:06:31 +00:00
||sites.google.com/view/viewyournewbill/bt-business-btconnect$all
||sites.google.com/view/vjsdhdfidjasi/btconnect$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||sites.google.com/view/voice-cloud-cloud/home?authuser=3$all
Filter updated: Mon, 16 Aug 2021 00:01:59 +0000
2021-08-16 00:01:59 +00:00
||sites.google.com/view/voicenote-office365/home$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||sites.google.com/view/watueru/bt-business$all
Filter updated: Sat, 21 Aug 2021 00:01:53 +0000
2021-08-21 00:01:54 +00:00
||sites.google.com/view/webmail12bt/home$all
Filter updated: Wed, 28 Jul 2021 00:02:03 +0000
2021-07-28 00:02:03 +00:00
||sites.google.com/view/webservice123/home$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||sites.google.com/view/wefgb/bt$all
||sites.google.com/view/wkkdbillz7z/bt-business$all
Filter updated: Tue, 24 Aug 2021 00:02:23 +0000
2021-08-24 00:02:24 +00:00
||sites.google.com/view/wnbhkfjfoie5ur9/office365$all
Filter updated: Mon, 26 Jul 2021 00:02:16 +0000
2021-07-26 00:02:17 +00:00
||sites.google.com/view/wsdxcvvbnb/bt$all
Filter updated: Tue, 13 Apr 2021 00:06:31 UTC
2021-04-13 00:06:31 +00:00
||sites.google.com/view/xcccjcdhasks/btconnect$all
Filter updated: Thu, 29 Jul 2021 00:01:57 +0000
2021-07-29 00:01:57 +00:00
||sites.google.com/view/xfinityupgrad/home?authuser=3$all
Filter updated: Thu, 26 Aug 2021 00:02:01 +0000
2021-08-26 00:02:01 +00:00
||sites.google.com/view/xfojnbvijozhd-mfjv-bt/office365$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||sites.google.com/view/xinmywin/bt-business$all
Filter updated: Fri, 13 Aug 2021 12:01:44 +0000
2021-08-13 12:01:44 +00:00
||sites.google.com/view/xmicrosoftoficew/home$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||sites.google.com/view/xsuooma/bt-business$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||sites.google.com/view/xuaok/home$all
Filter updated: Tue, 13 Apr 2021 00:06:31 UTC
2021-04-13 00:06:31 +00:00
||sites.google.com/view/xvhfefef/bt-business$all
Filter updated: Thu, 17 Jun 2021 00:06:32 +0000
2021-06-17 00:06:32 +00:00
||sites.google.com/view/yanyan7/bt-business$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||sites.google.com/view/yktvyessir/bt-business$all
Filter updated: Thu, 16 Sep 2021 00:01:52 +0000
2021-09-16 00:01:52 +00:00
||sites.google.com/view/ymaiiil109/$all
Filter updated: Mon, 12 Apr 2021 12:08:04 UTC
2021-04-12 12:08:04 +00:00
||sites.google.com/view/yorku-ca-hayford$all
Filter updated: Sat, 04 Sep 2021 00:17:00 +0000
2021-09-04 00:17:00 +00:00
||sites.google.com/view/youronlneserviceinfo/home?authuser=6$all
Filter updated: Tue, 29 Jun 2021 12:02:07 +0000
2021-06-29 12:02:07 +00:00
||sites.google.com/view/yt89ougjio/bt$all
Filter updated: Fri, 20 Aug 2021 00:01:56 +0000
2021-08-20 00:01:56 +00:00
||sites.google.com/view/ytesdfxfgvjikjnm/bt$all
Filter updated: Tue, 24 Aug 2021 00:02:23 +0000
2021-08-24 00:02:24 +00:00
||sites.google.com/view/zsgkjdhgjitjgbnzl/office365$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||sites.google.com/view/zxchooloshi/bt$all
Filter updated: Fri, 24 Sep 2021 12:02:36 +0000
2021-09-24 12:02:36 +00:00
||sites.google.com/view/zxcvbnmjkhsdfghj/home$all
Filter updated: Tue, 14 Sep 2021 12:01:44 +0000
2021-09-14 12:01:44 +00:00
||siteserversolutions.com$all
Filter updated: Fri, 02 Jul 2021 00:01:50 +0000
2021-07-02 00:01:51 +00:00
||situs-facebook-resmi21.webnode.com$all
Filter updated: Sat, 22 May 2021 12:07:44 UTC
2021-05-22 12:07:44 +00:00
||situs-pemulihan-resmi0.webnode.com$all
Filter updated: Thu, 26 Aug 2021 12:02:31 +0000
2021-08-26 12:02:31 +00:00
||sixlincolns.com$all
Filter updated: Wed, 22 Sep 2021 00:02:26 +0000
2021-09-22 00:02:26 +00:00
||sjdkjkdfdk-jnfkff-nfjkfk.s3.amazonaws.com/index.html$all
Filter updated: Wed, 23 Jun 2021 00:06:32 +0000
2021-06-23 00:06:32 +00:00
||sjsemi.com$all
Filter updated: Wed, 04 Aug 2021 00:02:10 +0000
2021-08-04 00:02:10 +00:00
||ski-dxb.com$all
Filter updated: Thu, 23 Sep 2021 00:02:18 +0000
2021-09-23 00:02:18 +00:00
||skillspro.net$all
Filter updated: Sat, 22 May 2021 12:07:44 UTC
2021-05-22 12:07:44 +00:00
||skinbarontow.ml$all
Filter updated: Sat, 17 Jul 2021 12:01:37 +0000
2021-07-17 12:01:37 +00:00
||skinpl.hostfree.pw$all
Filter updated: Fri, 16 Jul 2021 12:01:57 +0000
2021-07-16 12:01:57 +00:00
||skinprolp.hostfree.pw$all
||skinprolpler1.hostfree.pw$all
Filter updated: Fri, 03 Sep 2021 12:01:48 +0000
2021-09-03 12:01:48 +00:00
||skinprolpsv.hostfree.pw$all
Filter updated: Sat, 10 Apr 2021 00:06:30 UTC
2021-04-10 00:06:30 +00:00
||sklad-hub.ru$all
Filter updated: Sat, 20 Mar 2021 00:06:31 UTC
2021-03-20 00:06:31 +00:00
||sklepkody.pl$all
Filter updated: Wed, 25 Aug 2021 12:02:06 +0000
2021-08-25 12:02:07 +00:00
||skradvanidance.business.site$all
Filter updated: Wed, 15 Sep 2021 00:01:54 +0000
2021-09-15 00:01:55 +00:00
||skrtysupport.com/home/login.php$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||slack-redir.net/link?url=http://taijishentie.com/js/index.htm?http://us.battle.net/login/en/?ref=http://xwnrssfus.battle.net/d3/en/index&app=com-d3$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||slack-redir.net/link?url=https://bit.ly/3lefgwg$all
Filter updated: Fri, 04 Sep 2020 12:06:38 UTC
2020-09-04 12:06:38 +00:00
||slack-redir.net/link?url=https://dhtgfhxfgs.com/doc$all
Filter updated: Mon, 20 Sep 2021 12:02:05 +0000
2021-09-20 12:02:05 +00:00
||slapcoffee.com$all
Filter updated: Wed, 01 Sep 2021 12:01:58 +0000
2021-09-01 12:01:58 +00:00
||slavamel.github.io$all
Filter updated: Fri, 19 Feb 2021 00:06:27 UTC
2021-02-19 00:06:28 +00:00
||sleepmaskz.com$all
Filter updated: Sat, 29 May 2021 12:06:18 UTC
2021-05-29 12:06:19 +00:00
||slickparties.com$all
Filter updated: Fri, 04 Jun 2021 00:06:37 UTC
2021-06-04 00:06:37 +00:00
||slmplenewforward.byethost31.com$all
Filter updated: Sat, 03 Oct 2020 00:06:51 UTC
2020-10-03 00:06:51 +00:00
||sloka.constantcontactsites.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||slotgamer.top$all
Filter updated: Mon, 15 Mar 2021 12:43:24 UTC
2021-03-15 12:43:24 +00:00
||slotsno.com$all
Filter updated: Mon, 20 Sep 2021 00:01:41 +0000
2021-09-20 00:01:41 +00:00
||slovenska-posta.co.sk.u1478897.cp.regruhosting.ru$all
Filter updated: Mon, 20 Sep 2021 12:02:05 +0000
2021-09-20 12:02:05 +00:00
||slovenska-posta.sk.u1477485.cp.regruhosting.ru$all
Filter updated: Mon, 24 May 2021 12:06:37 UTC
2021-05-24 12:06:37 +00:00
||slowlinebag.jp$all
Filter updated: Sat, 29 May 2021 00:06:23 UTC
2021-05-29 00:06:23 +00:00
||slql.byethost7.com$all
Filter updated: Sun, 28 Mar 2021 00:07:02 UTC
2021-03-28 00:07:03 +00:00
||sm777.csb.app$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||smarteconomy.rs$all
Filter updated: Tue, 01 Jun 2021 00:06:26 UTC
2021-06-01 00:06:26 +00:00
||smartgos.com$all
Filter updated: Thu, 08 Jul 2021 00:02:02 +0000
2021-07-08 00:02:02 +00:00
||smartklick.biz/?p=gntdomrwme5gi3bpge3temry$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||smartmco.com$all
Filter updated: Mon, 20 Sep 2021 12:02:05 +0000
2021-09-20 12:02:05 +00:00
||smartpage.lt$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||smartschooldiary.in$all
Filter updated: Tue, 15 Jun 2021 12:29:08 UTC
2021-06-15 12:29:08 +00:00
||smashpc.org$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||smbc-carcl.com.s0djaz.cn$all
Filter updated: Sat, 07 Aug 2021 00:20:48 +0000
2021-08-07 00:20:48 +00:00
||smbc-cardvpass.cn$all
Filter updated: Tue, 17 Aug 2021 00:02:45 +0000
2021-08-17 00:02:45 +00:00
||smbc-jp.site$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||smbc-ms.xyz$all
Filter updated: Wed, 07 Jul 2021 00:01:56 +0000
2021-07-07 00:01:57 +00:00
||smbc.co.jp.rr04y2w.cn$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||smbcicarid-info.top$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||smbcsafecard.com$all
Filter updated: Thu, 11 Feb 2021 12:07:21 UTC
2021-02-11 12:07:21 +00:00
||smbcwodeqingguoshoujicojp.top$all
Filter updated: Fri, 24 Sep 2021 12:02:36 +0000
2021-09-24 12:02:36 +00:00
||smcbc.careoed.com$all
Filter updated: Tue, 21 Sep 2021 00:01:40 +0000
2021-09-21 00:01:40 +00:00
||smdc-caed.cascrccrd.com$all
Filter updated: Tue, 16 Mar 2021 00:07:08 UTC
2021-03-16 00:07:09 +00:00
||smeo.org.mx$all
Filter updated: Mon, 30 Aug 2021 00:02:03 +0000
2021-08-30 00:02:03 +00:00
||smgolamalif.github.io$all
Filter updated: Fri, 13 Aug 2021 00:01:48 +0000
2021-08-13 00:01:48 +00:00
||smkkesehatanjember.sch.id$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||smmsvocal.yolasite.com$all
Filter updated: Mon, 26 Jul 2021 00:02:16 +0000
2021-07-26 00:02:17 +00:00
||sms-shorter.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||smsenligne.myfreesites.net$all
Filter updated: Mon, 16 Aug 2021 12:01:42 +0000
2021-08-16 12:01:42 +00:00
||smsorangephonemail.myfreesites.net$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||smsorangesmsmessage.myfreesites.net$all
||smss-mms.yolasite.com$all
||smsverificationmms.myfreesites.net$all
Filter updated: Tue, 29 Jun 2021 12:02:07 +0000
2021-06-29 12:02:07 +00:00
||snajhyssssssssss.byethost31.com$all
Filter updated: Sun, 20 Jun 2021 12:06:22 +0000
2021-06-20 12:06:22 +00:00
||snapchat.acccccount.com$all
Filter updated: Wed, 11 Aug 2021 12:01:50 +0000
2021-08-11 12:01:50 +00:00
||snapchat.accounts.com.es$all
Filter updated: Sat, 07 Nov 2020 00:06:40 UTC
2020-11-07 00:06:40 +00:00
||sniperdz.com$all
Filter updated: Wed, 15 Sep 2021 00:01:54 +0000
2021-09-15 00:01:55 +00:00
||sniter.widyakartika.ac.id$all
Filter updated: Wed, 15 Sep 2021 12:01:46 +0000
2021-09-15 12:01:46 +00:00
||snnbc-cardrs-kdmnc-com.skfhj.top$all
Filter updated: Fri, 19 Feb 2021 00:06:27 UTC
2021-02-19 00:06:28 +00:00
||snprobbx.pbz.r.uk.a2ip.ru$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||snrsystem.com$all
Filter updated: Wed, 18 Aug 2021 00:01:50 +0000
2021-08-18 00:01:50 +00:00
||sntuyconfgurtion.ultimatefreehost.in$all
Filter updated: Sat, 31 Jul 2021 00:01:51 +0000
2021-07-31 00:01:51 +00:00
||sntuyconfir.byethost13.com$all
Filter updated: Sun, 30 May 2021 12:06:22 UTC
2021-05-30 12:06:22 +00:00
||soaringskiesrentals.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||sobisparkss-poser.blogspot.com$all
Filter updated: Thu, 03 Sep 2020 12:06:37 UTC
2020-09-03 12:06:37 +00:00
||soci-molen.web.app$all
Filter updated: Fri, 11 Jun 2021 12:06:37 UTC
2021-06-11 12:06:38 +00:00
||socialmediatraveler.com$all
Filter updated: Fri, 10 Sep 2021 00:02:17 +0000
2021-09-10 00:02:17 +00:00
||sockemdesign.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||sofe-firma.firebaseapp.com$all
Filter updated: Wed, 01 Sep 2021 12:01:58 +0000
2021-09-01 12:01:58 +00:00
||software.verify-secure.info$all
Filter updated: Thu, 23 Sep 2021 00:02:18 +0000
2021-09-23 00:02:18 +00:00
||solarchampsllc.com$all
Filter updated: Fri, 24 Sep 2021 00:01:50 +0000
2021-09-24 00:01:51 +00:00
||solicitarfirmaelectronica-sv.com$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||solitary-flower-7e0a.loginupdatemail.workers.dev$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||solutionfun.services$all
Filter updated: Sat, 28 Aug 2021 12:01:47 +0000
2021-08-28 12:01:47 +00:00
||solutionsaec-my.sharepoint.com/:x:/g/personal/jblanquart_solutions-aec_com/eco5jmdevefltbrj2rnwypgbnoisgm3og8kg4u7uxbmefa?e=rge5mf$all
||solutionsaec-my.sharepoint.com/personal/jblanquart_solutions-aec_com/_layouts/15/doc2.aspx?sourcedoc={602639ca-54c4-4b41-b41a-c9dab9d66298}&action=default&slrid=e91ed59f-406c-c000-3041-75a88e0b5689&originalpath=ahr0chm6ly9zb2x1dglvbnnhzwmtbxkuc2hhcmvwb2ludc5jb20vong6l2cvcgvyc29uywwvamjsyw5xdwfydf9zb2x1dglvbnmtywvjx2nvbs9fy281sm1ervzfrkx0qnjkmnjuv1lwz0jut0ltr20zb0c4a0c0vtd1wejnruzbp3j0aw1lpvlwvu1lrkezmlvn&cid=abd2b9bf-cc2a-4d1b-b944-a06977d53e19$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||solutionsin-com-br.umbler.net$all
Filter updated: Thu, 18 Mar 2021 00:09:13 UTC
2021-03-18 00:09:14 +00:00
||solyanayakomnata.ru$all
Filter updated: Fri, 24 Sep 2021 12:02:36 +0000
2021-09-24 12:02:36 +00:00
||sombc.careoed.com$all
Filter updated: Wed, 15 Sep 2021 00:01:54 +0000
2021-09-15 00:01:55 +00:00
||somdcontractor.com$all
Filter updated: Sun, 10 Jan 2021 00:06:52 UTC
2021-01-10 00:06:52 +00:00
||soneyamks.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||sonne-medoon.firebaseapp.com$all
||sonofabridge.com.net2care.com$all
Filter updated: Wed, 25 Aug 2021 12:02:06 +0000
2021-08-25 12:02:07 +00:00
||sopac.org.py$all
Filter updated: Sun, 15 Aug 2021 00:01:57 +0000
2021-08-15 00:01:57 +00:00
||sorowhite53.byethost6.com$all
Filter updated: Thu, 29 Apr 2021 12:07:55 UTC
2021-04-29 12:07:55 +00:00
||sotly.me$all
Filter updated: Fri, 15 Jan 2021 00:06:14 UTC
2021-01-15 00:06:14 +00:00
||souaxwaoh.myfreesites.net$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||soude-masi.firebaseapp.com$all
Filter updated: Sun, 02 May 2021 00:06:30 UTC
2021-05-02 00:06:30 +00:00
||southport-farm-holidays.co.uk$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||souvenirsplace.com$all
||soysodimac.estudiarfacil.com$all
Filter updated: Wed, 25 Nov 2020 12:06:48 UTC
2020-11-25 12:06:48 +00:00
||sp477389.sitebeat.site$all
Filter updated: Wed, 17 Mar 2021 00:06:16 UTC
2021-03-17 00:06:16 +00:00
||sp701876.sitebeat.site$all
Filter updated: Wed, 15 Sep 2021 00:01:54 +0000
2021-09-15 00:01:55 +00:00
||spaacing-particule.ml$all
Filter updated: Sat, 04 Sep 2021 00:17:00 +0000
2021-09-04 00:17:00 +00:00
||sparka-einloggen-sicher.xyz$all
||sparka-einloggen2021.xyz$all
Filter updated: Thu, 16 Sep 2021 00:01:52 +0000
2021-09-16 00:01:52 +00:00
||sparka-kundenr1235234.xyz$all
||sparka-kundenr5234234.xyz$all
Filter updated: Wed, 15 Sep 2021 00:01:54 +0000
2021-09-15 00:01:55 +00:00
||sparka-kundenr5324523.xyz$all
Filter updated: Thu, 16 Sep 2021 00:01:52 +0000
2021-09-16 00:01:52 +00:00
||sparka-kundenr56423.xyz$all
||sparka-pushtan.de$all
Filter updated: Sat, 04 Sep 2021 00:17:00 +0000
2021-09-04 00:17:00 +00:00
||sparka-sicher-einloggen-2021.xyz$all
||sparka-sicheres-einloggen-2021.xyz$all
Filter updated: Mon, 06 Sep 2021 12:01:50 +0000
2021-09-06 12:01:50 +00:00
||sparka-sicherheit-2021.xyz$all
||sparka-sicherheit-einloggen.xyz$all
Filter updated: Tue, 07 Sep 2021 00:01:46 +0000
2021-09-07 00:01:46 +00:00
||sparka-sicherheit-sicher.xyz$all
Filter updated: Wed, 15 Sep 2021 00:01:54 +0000
2021-09-15 00:01:55 +00:00
||sparkasse-1129.de$all
Filter updated: Wed, 21 Apr 2021 00:07:05 UTC
2021-04-21 00:07:05 +00:00
||sparkasse-hannover.work$all
Filter updated: Tue, 15 Jun 2021 12:29:08 UTC
2021-06-15 12:29:08 +00:00
||sparkasse-kundenbetreuung.de$all
Filter updated: Thu, 16 Sep 2021 00:01:52 +0000
2021-09-16 00:01:52 +00:00
||sparkasse-newsystem.com$all
Filter updated: Sun, 02 May 2021 00:06:30 UTC
2021-05-02 00:06:30 +00:00
||sparkasse-push.de$all
Filter updated: Wed, 02 Jun 2021 12:06:27 UTC
2021-06-02 12:06:28 +00:00
||sparkasse-pushwartung.de$all
Filter updated: Thu, 26 Aug 2021 12:02:31 +0000
2021-08-26 12:02:31 +00:00
||sparkasse-scert-web.com$all
Filter updated: Thu, 16 Sep 2021 00:01:52 +0000
2021-09-16 00:01:52 +00:00
||sparkasse-scert.com/yscf2noceq$all
||sparkasse-scertsystem.com$all
||sparkasse-sicherheitshinweise.com$all
||sparkasse-tan.top$all
Filter updated: Tue, 07 Sep 2021 12:01:49 +0000
2021-09-07 12:01:49 +00:00
||sparkasse-updatesystem-web.com$all
Filter updated: Thu, 16 Sep 2021 12:02:15 +0000
2021-09-16 12:02:15 +00:00
||sparkasse-verfahren.com$all
Filter updated: Sun, 11 Jul 2021 00:02:18 +0000
2021-07-11 00:02:18 +00:00
||sparkasse.tan-verfahren-spk.com$all
Filter updated: Wed, 22 Sep 2021 12:01:56 +0000
2021-09-22 12:01:56 +00:00
||sparkassen-verifikationen.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||sparxinteriors.co.zw$all
||spectralwirejewelry.com$all
Filter updated: Thu, 14 Jan 2021 12:06:32 UTC
2021-01-14 12:06:32 +00:00
||spectrumstorageaccess.yahoosites.com$all
Filter updated: Sat, 28 Aug 2021 00:33:51 +0000
2021-08-28 00:33:51 +00:00
||speedylogisticsllc.com$all
Filter updated: Wed, 14 Apr 2021 12:07:09 UTC
2021-04-14 12:07:09 +00:00
||spektrumchile.cl$all
Filter updated: Tue, 01 Jun 2021 00:06:26 UTC
2021-06-01 00:06:26 +00:00
||spentamultimedia.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||sphinxsecurityusa.com$all
Filter updated: Fri, 19 Feb 2021 00:06:27 UTC
2021-02-19 00:06:28 +00:00
||spidertvapp.com$all
Filter updated: Tue, 13 Apr 2021 12:07:03 UTC
2021-04-13 12:07:03 +00:00
||spikenow.com/collab/?id=bhyaaypay0mizbywaw0ockqgxxza6tjjy0mveuavwj6$all
Filter updated: Thu, 29 Oct 2020 12:06:25 UTC
2020-10-29 12:06:25 +00:00
||spinosacenter.com$all
Filter updated: Wed, 09 Dec 2020 12:06:49 UTC
2020-12-09 12:06:49 +00:00
||spiritotarsogno.com$all
Filter updated: Thu, 16 Sep 2021 12:02:15 +0000
2021-09-16 12:02:15 +00:00
||spk-datenbank-spk.com$all
||spk-easycomfort.top$all
Filter updated: Tue, 20 Jul 2021 00:01:58 +0000
2021-07-20 00:01:58 +00:00
||spk-mail-service5.xyz$all
Filter updated: Fri, 16 Jul 2021 12:01:57 +0000
2021-07-16 12:01:57 +00:00
||spk-service-web.xyz$all
Filter updated: Thu, 16 Sep 2021 00:01:52 +0000
2021-09-16 00:01:52 +00:00
||spk-tan.top$all
Filter updated: Tue, 04 May 2021 00:15:58 UTC
2021-05-04 00:15:58 +00:00
||spk-tanverfahren.de$all
Filter updated: Thu, 05 Aug 2021 12:01:57 +0000
2021-08-05 12:01:57 +00:00
||spk.so$all
Filter updated: Fri, 21 May 2021 00:06:36 UTC
2021-05-21 00:06:36 +00:00
||spkitem7.life$all
Filter updated: Thu, 02 Sep 2021 00:01:59 +0000
2021-09-02 00:01:59 +00:00
||sponsorlens.cs.umn.edu$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||spontan.ch.net2care.com$all
Filter updated: Thu, 16 Sep 2021 00:01:52 +0000
2021-09-16 00:01:52 +00:00
||sportrecent.com/docu084$all
Filter updated: Wed, 15 Sep 2021 12:01:46 +0000
2021-09-15 12:01:46 +00:00
||sportrecent.com/docu084/$all
Filter updated: Tue, 12 Jan 2021 00:06:08 UTC
2021-01-12 00:06:08 +00:00
||spotify-home.com$all
Filter updated: Wed, 14 Apr 2021 00:08:24 UTC
2021-04-14 00:08:24 +00:00
||spotlfy-subscribe.com$all
Filter updated: Thu, 20 May 2021 12:06:36 UTC
2021-05-20 12:06:36 +00:00
||spp2.gratishosting.cl$all
Filter updated: Sat, 18 Sep 2021 00:14:48 +0000
2021-09-18 00:14:48 +00:00
||spprtfc.000webhostapp.com$all
Filter updated: Mon, 20 Sep 2021 12:02:05 +0000
2021-09-20 12:02:05 +00:00
||spring-pond-62c4.autocreative.workers.dev#eimaste@stinpriza.org$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||spropes-auntmillies-com.slite.com$all
Filter updated: Wed, 02 Jun 2021 00:06:23 UTC
2021-06-02 00:06:23 +00:00
||sprtcnicomicrsf.byethost17.com$all
Filter updated: Thu, 26 Aug 2021 00:02:01 +0000
2021-08-26 00:02:01 +00:00
||sqft.co.in/wp-admin/secumds.org_focusnew/secumds.org_focusnew$all
Filter updated: Fri, 26 Feb 2021 00:06:07 UTC
2021-02-26 00:06:07 +00:00
||srfgzdsfh4ergdsfg.agilecrm.com$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||srilakshmiengg.com$all
Filter updated: Wed, 22 Sep 2021 12:01:56 +0000
2021-09-22 12:01:56 +00:00
||srnbc-card.com.d23782.cn$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||ssia.org.sg/wee/wellsfargo.comnew_lastbornencode/w/index.php$all
||ssia.org.sg/wee/wellsfargo.comnew_lastbornencode/w/indexa.php$all
Filter updated: Fri, 10 Sep 2021 00:02:17 +0000
2021-09-10 00:02:17 +00:00
||ssl-cloud-r.s4-cloud980-0.workers.dev$all
Filter updated: Wed, 18 Aug 2021 12:02:35 +0000
2021-08-18 12:02:36 +00:00
||ssmanlawam.com$all
Filter updated: Fri, 30 Jul 2021 12:01:52 +0000
2021-07-30 12:01:52 +00:00
||sso-garena-vi.com$all
||sso-garena-vn.com$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||ssrw.org$all
Filter updated: Wed, 30 Dec 2020 00:06:08 UTC
2020-12-30 00:06:08 +00:00
||sswebmail-4w5twsr.web.app$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||stand.ddnsking.com$all
Filter updated: Thu, 29 Jul 2021 00:01:57 +0000
2021-07-29 00:01:57 +00:00
||stargiveaway.com$all
Filter updated: Mon, 15 Mar 2021 12:43:24 UTC
2021-03-15 12:43:24 +00:00
||starlangsb.com$all
Filter updated: Fri, 20 Aug 2021 12:01:48 +0000
2021-08-20 12:01:48 +00:00
||starliker.net$all
Filter updated: Fri, 12 Mar 2021 00:08:02 UTC
2021-03-12 00:08:02 +00:00
||starlingbankplc.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||starmak.com.tr$all
Filter updated: Fri, 06 Aug 2021 00:01:52 +0000
2021-08-06 00:01:52 +00:00
||starnetlegal-my.sharepoint.com/:x:/r/personal/kimanistarnet_starnetlegal_com_au/_layouts/15/wopiframe.aspx$all
Filter updated: Thu, 22 Jul 2021 00:01:54 +0000
2021-07-22 00:01:54 +00:00
||starnetlegal-my.sharepoint.com/:x:/r/personal/kimanistarnet_starnetlegal_com_au/_layouts/15/wopiframe.aspx?guestaccesstoken=pv890fkaw3j3sxii8ccetsfxta1sij%2fjet9rdeg8oow%3d&docid=1_1c7b4face5780498ab995b86b5b2dcaff&wdformid=%7bbc8906f7%2d715e%2d4df9%2d8716%2d058d26a1426c%7d&action=formsubmit$all
Filter updated: Fri, 06 Aug 2021 00:01:52 +0000
2021-08-06 00:01:52 +00:00
||starnetlegal-my.sharepoint.com/personal/kimanistarnet_starnetlegal_com_au/_layouts/15/wopiframe.aspx$all
||starnetlegal-my.sharepoint.com/personal/kimanistarnet_starnetlegal_com_au/_layouts/15/wopiframe.aspx?cid=06b1de42-a36f-49e7-afc9-feebd6a06c07$all
Filter updated: Thu, 22 Jul 2021 00:01:54 +0000
2021-07-22 00:01:54 +00:00
||starnetlegal-my.sharepoint.com/personal/kimanistarnet_starnetlegal_com_au/_layouts/15/wopiframe.aspx?guestaccesstoken=pv890fkaw3j3sxii8ccetsfxta1sij%2fjet9rdeg8oow%3d&docid=1_1c7b4face5780498ab995b86b5b2dcaff&wdformid=%7bbc8906f7%2d715e%2d4df9%2d8716%2d058d26a1426c%7d&action=formsubmit&cid=875889c4-4530-43af-a869-cf468b381692$all
Filter updated: Fri, 06 Aug 2021 00:01:52 +0000
2021-08-06 00:01:52 +00:00
||starnetlegal-my.sharepoint.com/personal/kimanistarnet_starnetlegal_com_au/_layouts/15/wopiframe2.aspx?$all
Filter updated: Sun, 18 Jul 2021 00:02:04 +0000
2021-07-18 00:02:04 +00:00
||starp2.com$all
Filter updated: Tue, 17 Nov 2020 12:06:54 UTC
2020-11-17 12:06:54 +00:00
||starsoftheindustry.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||starstrap.co.zw$all
Filter updated: Thu, 03 Sep 2020 12:06:37 UTC
2020-09-03 12:06:37 +00:00
||startimes.com/f.aspx?t=37$all
Filter updated: Wed, 25 Nov 2020 00:06:21 UTC
2020-11-25 00:06:21 +00:00
||startseite-verden.de$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||starttsboxfile.myfreesites.net$all
||stateagencybe.tumblr.com$all
Filter updated: Fri, 27 Aug 2021 12:01:40 +0000
2021-08-27 12:01:40 +00:00
||stateboy.top$all
Filter updated: Fri, 18 Sep 2020 00:06:21 UTC
2020-09-18 00:06:21 +00:00
||static-ak-fbcdn.atspace.com$all
Filter updated: Sat, 12 Jun 2021 12:06:23 UTC
2021-06-12 12:06:23 +00:00
||staticmemoriesphotography.ca$all
Filter updated: Tue, 24 Aug 2021 12:02:00 +0000
2021-08-24 12:02:00 +00:00
||status-track-dispatch.com$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||stcroixlofts.com$all
Filter updated: Tue, 21 Sep 2021 00:01:40 +0000
2021-09-21 00:01:40 +00:00
||steam-discords.com$all
Filter updated: Fri, 24 Sep 2021 12:02:36 +0000
2021-09-24 12:02:36 +00:00
||steamcommynitu.com$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||steamcomunity.net.ru$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||steamcornminuty.com$all
Filter updated: Thu, 18 Mar 2021 12:07:19 UTC
2021-03-18 12:07:19 +00:00
||steamproxy.net$all
Filter updated: Sat, 05 Jun 2021 00:27:49 UTC
2021-06-05 00:27:49 +00:00
||steannconnunity.com$all
Filter updated: Sun, 19 Sep 2021 12:01:34 +0000
2021-09-19 12:01:35 +00:00
||steinercoza-my.sharepoint.com/:b:/g/personal/mandyb_steiner_co_za/exxq1passetnrojoe83fzboboxufoggwb7uvmyfqbionla?e=4:su8jhq&at=9$all
Filter updated: Wed, 15 Sep 2021 00:01:54 +0000
2021-09-15 00:01:55 +00:00
||stendec.it$all
Filter updated: Wed, 08 Sep 2021 12:01:51 +0000
2021-09-08 12:01:51 +00:00
||stephensfloorcovering-my.sharepoint.com/personal/river_stephensfloorcovering_com/_layouts/15/onedrive.aspx?id=/personal/river_stephensfloorcovering_com/documents/invoice.pdf&parent=/personal/river_stephensfloorcovering_com/documents&originalpath=ahr0chm6ly9zdgvwagvuc2zsb29yy292zxjpbmctbxkuc2hhcmvwb2ludc5jb20vomi6l3avcml2zxivrvrjc05taepzaljkczzxsnf6bnpnd2tcuwjucnnzvmfrdezlodnlmzfsthhmqt9ydgltzt10zzdkegvatdjvzw$all
||stephensfloorcovering-my.sharepoint.com/personal/river_stephensfloorcovering_com/_layouts/15/onedrive.aspx?id=/personal/river_stephensfloorcovering_com/documents/invoice.pdf&parent=/personal/river_stephensfloorcovering_com/documents&originalpath=ahr0chm6ly9zdgvwagvuc2zsb29yy292zxjpbmctbxkuc2hhcmvwb2ludc5jb20vomi6l3avcml2zxivrvrjc05taepzaljkczzxsnf6bnpnd2tcuwjucnnzvmfrdezlodnlmzfsthhmqt9ydgltzt12dgvinhzotdjvzw$all
||stephensfloorcovering-my.sharepoint.com/personal/river_stephensfloorcovering_com/_layouts/15/onedrive.aspx?id=/personal/river_stephensfloorcovering_com/documents/invoice.pdf&parent=/personal/river_stephensfloorcovering_com/documents&originalpath=ahr0chm6ly9zdgvwagvuc2zsb29yy292zxjpbmctbxkuc2hhcmvwb2ludc5jb20vomi6l3avcml2zxivrvrjc05taepzaljkczzxsnf6bnpnd2tcuwjucnnzvmfrdezlodnlmzfsthhmqt9ydgltzt1lblbjd3zotdjvzw$all
Filter updated: Wed, 21 Jul 2021 12:01:49 +0000
2021-07-21 12:01:49 +00:00
||stephensfloorcovering-my.sharepoint.com:443/:b:/p/river/etcsnshjyjrjs6qjqznzgwkbqbnrsyvaktfk83k31llxfa?e=4:gr4asj&at=9$all
Filter updated: Sat, 18 Sep 2021 00:14:48 +0000
2021-09-18 00:14:48 +00:00
||stevemaddenshoe.net$all
Filter updated: Fri, 24 Sep 2021 00:01:50 +0000
2021-09-24 00:01:51 +00:00
||stevemaddensneakersrea.com$all
||stevemaddenstivali.com$all
Filter updated: Thu, 01 Jul 2021 00:01:46 +0000
2021-07-01 00:01:46 +00:00
||stevemadderomania.co$all
Filter updated: Tue, 22 Dec 2020 00:06:07 UTC
2020-12-22 00:06:07 +00:00
||steven-coldwellbth9965.web.app$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||stevencrews.com$all
Filter updated: Thu, 05 Aug 2021 00:02:05 +0000
2021-08-05 00:02:05 +00:00
||stewarts-stupendous-project-ee8707.webflow.io$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||stgrp.ru$all
||still-glitter-643b.block12.workers.dev$all
Filter updated: Tue, 16 Mar 2021 00:07:08 UTC
2021-03-16 00:07:09 +00:00
||stimulus-claim.com$all
Filter updated: Tue, 17 Aug 2021 00:02:45 +0000
2021-08-17 00:02:45 +00:00
||stimulusgovt.com/apply-now/$all
Filter updated: Fri, 24 Sep 2021 00:01:50 +0000
2021-09-24 00:01:51 +00:00
||stkynu.club$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||stolizaparketa.ru$all
||stolizaparketa.ru/wp-content/themes/twentyfifteen/css/read/chinavali/index.php?email=jsmith@imaphost.com$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||storage.cloud.google.com/1lordman1man3/kelmanco2.html#user@cslanet.calstatela.edu$all
Filter updated: Mon, 16 Aug 2021 00:01:59 +0000
2021-08-16 00:01:59 +00:00
||storage.cloud.google.com/1lordman1man3/oscman.html#samba@jubileegroup.co.uk$all
||storage.cloud.google.com/1lordman1man3/oscman.html$all
Filter updated: Wed, 02 Jun 2021 00:06:23 UTC
2021-06-02 00:06:23 +00:00
||storage.cloud.google.com/1lordman1man3/oscman2.html#@osgoode.yorku.ca$all
Filter updated: Thu, 16 Sep 2021 12:02:15 +0000
2021-09-16 12:02:15 +00:00
||storage.cloud.google.com/1lordman1man3/oscman2.html#user@calstatela.edu$all
Filter updated: Wed, 15 Sep 2021 00:01:54 +0000
2021-09-15 00:01:55 +00:00
||storage.cloud.google.com/1lordman1man3/oscman2.html#user@cslanet.calstatela.edu$all
Filter updated: Wed, 25 Aug 2021 12:02:06 +0000
2021-08-25 12:02:07 +00:00
||storage.cloud.google.com/algebraic-pact-316913.appspot.com/index.html#jbell@legalshield.com$all
Filter updated: Wed, 07 Apr 2021 12:23:11 UTC
2021-04-07 12:23:12 +00:00
||storage.cloud.google.com/appspotv450i7r8h9vf9y6yt8uiuft58f7uf5yye36u0jtyf78uuyfyy/index.html$all
Filter updated: Tue, 20 Jul 2021 12:01:48 +0000
2021-07-20 12:01:48 +00:00
||storage.cloud.google.com/aurrhorot3a3xwr03orxwxwuowas.appspot.com/index.html#craig@legalshield.com$all
||storage.cloud.google.com/aurrhorot3a3xwr03orxwxwuowas.appspot.com/index.html#frank.o@legalshield.com$all
||storage.cloud.google.com/aurrhorot3a3xwr03orxwxwuowas.appspot.com/index.html#stevewilliamson@legalshield.com$all
Filter updated: Wed, 25 Aug 2021 12:02:06 +0000
2021-08-25 12:02:07 +00:00
||storage.cloud.google.com/be8be8qabe88aqpa8userpp.appspot.com/index.html#stevewilliamson@legalshield.com$all
||storage.cloud.google.com/ciat3tdtttd53c3e5userp.appspot.com/index.html#jr@legalshield.com$all
||storage.cloud.google.com/ciat3tdtttd53c3e5userp.appspot.com/index.html#laura@legalshield.com$all
||storage.cloud.google.com/ciat3tdtttd53c3e5userp.appspot.com/index.html#paul@legalshield.com$all
||storage.cloud.google.com/cq22cc22a0wqcaawasauerip.appspot.com/index.html#a.roldan@legalshield.com$all
||storage.cloud.google.com/dhngw6p6rwrwnuv6vnuse.appspot.com/index.html#brianvillacarlos@legalshieldcorp.com$all
||storage.cloud.google.com/dhngw6p6rwrwnuv6vnuse.appspot.com/index.html#stevewilliamson@legalshield.com$all
Filter updated: Mon, 12 Apr 2021 00:06:48 UTC
2021-04-12 00:06:48 +00:00
||storage.cloud.google.com/employt44to49cclrlolcrl94lnlxo.appspot.com/index.html#mclifton36@prepaidlegal.com$all
Filter updated: Mon, 05 Jul 2021 12:02:12 +0000
2021-07-05 12:02:12 +00:00
||storage.cloud.google.com/g58t3e588ddgmdeddauth.appspot.com/index.html#jbell@legalshield.com$all
||storage.cloud.google.com/g58t3e588ddgmdeddauth.appspot.com/index.html#jim-shelvy@legalshield.com$all
Filter updated: Wed, 25 Aug 2021 12:02:06 +0000
2021-08-25 12:02:07 +00:00
||storage.cloud.google.com/genuine-rope-318401.appspot.com/index.html#stevewilliamson@legalshield.com$all
||storage.cloud.google.com/kkkqkl633qn6kq3lqssiiddnenen.appspot.com/index.html#jbell@legalshield.com$all
Filter updated: Mon, 16 Aug 2021 00:01:59 +0000
2021-08-16 00:01:59 +00:00
||storage.cloud.google.com/kkkqkl633qn6kq3lqssiiddnenen.appspot.com/index.html#roger@legalshield.com$all
||storage.cloud.google.com/kkkqkl633qn6kq3lqssiiddnenen.appspot.com/index.html#rosalefua@legalshield.com$all
||storage.cloud.google.com/kkkqkl633qn6kq3lqssiiddnenen.appspot.com/index.html#stevewilliamson@legalshield.com$all
||storage.cloud.google.com/kkkqkl633qn6kq3lqssiiddnenen.appspot.com/index.html#t.voit@legalshield.com$all
Filter updated: Wed, 25 Aug 2021 12:02:06 +0000
2021-08-25 12:02:07 +00:00
||storage.cloud.google.com/maintainancecomponeta.appspot.com/donperezbigsam.html#@yorku.ca$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||storage.cloud.google.com/maintainancecomponeta.appspot.com/fcocwetindex.html$all
Filter updated: Thu, 03 Jun 2021 00:06:28 UTC
2021-06-03 00:06:28 +00:00
||storage.cloud.google.com/maintainancecomponeta.appspot.com/kayindex.html#eimaste@stinpriza.org$all
Filter updated: Thu, 10 Jun 2021 12:06:40 UTC
2021-06-10 12:06:40 +00:00
||storage.cloud.google.com/maintainancecomponeta.appspot.com/kayindex.html#jbcavin@prepaidlegal.com$all
||storage.cloud.google.com/maintainancecomponeta.appspot.com/kayindex.html#jtucker@prepaidlegal.com$all
||storage.cloud.google.com/maintainancecomponeta.appspot.com/kayindex.html#rikeoka@prepaidlegal.com$all
Filter updated: Wed, 02 Jun 2021 00:06:23 UTC
2021-06-02 00:06:23 +00:00
||storage.cloud.google.com/maintainancecomponeta.appspot.com/mineindex.html#@yorku.ca$all
Filter updated: Fri, 13 Aug 2021 12:01:44 +0000
2021-08-13 12:01:44 +00:00
||storage.cloud.google.com/maintainancecomponeta.appspot.com/sydlasguygendomain.html$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||storage.cloud.google.com/noomooonplotoon-ogt0098709lot/mlindex.html#user@domain.org$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||storage.cloud.google.com/officpcpspbcncuser.appspot.com/index.htm#jbell@legalshield.com$all
Filter updated: Tue, 24 Aug 2021 12:02:00 +0000
2021-08-24 12:02:00 +00:00
||storage.cloud.google.com/ost9ptpttt9ttztqpttt9tureh.appspot.com/index.html#antonio@legalshield.com$all
||storage.cloud.google.com/ost9ptpttt9ttztqpttt9tureh.appspot.com/index.html#hmark@legalshield.com$all
||storage.cloud.google.com/ost9ptpttt9ttztqpttt9tureh.appspot.com/index.html#me@legalshield.com$all
||storage.cloud.google.com/ost9ptpttt9ttztqpttt9tureh.appspot.com/index.html$all
Filter updated: Mon, 16 Aug 2021 00:01:59 +0000
2021-08-16 00:01:59 +00:00
||storage.cloud.google.com/owuddqd9dqqdddq9qd0caerq.appspot.com/index.html#stevewilliamson@legalshield.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||storage.cloud.google.com/prprhrhprc.appspot.com/index.htm#oncall-infra@eqiom.com$all
Filter updated: Sun, 11 Jul 2021 00:02:18 +0000
2021-07-11 00:02:18 +00:00
||storage.cloud.google.com/qq85e0p8ae05qb55buser.appspot.com/index.html#jbell@legalshield.com$all
Filter updated: Sun, 27 Jun 2021 12:06:19 +0000
2021-06-27 12:06:19 +00:00
||storage.cloud.google.com/r0090a0p0090pb0ppba9owan.appspot.com/index.html#a@b.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||storage.cloud.google.com/rqraaqqax3xa.appspot.com/index.htm#memberservices@legalshield.com$all
||storage.cloud.google.com/rqraaqqax3xa.appspot.com/index.htm#no@nope.com$all
Filter updated: Tue, 21 Sep 2021 00:01:40 +0000
2021-09-21 00:01:40 +00:00
||storage.cloud.google.com/servicech3kernow/index$all
Filter updated: Thu, 19 Nov 2020 00:06:21 UTC
2020-11-19 00:06:21 +00:00
||storage.cloud.google.com/staging.maintainancecomponeta.appspot.com/bsnnindex.html$all
Filter updated: Wed, 25 Aug 2021 12:02:06 +0000
2021-08-25 12:02:07 +00:00
||storage.cloud.google.com/staging.maintainancecomponeta.appspot.com/fcocnew.html$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||storage.cloud.google.com/user517497679326978.appspot.com/index.html#samsnow@tjsnow.com$all
Filter updated: Thu, 03 Sep 2020 12:06:37 UTC
2020-09-03 12:06:37 +00:00
||storage.cloud.google.com/user517497679326978.appspot.com/index.html$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||storage.cloud.google.com/user7773578ixh1092839.appspot.com/index.html#estewart30@legalshield.com$all
||storage.cloud.google.com/user7773578ixh1092839.appspot.com/index.html#john.smith@gmail.com$all
Filter updated: Thu, 03 Sep 2020 12:06:37 UTC
2020-09-03 12:06:37 +00:00
||storage.cloud.google.com/user7773578ixh1092839.appspot.com/index.html$all
Filter updated: Wed, 25 Aug 2021 12:02:06 +0000
2021-08-25 12:02:07 +00:00
||storage.cloud.google.com/uth0uax3t3uh30ttna0nnuser.appspot.com/index.html#jbell@legalshield.com$all
||storage.cloud.google.com/uth0uax3t3uh30ttna0nnuser.appspot.com/index.html#kpinson@legalshield.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||storage.cloud.google.com/xzrdzcdruerp.appspot.com/index.html#ricardo.rodriguez@cgexchange.org$all
Filter updated: Mon, 16 Aug 2021 00:01:59 +0000
2021-08-16 00:01:59 +00:00
||storage.cloud.google.com/y5r50f5ur5ryufsu66rruser.appspot.com/index.htm#a.roldan@legalshield.com$all
Filter updated: Thu, 08 Jul 2021 00:02:02 +0000
2021-07-08 00:02:02 +00:00
||storage.cloud.google.com/yyw77ywnn68weyew6euserq.appspot.com/index.html#azaleajones@legalshield.com$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||storage.cloud.google.com/yyw77ywnn68weyew6euserq.appspot.com/index.html#gerzineduncan@legalshield.com$all
Filter updated: Thu, 08 Jul 2021 00:02:02 +0000
2021-07-08 00:02:02 +00:00
||storage.cloud.google.com/yyw77ywnn68weyew6euserq.appspot.com/index.html#leta@legalshield.com$all
||storage.cloud.google.com/yyw77ywnn68weyew6euserq.appspot.com/index.html#roger@legalshield.com$all
||storage.cloud.google.com/yyw77ywnn68weyew6euserq.appspot.com/index.html#rosalefua@legalshield.com$all
Filter updated: Mon, 05 Apr 2021 12:06:40 UTC
2021-04-05 12:06:40 +00:00
||storage.googleapis.com/1827435283/1827435283.html$all
Filter updated: Thu, 22 Jul 2021 00:01:54 +0000
2021-07-22 00:01:54 +00:00
||storage.googleapis.com/advertorial010/789654nu57r.html$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||storage.googleapis.com/awydjhabjcakucajjbhsa7.appspot.com/eafdcas/kakvajdbvkjdbadvujk.html$all
Filter updated: Wed, 04 Aug 2021 00:02:10 +0000
2021-08-04 00:02:10 +00:00
||storage.googleapis.com/emailaccess324/gho/indexautoss.html?email=identitytheft@legalshield.com$all
Filter updated: Fri, 09 Jul 2021 00:01:59 +0000
2021-07-09 00:01:59 +00:00
||storage.googleapis.com/emailaccess324/gho/indexautoss.html?email=user@domain.ch$all
Filter updated: Tue, 27 Jul 2021 00:02:10 +0000
2021-07-27 00:02:10 +00:00
||storage.googleapis.com/emailaccess324/gho/indexautoss.html?email=user@example.org$all
Filter updated: Mon, 30 Aug 2021 12:01:50 +0000
2021-08-30 12:01:51 +00:00
||storage.googleapis.com/hmosrwfggcwzbcyjpndfmmzbpmaxzdiq/yrtyrhgfghvhgftrytdfghchgrtyfghcvghfhgdw.html$all
Filter updated: Mon, 23 Aug 2021 00:01:47 +0000
2021-08-23 00:01:47 +00:00
||storage.googleapis.com/lopmpm/dfgdfg.html#/redirect.html?od=1syq612292b23e0fb_vl_weekvl_0zak.cvswn0.c0000r2jnzr1b453i9_xn1270.2jnzrmdviedjjltbtbzlkc3q0t59rh$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||storage.googleapis.com/navy/nfcu.htm$all
Filter updated: Wed, 01 Sep 2021 00:02:20 +0000
2021-09-01 00:02:20 +00:00
||storage.googleapis.com/ngicwagnbntzrwhnkodcqgicigddbzkl/yrtyrhyhghsfgfzrzpoiortyfghcvghfhgdw.html$all
Filter updated: Wed, 22 Sep 2021 12:01:56 +0000
2021-09-22 12:01:56 +00:00
||storage.googleapis.com/ntwe4nkt4e.appspot.com/20770.html$all
Filter updated: Fri, 18 Jun 2021 00:06:41 +0000
2021-06-18 00:06:41 +00:00
||storage.googleapis.com/otlinks/trafrp.html$all
Filter updated: Mon, 30 Aug 2021 12:01:50 +0000
2021-08-30 12:01:51 +00:00
||storage.googleapis.com/prgxsqydsktkvzgnkrnhyrmwewzmfnd/yturfggtrefgfkuhfddpoicfwrtetyrtfseuytrw.html$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||storage.googleapis.com/regularizeambiente/acesso.html$all
||storage.googleapis.com/segurocomcliente/acesso.html$all
Filter updated: Fri, 03 Sep 2021 12:01:48 +0000
2021-09-03 12:01:48 +00:00
||storage.googleapis.com/ylffhg/redireck.html$all
Filter updated: Mon, 30 Aug 2021 12:01:50 +0000
2021-08-30 12:01:51 +00:00
||storage.googleapis.com/ylffhg/redirecvxxx.html$all
||storage.googleapis.com/ylffhg/redplan.html$all
||storage.googleapis.com/zloogqmltxvgfjbtlbfvuoewunkzscyr/ytrtyrcgfserdffeaezddfyiouiuyutytrw.html$all
Filter updated: Fri, 06 Nov 2020 12:06:28 UTC
2020-11-06 12:06:28 +00:00
||storage.ning.com/topology/rest/1.0/file/get/8122054091/$all
Filter updated: Mon, 13 Sep 2021 12:01:52 +0000
2021-09-13 12:01:52 +00:00
||store.prunescape.com.au$all
Filter updated: Sat, 10 Jul 2021 12:01:35 +0000
2021-07-10 12:01:35 +00:00
||stormadjust.com/ex/excel/quotation$all
Filter updated: Sat, 10 Jul 2021 00:01:42 +0000
2021-07-10 00:01:42 +00:00
||stormadjust.com/ex/excel/quotation/$all
Filter updated: Thu, 15 Jul 2021 12:01:53 +0000
2021-07-15 12:01:53 +00:00
||stormadjust.com/ex/excel/quotation/algoni.php$all
Filter updated: Sat, 10 Jul 2021 12:01:35 +0000
2021-07-10 12:01:35 +00:00
||stormadjust.com/ex/excel/quotation/algoni.php?cmd=login_submit&id=67f44f34b1007a28ef8be6ac1ef336c867f44f34b1007a28ef8be6ac1ef336c8&session=67f44f34b1007a28ef8be6ac1ef336c867f44f34b1007a28ef8be6ac1ef336c8$all
||stormadjust.com/ex/excel/quotation/algoni.php?cmd=login_submit&id=666086fc9b4d91c39a0d03e11816dd1c666086fc9b4d91c39a0d03e11816dd1c&session=666086fc9b4d91c39a0d03e11816dd1c666086fc9b4d91c39a0d03e11816dd1c$all
||stormadjust.com/ex/excel/quotation/algoni.php?cmd=login_submit&id=c2ce40f177bea74a0727867fafcbc454c2ce40f177bea74a0727867fafcbc454&session=c2ce40f177bea74a0727867fafcbc454c2ce40f177bea74a0727867fafcbc454$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||str-military-strongly-mouse.trycloudflare.com$all
||strafin-asia.fqrd.com$all
Filter updated: Mon, 13 Sep 2021 12:01:52 +0000
2021-09-13 12:01:52 +00:00
||streamlightmotionmedia.com$all
Filter updated: Sat, 21 Aug 2021 12:02:04 +0000
2021-08-21 12:02:04 +00:00
||stretchbuilder.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||structin-my.sharepoint.com/:o:/g/personal/p_brouwer_structin_nl/ehu4nhcxmmlmrmou4we1fpsb5lqpufe4sslse_xjh33dea?e=9dtcpc$all
Filter updated: Fri, 24 Sep 2021 12:02:36 +0000
2021-09-24 12:02:36 +00:00
||sts-onetime073737823-auth879304804394-encrypted798320939.s3.ap-southeast-2.amazonaws.com$all
Filter updated: Thu, 22 Jul 2021 00:01:54 +0000
2021-07-22 00:01:54 +00:00
||students2science.org$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||studentsimperial-my.sharepoint.com/personal/vcarrion_students_imperial_edu/_layouts/15/wopiframe.aspx?guestaccesstoken=rvz44awzcpdubusreabukfouvj04snc94kmlpod04h4%3d&docid=1_1acb4510b85ac413f9ea166e72d4bbca4&wdformid=%7b3cad2e15%2d9297%2d423e%2d87b0%2db890b72dfaa2%7d&action=formsubmit$all
||studentsimperial-my.sharepoint.com/personal/vcarrion_students_imperial_edu/_layouts/15/wopiframe.aspx?guestaccesstoken=rvz44awzcpdubusreabukfouvj04snc94kmlpod04h4%3d&docid=1_1acb4510b85ac413f9ea166e72d4bbca4&wdformid=%7b3cad2e15%2d9297%2d423e%2d87b0%2db890b72dfaa2%7d&action=formsubmit$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||stylesbyaranda.com$all
Filter updated: Fri, 26 Mar 2021 00:06:40 UTC
2021-03-26 00:06:40 +00:00
||stylifehomedecors.com$all
Filter updated: Sat, 08 May 2021 00:06:32 UTC
2021-05-08 00:06:32 +00:00
||sub4sub.co$all
Filter updated: Thu, 22 Jul 2021 00:01:54 +0000
2021-07-22 00:01:54 +00:00
||subdomainnet1.byethost13.com$all
Filter updated: Wed, 15 Sep 2021 12:01:46 +0000
2021-09-15 12:01:46 +00:00
||subtitlesdb.com$all
Filter updated: Thu, 25 Feb 2021 00:06:20 UTC
2021-02-25 00:06:20 +00:00
||successgroup.org$all
Filter updated: Tue, 04 May 2021 00:15:58 UTC
2021-05-04 00:15:58 +00:00
||succvirtl.com$all
Filter updated: Tue, 21 Sep 2021 00:01:40 +0000
2021-09-21 00:01:40 +00:00
||sucure-dcsonc.ml$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||sucure-doc-dcsonc.ga$all
Filter updated: Sun, 05 Sep 2021 12:01:36 +0000
2021-09-05 12:01:37 +00:00
||sucursalenlineacr.com$all
Filter updated: Mon, 05 Jul 2021 12:02:12 +0000
2021-07-05 12:02:12 +00:00
||sucursalpersona-stransaccionesbancolombia.com$all
Filter updated: Thu, 09 Sep 2021 00:01:56 +0000
2021-09-09 00:01:56 +00:00
||sucursalpersona1.2host.me$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||sucursapersonastransacionebancolombiaccomn.small-business-solutions.biz$all
Filter updated: Wed, 17 Mar 2021 00:06:16 UTC
2021-03-17 00:06:16 +00:00
||sucuvirtcolba.com$all
Filter updated: Sat, 07 Aug 2021 00:20:48 +0000
2021-08-07 00:20:48 +00:00
||sudamshelar.in$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||sudaworks.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||suelunn.com$all
Filter updated: Mon, 16 Aug 2021 12:01:42 +0000
2021-08-16 12:01:42 +00:00
||suisspost-tracking.com.ch.u1450107.cp.regruhosting.ru$all
Filter updated: Thu, 05 Aug 2021 00:02:05 +0000
2021-08-05 00:02:05 +00:00
||suitsandfits.com.pk$all
Filter updated: Sat, 12 Jun 2021 00:25:37 UTC
2021-06-12 00:25:37 +00:00
||suivi-cod2823999023.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||sultanbetgirisadresimiz.blogspot.com$all
||sultanbetgirisadresimiz1.blogspot.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||sumarckes.000webhostapp.com$all
Filter updated: Wed, 15 Sep 2021 12:01:46 +0000
2021-09-15 12:01:46 +00:00
||sumeret.com/wp.chinadomin/china/?login=replaced@us.sika.com&mc_phishing_protection_id=28396-c4a8rukna38tf30kt56g$all
Filter updated: Thu, 02 Sep 2021 12:02:02 +0000
2021-09-02 12:02:02 +00:00
||sumeret.com/wp.chinadomin/china?login=replaced@us.sika.com&mc_phishing_protection_id=28396-c4a8rukna38tf30kt56g$all
Filter updated: Sun, 12 Sep 2021 00:02:13 +0000
2021-09-12 00:02:13 +00:00
||suminetconfir.hostfree.pw$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||sumwilfried.wixsite.com$all
Filter updated: Wed, 07 Apr 2021 12:23:11 UTC
2021-04-07 12:23:12 +00:00
||sunbeltmembers.com$all
Filter updated: Thu, 14 Jan 2021 12:06:32 UTC
2021-01-14 12:06:32 +00:00
||suncoastcreditunion.balancepro.org$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||sunge-ode.firebaseapp.com$all
Filter updated: Mon, 05 Jul 2021 00:01:57 +0000
2021-07-05 00:01:57 +00:00
||sunmarkholidays.com$all
Filter updated: Wed, 14 Jul 2021 00:03:28 +0000
2021-07-14 00:03:28 +00:00
||sunsetslushdupage.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||sunypotsdam-my.sharepoint.com/:x:/r/personal/caniasj_potsdam_edu/_layouts/15/wopiframe.aspx?guestaccesstoken=3iraoz5qrcw0w4%2frehotcj25mgvldlzenlokue%2bfudw%3d&docid=1_10850bdc012e8450fb8f3297a80b3ecbb&wdformid=%7b955fb703-afe5-44b1-b0ca-d52fccb3199c%7d&action=formsubmit&cid=5df7ddf9-38f3-4abe-b529-7a3c4779e246$all
Filter updated: Thu, 02 Sep 2021 12:02:02 +0000
2021-09-02 12:02:02 +00:00
||supaserious.com$all
Filter updated: Fri, 30 Jul 2021 00:01:47 +0000
2021-07-30 00:01:47 +00:00
||supcuttfree.byethost7.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||superbahisgir12.blogspot.com$all
||superbahisgir2.blogspot.com$all
||superbahisgirisadresimiz.blogspot.com$all
||superbahisgirisadresimiz3.blogspot.com$all
||superbahisim1.blogspot.com$all
Filter updated: Tue, 30 Mar 2021 00:06:27 UTC
2021-03-30 00:06:27 +00:00
||supermilhas.com$all
Filter updated: Fri, 30 Jul 2021 00:01:47 +0000
2021-07-30 00:01:47 +00:00
||supernet-santa-1.hostfree.pw$all
Filter updated: Sat, 11 Sep 2021 12:01:27 +0000
2021-09-11 12:01:27 +00:00
||supernettsd-worl.byethost22.com$all
Filter updated: Mon, 02 Aug 2021 00:02:18 +0000
2021-08-02 00:02:18 +00:00
||supernetx.byethost32.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||superpark-my.sharepoint.com/:x:/r/personal/adrian_ramos_superpark_com_hk/_layouts/15/wopiframe.aspx?guestaccesstoken=vofjngnui%2fslbameorlq62qlg8mcdnpo1dizu6i%2bc1m%3d&docid=1_124bbb2f682ca4c7daba6cec6ee34dfb9&wdformid=%7ba85c8abe%2d68be%2d43dd%2d91f3%2db397386186be%7d&action=formsubmit$all
Filter updated: Fri, 13 Aug 2021 00:01:48 +0000
2021-08-13 00:01:48 +00:00
||supersantderft.byethost14.com$all
Filter updated: Tue, 14 Sep 2021 00:01:48 +0000
2021-09-14 00:01:48 +00:00
||supersantlogg.22web.org$all
Filter updated: Fri, 11 Jun 2021 00:06:40 UTC
2021-06-11 00:06:40 +00:00
||supersexytrends.com$all
Filter updated: Wed, 22 Sep 2021 00:02:26 +0000
2021-09-22 00:02:26 +00:00
||suplementoforca.bioextratus.com.br$all
Filter updated: Sat, 19 Dec 2020 00:06:42 UTC
2020-12-19 00:06:42 +00:00
||suportecxacesso2020.com$all
Filter updated: Thu, 18 Mar 2021 12:07:19 UTC
2021-03-18 12:07:19 +00:00
||suports-identiity-notification-secur-recovery.my.id$all
Filter updated: Thu, 25 Mar 2021 00:06:37 UTC
2021-03-25 00:06:37 +00:00
||suports-identity-notiification-secur-recovery.my.id$all
Filter updated: Fri, 30 Jul 2021 00:01:47 +0000
2021-07-30 00:01:47 +00:00
||suportsupernet.hostfree.pw$all
Filter updated: Tue, 06 Apr 2021 00:06:40 UTC
2021-04-06 00:06:40 +00:00
||suportts-notification-idntity-secur-recover.my.id$all
Filter updated: Wed, 02 Jun 2021 00:06:23 UTC
2021-06-02 00:06:23 +00:00
||suppliers.bitshepherd.org$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||support-att.com$all
Filter updated: Mon, 16 Aug 2021 00:01:59 +0000
2021-08-16 00:01:59 +00:00
||support-security.paypal.com.komamen.com$all
Filter updated: Sat, 13 Mar 2021 12:07:44 UTC
2021-03-13 12:07:44 +00:00
||support-verify-my-newpayments.com$all
Filter updated: Fri, 05 Mar 2021 00:09:33 UTC
2021-03-05 00:09:33 +00:00
||support-verify-mydevices.com$all
Filter updated: Mon, 30 Aug 2021 12:01:50 +0000
2021-08-30 12:01:51 +00:00
||support.streamsteam.ca$all
Filter updated: Wed, 28 Jul 2021 00:02:03 +0000
2021-07-28 00:02:03 +00:00
||supremenet4555.ultimatefreehost.in$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||sur-vey.ru$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||surface.ddnsking.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||surl.li/ahpcs/$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||surveyheart.com/form/5e23c40fb533f62621f5252d#form/0$all
||surveyheart.com/form/5e5b8d772e417841d96ee7af#form/0$all
Filter updated: Sat, 03 Oct 2020 12:06:36 UTC
2020-10-03 12:06:36 +00:00
||surveyheart.com/form/5f7840827687c759eed006a1#welcome$all
Filter updated: Mon, 10 May 2021 00:06:32 UTC
2021-05-10 00:06:32 +00:00
||surveyheart.com/form/608bca7586919c70a2066ef7$all
Filter updated: Thu, 22 Jul 2021 00:01:54 +0000
2021-07-22 00:01:54 +00:00
||surveyheart.com/form/60a058fc9006c7136837a91d#welcome$all
Filter updated: Fri, 27 Aug 2021 00:01:47 +0000
2021-08-27 00:01:47 +00:00
||surveyheart.com/form/60a94371b2b62b3fc765f8d6#form/0$all
Filter updated: Sun, 18 Jul 2021 12:02:04 +0000
2021-07-18 12:02:04 +00:00
||surveyheart.com/form/60a965d7f248866d4bfaa2e1$all
Filter updated: Sun, 06 Jun 2021 00:06:22 UTC
2021-06-06 00:06:22 +00:00
||surveyheart.com/form/60b6ccf8f448b239642ef416#welcome$all
Filter updated: Sat, 17 Jul 2021 00:01:47 +0000
2021-07-17 00:01:47 +00:00
||surveyheart.com/form/60bda82df448b2396434c877#form/0$all
||surveyheart.com/form/60bda82df448b2396434c877$all
Filter updated: Wed, 08 Sep 2021 00:02:08 +0000
2021-09-08 00:02:08 +00:00
||surveyheart.com/form/60c1eb6bda9e5d578a03ff44#welcome$all
Filter updated: Tue, 22 Jun 2021 00:06:28 +0000
2021-06-22 00:06:29 +00:00
||surveyheart.com/form/60c7e129d519fc79691fa39e#welcome$all
Filter updated: Mon, 26 Jul 2021 00:02:16 +0000
2021-07-26 00:02:17 +00:00
||surveyheart.com/form/60c9c5d0f448b2396441605e#form/0$all
Filter updated: Wed, 07 Jul 2021 12:01:55 +0000
2021-07-07 12:01:56 +00:00
||surveyheart.com/form/60e16548acc3670c142bc20f$all
Filter updated: Mon, 26 Jul 2021 00:02:16 +0000
2021-07-26 00:02:17 +00:00
||surveyheart.com/form/60f4eb89eec7723cc29b78c0#form/0$all
||surveyheart.com/form/60f4eb89eec7723cc29b78c0$all
||surveyheart.com/form/60fa5369257c2c6100a5f1b1#form/0$all
||surveyheart.com/form/60fa5369257c2c6100a5f1b1#welcome$all
Filter updated: Mon, 04 Jan 2021 12:06:21 UTC
2021-01-04 12:06:21 +00:00
||surveylegend.com/s/2vze$all
Filter updated: Wed, 03 Feb 2021 12:06:43 UTC
2021-02-03 12:06:43 +00:00
||susanlynnepeters.com$all
Filter updated: Sun, 18 Jul 2021 00:02:04 +0000
2021-07-18 00:02:04 +00:00
||suspedpromericsv.hostfree.pw$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||sustainabletech.cc$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||sustech.cc$all
Filter updated: Thu, 01 Jul 2021 00:01:46 +0000
2021-07-01 00:01:46 +00:00
||suupernett.byethost4.com$all
Filter updated: Wed, 07 Jul 2021 00:01:56 +0000
2021-07-07 00:01:57 +00:00
||suuupeernet.byethost7.com$all
Filter updated: Sun, 29 Nov 2020 12:06:41 UTC
2020-11-29 12:06:41 +00:00
||sv.mikecrm.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||svca.info$all
||svelte-kdy6dk.stackblitz.io$all
Filter updated: Thu, 08 Jul 2021 00:02:02 +0000
2021-07-08 00:02:02 +00:00
||svetikc.space$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||svkmmumbai-my.sharepoint.com/:x:/r/personal/pranjali_chandurkar_nmims_edu/_layouts/15/wopiframe.aspx?guestaccesstoken=668cyp4s%2fwcmx8rj223bvjfwdvtryffzfpyarbrueha%3d&docid=1_1916b69db182644fead12e874cad930c4&wdformid=%7bcd4093b9%2ddfae%2d49f1%2dadde%2df32fbe93b271%7d&action=formsubmit$all
Filter updated: Tue, 17 Aug 2021 12:01:39 +0000
2021-08-17 12:01:39 +00:00
||svr-casloginsfrmail.ulanding.me$all
Filter updated: Mon, 20 Sep 2021 00:01:41 +0000
2021-09-20 00:01:41 +00:00
||svri-my-mtb.com$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||swap.elena.finance$all
Filter updated: Mon, 13 Sep 2021 12:01:52 +0000
2021-09-13 12:01:52 +00:00
||swappauto.staging.lcsolutions.it$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||sweetxclusive.com$all
Filter updated: Fri, 24 Sep 2021 12:02:36 +0000
2021-09-24 12:02:36 +00:00
||swickard-goo.gq$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||swickard-or.tk$all
Filter updated: Tue, 21 Sep 2021 00:01:40 +0000
2021-09-21 00:01:40 +00:00
||swisscoat.com.cn/index.html$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||swisscom.myfreesites.net$all
Filter updated: Tue, 21 Sep 2021 00:01:40 +0000
2021-09-21 00:01:40 +00:00
||swisspost-delivering-parcel.trowelandfork.com$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||swisspost.info-versand.com$all
Filter updated: Mon, 06 Sep 2021 12:01:50 +0000
2021-09-06 12:01:50 +00:00
||swisstelecom.info$all
Filter updated: Sun, 11 Jul 2021 00:02:18 +0000
2021-07-11 00:02:18 +00:00
||switch.com.kw/.kw$all
||switch.com.kw/.kw/$all
||switch.com.kw/.si/$all
Filter updated: Thu, 16 Sep 2021 00:01:52 +0000
2021-09-16 00:01:52 +00:00
||synaxisreadymix.com$all
Filter updated: Wed, 26 May 2021 12:06:39 UTC
2021-05-26 12:06:39 +00:00
||synergica.no$all
Filter updated: Tue, 30 Mar 2021 12:06:32 UTC
2021-03-30 12:06:33 +00:00
||synoxpigments.com.br$all
Filter updated: Fri, 23 Jul 2021 00:03:07 +0000
2021-07-23 00:03:07 +00:00
||syromalabarbrisbanesouth.org.au$all
Filter updated: Wed, 16 Jun 2021 00:06:45 +0000
2021-06-16 00:06:45 +00:00
||systenver-coban.byethost7.com$all
Filter updated: Fri, 30 Oct 2020 12:06:39 UTC
2020-10-30 12:06:39 +00:00
||t-online-de.net$all
Filter updated: Fri, 27 Aug 2021 00:01:47 +0000
2021-08-27 00:01:47 +00:00
||t.co/4idnrqspjc?amp=1$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||t.co/8oqjd0lcjo?amp=1?trackingid=chrzmpae&signature=newsletter$all
Filter updated: Wed, 01 Sep 2021 00:02:20 +0000
2021-09-01 00:02:20 +00:00
||t.co/bez0scjtp9?amp=1?id=htgsjhisuu$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||t.co/bznnttpwyc?amp=1?trackingid=lhgy4czf&signature=newsletter$all
Filter updated: Wed, 22 Sep 2021 00:02:26 +0000
2021-09-22 00:02:26 +00:00
||t.co/egwwg2u26h?amp=1$all
Filter updated: Thu, 19 Aug 2021 00:01:47 +0000
2021-08-19 00:01:47 +00:00
||t.co/ejvjcj61gf?amp=1$all
Filter updated: Fri, 20 Aug 2021 00:01:56 +0000
2021-08-20 00:01:56 +00:00
||t.co/eyojzroijp?amp=1$all
Filter updated: Fri, 30 Jul 2021 12:01:52 +0000
2021-07-30 12:01:52 +00:00
||t.co/gkg8qifan6$all
Filter updated: Fri, 06 Aug 2021 00:01:52 +0000
2021-08-06 00:01:52 +00:00
||t.co/h7acl0jhzk$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||t.co/h7acl0jhzk?amp=1?trackingid=ncpvnlmx&signature=newsletter$all
||t.co/hau7jfzq6w?amp=1?trackingid=duv7ggf5&signature=newsletter$all
||t.co/hau7jfzq6w?amp=1?trackingid=upvqjzrm&signature=newsletter$all
||t.co/hau7jfzq6w?amp=1?trackingid=v3hqk4lo&signature=newsletter$all
Filter updated: Thu, 29 Jul 2021 00:01:57 +0000
2021-07-29 00:01:57 +00:00
||t.co/mo6udulxss?amp=1$all
Filter updated: Fri, 25 Jun 2021 00:06:14 +0000
2021-06-25 00:06:14 +00:00
||t.co/o0qawzpm7a?amp=1?trackingid=oz9ujyp7&signature=newsletter$all
Filter updated: Mon, 20 Sep 2021 12:02:05 +0000
2021-09-20 12:02:05 +00:00
||t.co/pidf3lkzfq?amp=1$all
Filter updated: Fri, 21 May 2021 00:06:36 UTC
2021-05-21 00:06:36 +00:00
||t.co/vq4q53mozw?amp=1$all
Filter updated: Thu, 16 Sep 2021 00:01:52 +0000
2021-09-16 00:01:52 +00:00
||t.co/xysalvvopk?amp=1$all
Filter updated: Wed, 01 Sep 2021 00:02:20 +0000
2021-09-01 00:02:20 +00:00
||t.co/yzq6afs3sj?amp=1$all
Filter updated: Fri, 17 Sep 2021 12:01:51 +0000
2021-09-17 12:01:52 +00:00
||t.co/zrd6j5rq4u?amp=1$all
Filter updated: Mon, 26 Jul 2021 00:02:16 +0000
2021-07-26 00:02:17 +00:00
||t.mail-svc.evernote.com/f/a/7vnazmxjrqjeu2yhcuso2a~~/aadd_wa~/rgri2drap0qxahr0chm6ly9rbm93bgvkz2vhbmr0cmfpbmluzy5jb20vbwvkymlsbhnwyxkymdixl1cdc3bjqgpg9dq19wcmnbtxuhptyw50b3zhbmkuyw5kcmvhqgdtywlslmnvbvgeaaaabg~~$all
Filter updated: Sun, 22 Aug 2021 00:01:52 +0000
2021-08-22 00:01:52 +00:00
||t.mails.total.direct-energie.com$all
Filter updated: Tue, 17 Aug 2021 12:01:39 +0000
2021-08-17 12:01:39 +00:00
||t.marketing1.william-reed.com/r/?id=h4b503239,418a056e,416f6e60$all
Filter updated: Sun, 28 Mar 2021 12:06:32 UTC
2021-03-28 12:06:32 +00:00
||t.mktla.com$all
Filter updated: Wed, 22 Sep 2021 00:02:26 +0000
2021-09-22 00:02:26 +00:00
||t3t23tgewy34y53uw5hrsj5uu467547435324253tgwtw4t4wtwyw.zvmflqkp7j-ypj680je54l2.p.runcloud.link$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||t9y.me$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||taalim.ma$all
Filter updated: Thu, 15 Jul 2021 00:02:02 +0000
2021-07-15 00:02:03 +00:00
||tabaccheriadelborgo.net$all
Filter updated: Thu, 22 Jul 2021 00:01:54 +0000
2021-07-22 00:01:54 +00:00
||tabitapeixoto.com$all
Filter updated: Tue, 17 Aug 2021 12:01:39 +0000
2021-08-17 12:01:39 +00:00
||tabloided.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||tadriib.com$all
Filter updated: Sun, 15 Aug 2021 12:01:40 +0000
2021-08-15 12:01:40 +00:00
||taengball.co$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||taher-mohamed-ahmed-saad.github.io$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||taijishentie.com$all
Filter updated: Mon, 15 Mar 2021 00:08:36 UTC
2021-03-15 00:08:36 +00:00
||taimitaivas.fi$all
Filter updated: Wed, 15 Sep 2021 12:01:46 +0000
2021-09-15 12:01:46 +00:00
||taiwokupolatiandco.com$all
Filter updated: Thu, 02 Sep 2021 12:02:02 +0000
2021-09-02 12:02:02 +00:00
||takbyte-stockholm.se$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||takingnote.learningmatters.tv$all
Filter updated: Fri, 24 Sep 2021 00:01:50 +0000
2021-09-24 00:01:51 +00:00
||takmengapa.com$all
Filter updated: Thu, 09 Sep 2021 00:01:56 +0000
2021-09-09 00:01:56 +00:00
||taljliwjbqcxgkwkaubudzoivu-dot-goff039302032323.rj.r.appspot.com$all
Filter updated: Thu, 18 Feb 2021 12:07:12 UTC
2021-02-18 12:07:12 +00:00
||talkingdogsmobile.com$all
Filter updated: Mon, 20 Sep 2021 12:02:05 +0000
2021-09-20 12:02:05 +00:00
||tamilnadutourstravels.com$all
Filter updated: Thu, 02 Sep 2021 12:02:02 +0000
2021-09-02 12:02:02 +00:00
||tamkein.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||tanbo.main.jp$all
Filter updated: Sat, 18 Sep 2021 12:01:34 +0000
2021-09-18 12:01:34 +00:00
||targetcareer.co.in$all
Filter updated: Fri, 20 Aug 2021 12:01:48 +0000
2021-08-20 12:01:48 +00:00
||tarik-fitness.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||taumiq.com$all
Filter updated: Thu, 29 Jul 2021 00:01:57 +0000
2021-07-29 00:01:57 +00:00
||tawk.link/5e9f607835bcbb0c9ab3656a/t/new-ticket/d3e5f86dddb76aaf581d0c09b5b91b2c034004c0/task_payment_doe1.pdf$all
Filter updated: Thu, 23 Sep 2021 00:02:18 +0000
2021-09-23 00:02:18 +00:00
||taxopus.com$all
Filter updated: Thu, 24 Dec 2020 12:06:14 UTC
2020-12-24 12:06:14 +00:00
||tb915hdh89.mfs.gg$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||tbbalpharetta.com$all
Filter updated: Tue, 10 Aug 2021 00:01:49 +0000
2021-08-10 00:01:49 +00:00
||tbositescapecompany.com$all
Filter updated: Sat, 24 Jul 2021 00:33:22 +0000
2021-07-24 00:33:22 +00:00
||tby.eb-sites.com$all
Filter updated: Fri, 17 Sep 2021 00:01:45 +0000
2021-09-17 00:01:46 +00:00
||tcaa.com.hk$all
Filter updated: Sun, 11 Jul 2021 00:02:18 +0000
2021-07-11 00:02:18 +00:00
||tcaconnect.ac-page.com$all
Filter updated: Tue, 14 Sep 2021 12:01:44 +0000
2021-09-14 12:01:44 +00:00
||tcpipserver.net$all
Filter updated: Wed, 07 Apr 2021 12:23:11 UTC
2021-04-07 12:23:12 +00:00
||tcta-my.sharepoint.com/:w:/g/personal/covid_tcta_co_za1/ebjxoc27czhhowhytqdp-3ibzjxhp5dd9_a-vm8e5vzs0a?e=tehygt$all
Filter updated: Fri, 17 Sep 2021 00:01:45 +0000
2021-09-17 00:01:46 +00:00
||tdtdghd-hdhhdgj-bdbbdj-9g27u.ondigitalocean.app$all
Filter updated: Wed, 15 Sep 2021 00:01:54 +0000
2021-09-15 00:01:55 +00:00
||teamfatbird.com$all
Filter updated: Mon, 19 Apr 2021 00:06:54 UTC
2021-04-19 00:06:54 +00:00
||teamgoogle125590.psee.ly$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||teamgrouppcl-my.sharepoint.com/:u:/g/personal/nongluck_m_attconsult_com/eumhzaoxwpngi0mled8_gs0blnumsbrsk_gjzqcnte543g?download=1&utm_content=newclient&utm_campaign=website&utm_source=julywazepromo&utm_medium=email$all
Filter updated: Thu, 17 Jun 2021 00:06:32 +0000
2021-06-17 00:06:32 +00:00
||teammetapp.azurefd.net$all
Filter updated: Fri, 11 Jun 2021 00:06:40 UTC
2021-06-11 00:06:40 +00:00
||teamshared.net.ru$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||teamsuport.github.io$all
Filter updated: Thu, 22 Apr 2021 00:06:42 UTC
2021-04-22 00:06:42 +00:00
||tecflex.com.br$all
Filter updated: Sat, 22 May 2021 00:06:19 UTC
2021-05-22 00:06:19 +00:00
||tech4guru.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||techdirectbh.com$all
Filter updated: Thu, 18 Feb 2021 00:06:34 UTC
2021-02-18 00:06:34 +00:00
||techfela.win$all
Filter updated: Sun, 18 Jul 2021 00:02:04 +0000
2021-07-18 00:02:04 +00:00
||techservic001.byethost11.com$all
Filter updated: Wed, 22 Sep 2021 00:02:26 +0000
2021-09-22 00:02:26 +00:00
||tecnocerberus.cl$all
Filter updated: Tue, 21 Sep 2021 00:01:40 +0000
2021-09-21 00:01:40 +00:00
||tecnominproductos.com$all
Filter updated: Fri, 09 Apr 2021 00:06:41 UTC
2021-04-09 00:06:41 +00:00
||tecsuport.com.br/files/system32/procesosdeseguridadhb/170.51.165.16679791/agregar/telefono/contacto/logonoperacionservlet.html$all
Filter updated: Wed, 01 Sep 2021 12:01:58 +0000
2021-09-01 12:01:58 +00:00
||teengamersnetwork.com$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||teeverse.in$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||tehno.gixx.ru$all
Filter updated: Tue, 21 Sep 2021 12:02:11 +0000
2021-09-21 12:02:11 +00:00
||teibertandassociates.com$all
Filter updated: Thu, 23 Sep 2021 00:02:18 +0000
2021-09-23 00:02:18 +00:00
||telaitaucardryco.000webhostapp.com$all
Filter updated: Thu, 19 Aug 2021 00:01:47 +0000
2021-08-19 00:01:47 +00:00
||telegra.ph/pua-10-09$all
Filter updated: Wed, 01 Sep 2021 12:01:58 +0000
2021-09-01 12:01:58 +00:00
||telekom.mydisplayer.stream$all
Filter updated: Tue, 13 Apr 2021 00:06:31 UTC
2021-04-13 00:06:31 +00:00
||telenorkandklimsupoort.blogspot.com/2021/03/blog-post_48.html$all
Filter updated: Wed, 09 Jun 2021 00:06:30 UTC
2021-06-09 00:06:31 +00:00
||telexaempresa.com$all
Filter updated: Tue, 10 Aug 2021 00:01:49 +0000
2021-08-10 00:01:49 +00:00
||tellmeliu.github.io$all
Filter updated: Thu, 29 Jul 2021 00:01:57 +0000
2021-07-29 00:01:57 +00:00
||tempatpinjamuang.co.id$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||templat65sldh.myfreesites.net$all
Filter updated: Sun, 19 Sep 2021 00:02:16 +0000
2021-09-19 00:02:17 +00:00
||temporary-url.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||tencentsresistancem3.com$all
Filter updated: Wed, 10 Feb 2021 00:06:29 UTC
2021-02-10 00:06:29 +00:00
||tenisclubemc.com.br$all
Filter updated: Tue, 20 Oct 2020 00:06:21 UTC
2020-10-20 00:06:21 +00:00
||termerosapepe.it$all
Filter updated: Fri, 24 Sep 2021 00:01:50 +0000
2021-09-24 00:01:51 +00:00
||terpelsicumple.com$all
Filter updated: Wed, 27 Jan 2021 12:06:59 UTC
2021-01-27 12:06:59 +00:00
||terri2.gitlab.io$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||tervem.hu$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||tes-wahyuu.duckdns.org$all
Filter updated: Sun, 27 Dec 2020 12:06:31 UTC
2020-12-27 12:06:31 +00:00
||test.arintek.ru$all
Filter updated: Thu, 03 Sep 2020 12:06:37 UTC
2020-09-03 12:06:37 +00:00
||test.bayoucitybadges.org$all
Filter updated: Sat, 08 May 2021 00:06:32 UTC
2021-05-08 00:06:32 +00:00
||test.cin.ba$all
Filter updated: Thu, 03 Sep 2020 12:06:37 UTC
2020-09-03 12:06:37 +00:00
||test.dxbproductions.com$all
Filter updated: Sat, 10 Jul 2021 00:01:42 +0000
2021-07-10 00:01:42 +00:00
||test.mediaclock.com.au$all
Filter updated: Mon, 13 Sep 2021 12:01:52 +0000
2021-09-13 12:01:52 +00:00
||test.prunescape.com.au$all
Filter updated: Fri, 20 Aug 2021 12:01:48 +0000
2021-08-20 12:01:48 +00:00
||test.srit.ac.in$all
Filter updated: Wed, 01 Sep 2021 00:02:20 +0000
2021-09-01 00:02:20 +00:00
||test.teacrew.team$all
Filter updated: Thu, 10 Sep 2020 12:06:46 UTC
2020-09-10 12:06:46 +00:00
||test.webclient4.de$all
Filter updated: Tue, 07 Sep 2021 00:01:46 +0000
2021-09-07 00:01:46 +00:00
||test1.cognizantdev.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||test102760.test-account.com/at&t-login.htm$all
||test103126.test-account.com/at&t-login.htm$all
Filter updated: Tue, 21 Sep 2021 12:02:11 +0000
2021-09-21 12:02:11 +00:00
||teste.listafood.com.br$all
Filter updated: Tue, 12 Jan 2021 12:06:44 UTC
2021-01-12 12:06:44 +00:00
||testingfortt-aj.com$all
Filter updated: Tue, 14 Sep 2021 12:01:44 +0000
2021-09-14 12:01:44 +00:00
||testjob.epizy.com$all
Filter updated: Fri, 12 Feb 2021 00:06:27 UTC
2021-02-12 00:06:27 +00:00
||texasfreedomrun.com$all
Filter updated: Mon, 26 Jul 2021 12:02:00 +0000
2021-07-26 12:02:00 +00:00
||tg.pe$all
Filter updated: Sat, 03 Jul 2021 00:01:56 +0000
2021-07-03 00:01:56 +00:00
||tgbhyu.hyperphp.com$all
Filter updated: Sat, 28 Aug 2021 00:33:51 +0000
2021-08-28 00:33:51 +00:00
||thdud-2536.ultimatefreehost.in$all
Filter updated: Fri, 24 Sep 2021 00:01:50 +0000
2021-09-24 00:01:51 +00:00
||the56ression.ru$all
Filter updated: Mon, 11 Jan 2021 12:06:44 UTC
2021-01-11 12:06:44 +00:00
||theaceofspaeder.com$all
Filter updated: Fri, 13 Aug 2021 00:01:48 +0000
2021-08-13 00:01:48 +00:00
||thebaseng.com$all
Filter updated: Mon, 08 Feb 2021 12:09:02 UTC
2021-02-08 12:09:02 +00:00
||thebeachleague.com$all
Filter updated: Mon, 26 Jul 2021 00:02:16 +0000
2021-07-26 00:02:17 +00:00
||thebusinessprofitsystem.com$all
Filter updated: Sun, 07 Feb 2021 00:06:51 UTC
2021-02-07 00:06:51 +00:00
||thechillipicklecanteen.com$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||theculturewire.com$all
Filter updated: Thu, 09 Sep 2021 12:02:27 +0000
2021-09-09 12:02:27 +00:00
||thedigirocket.com/wp-content/plugins/form.htm$all
Filter updated: Wed, 15 Sep 2021 12:01:46 +0000
2021-09-15 12:01:46 +00:00
||thedigitaltimes.com$all
Filter updated: Wed, 07 Jul 2021 00:01:56 +0000
2021-07-07 00:01:57 +00:00
||thedscomputers.com$all
Filter updated: Thu, 08 Apr 2021 12:07:09 UTC
2021-04-08 12:07:09 +00:00
||theduecfoinv.com$all
Filter updated: Wed, 09 Jun 2021 00:06:30 UTC
2021-06-09 00:06:31 +00:00
||theepic.in$all
Filter updated: Wed, 15 Sep 2021 12:01:46 +0000
2021-09-15 12:01:46 +00:00
||thefarmmanagers.com$all
Filter updated: Fri, 16 Apr 2021 12:06:41 UTC
2021-04-16 12:06:41 +00:00
||thefeelingwhole.com$all
Filter updated: Mon, 23 Aug 2021 12:02:18 +0000
2021-08-23 12:02:19 +00:00
||thefishbowlltd.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||thefocaltherapyfoundation.org$all
Filter updated: Tue, 14 Sep 2021 12:01:44 +0000
2021-09-14 12:01:44 +00:00
||thehotelmart.com$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||thekingsandqueens.in$all
Filter updated: Sat, 11 Sep 2021 00:34:15 +0000
2021-09-11 00:34:15 +00:00
||thelocalgamers.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||themarbleshop.sharepoint.com/:x:/r/_layouts/15/wopiframe.aspx?guestaccesstoken=b0tjq7uw13ohhsvlvr6vq189xb2ed7p3yoiuxgzs5xu%3d&docid=1_127b97513b5664db7a2c23beec6cbdf50&wdformid=%7b8bd84c70-967f-4172-8b3b-973c5f74f5a8%7d&action=formsubmit&cid=18e6e320-2aeb-4aa0-befe-ed946b2e8bd0$all
Filter updated: Tue, 27 Jul 2021 00:02:10 +0000
2021-07-27 00:02:10 +00:00
||themarketingdream.com$all
Filter updated: Sat, 11 Sep 2021 00:34:15 +0000
2021-09-11 00:34:15 +00:00
||themebird.com$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||themes.xclusivethemes.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||themkdiaries.com$all
Filter updated: Mon, 20 Sep 2021 12:02:05 +0000
2021-09-20 12:02:05 +00:00
||themyams.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||thenine9.com$all
Filter updated: Sat, 11 Sep 2021 00:34:15 +0000
2021-09-11 00:34:15 +00:00
||theone-lotto.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||thepaperdesign.com$all
||therockacc.org$all
||thescrapescape.com$all
Filter updated: Mon, 02 Aug 2021 00:02:18 +0000
2021-08-02 00:02:18 +00:00
||theswiftstitch.com$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||thetrafficbar.com$all
Filter updated: Fri, 30 Jul 2021 00:01:47 +0000
2021-07-30 00:01:47 +00:00
||theultimatelistener.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||theumashow.com$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||thirsty-kepler-5b96ca.netlify.app$all
Filter updated: Sun, 21 Mar 2021 12:06:11 UTC
2021-03-21 12:06:11 +00:00
||three-retail-live.devicetradein.co.uk$all
Filter updated: Wed, 09 Dec 2020 00:06:46 UTC
2020-12-09 00:06:46 +00:00
||tighi.creatorlink.net$all
Filter updated: Tue, 07 Sep 2021 12:01:49 +0000
2021-09-07 12:01:49 +00:00
||tikiimage.devotedcreations.com$all
Filter updated: Fri, 24 Sep 2021 00:01:50 +0000
2021-09-24 00:01:51 +00:00
||tiktok-ticket.ru$all
Filter updated: Mon, 02 Aug 2021 00:02:18 +0000
2021-08-02 00:02:18 +00:00
||tilama.suermax.de$all
Filter updated: Sat, 26 Jun 2021 00:06:14 +0000
2021-06-26 00:06:14 +00:00
||timeenigma.com#ggradnigo@prepaidlegal.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||tinavegaphotography.com$all
Filter updated: Thu, 29 Apr 2021 12:07:55 UTC
2021-04-29 12:07:55 +00:00
||tinify.ir$all
Filter updated: Thu, 29 Jul 2021 00:01:57 +0000
2021-07-29 00:01:57 +00:00
||tiny.one/mj76nxhf$all
Filter updated: Fri, 02 Apr 2021 12:06:43 UTC
2021-04-02 12:06:43 +00:00
||tinyl.uk$all
Filter updated: Wed, 08 Sep 2021 00:02:08 +0000
2021-09-08 00:02:08 +00:00
||tinyurl.com/2742uwk2$all
Filter updated: Sun, 19 Sep 2021 00:02:16 +0000
2021-09-19 00:02:17 +00:00
||tinyurl.com/335nb9dd?email=user@calstatela.edu$all
Filter updated: Tue, 31 Aug 2021 12:01:54 +0000
2021-08-31 12:01:54 +00:00
||tinyurl.com/3j3k2mzd$all
Filter updated: Sat, 12 Jun 2021 00:25:37 UTC
2021-06-12 00:25:37 +00:00
||tinyurl.com/48rzxpne$all
Filter updated: Sun, 23 May 2021 00:06:33 UTC
2021-05-23 00:06:33 +00:00
||tinyurl.com/5mhr8xz2$all
Filter updated: Mon, 13 Sep 2021 00:02:04 +0000
2021-09-13 00:02:04 +00:00
||tinyurl.com/b8wjtbep$all
Filter updated: Fri, 26 Mar 2021 12:07:44 UTC
2021-03-26 12:07:45 +00:00
||tinyurl.com/btinternet56$all
Filter updated: Wed, 05 May 2021 12:12:51 UTC
2021-05-05 12:12:51 +00:00
||tinyurl.com/di9mnobebi$all
Filter updated: Thu, 29 Apr 2021 00:07:24 UTC
2021-04-29 00:07:24 +00:00
||tinyurl.com/evyu688y$all
Filter updated: Wed, 18 Aug 2021 00:01:50 +0000
2021-08-18 00:01:50 +00:00
||tinyurl.com/kdtvp$all
||tinyurl.com/m6t9puyd$all
Filter updated: Thu, 01 Jul 2021 12:02:02 +0000
2021-07-01 12:02:03 +00:00
||tinyurl.com/n2p8adtb?email=ndanatsei.nyamhunga@sc.comorganization$all
Filter updated: Sat, 17 Apr 2021 00:06:31 UTC
2021-04-17 00:06:31 +00:00
||tinyurl.com/nycgovtgrant$all
Filter updated: Tue, 20 Jul 2021 12:01:48 +0000
2021-07-20 12:01:48 +00:00
||tinyurl.com/relief-for-pandemic$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||tinyurl.com/sd9t35n/?cliente=multiconexoes@terra.com.br/jhyyw8hlac3s5ao9r7mr22fe/imprimir.cgi$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||tinyurl.com/toqjl4j/?email=firstregistration6@dvla.gov.uk$all
Filter updated: Sun, 13 Dec 2020 00:06:49 UTC
2020-12-13 00:06:49 +00:00
||tinyurl.com/y2czr3ag$all
Filter updated: Thu, 16 Sep 2021 12:02:15 +0000
2021-09-16 12:02:15 +00:00
||tinyurl.com/y3hkttk5$all
Filter updated: Wed, 09 Dec 2020 12:06:49 UTC
2020-12-09 12:06:49 +00:00
||tinyurl.com/y3xk7mt7/$all
Filter updated: Thu, 20 May 2021 12:06:36 UTC
2021-05-20 12:06:36 +00:00
||tinyurl.com/yhgdwa3h$all
Filter updated: Sun, 13 Dec 2020 00:06:49 UTC
2020-12-13 00:06:49 +00:00
||tinyurl.com/yxb48kqj$all
Filter updated: Tue, 01 Dec 2020 00:06:31 UTC
2020-12-01 00:06:31 +00:00
||tinyurl.com/yxry9vf5$all
Filter updated: Sun, 13 Dec 2020 00:06:49 UTC
2020-12-13 00:06:49 +00:00
||tinyurl.com/yyvm8qr5$all
Filter updated: Wed, 14 Jul 2021 00:03:28 +0000
2021-07-14 00:03:28 +00:00
||tisisa.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||titelinedrillingintl.yolasite.com$all
||tkx29.codesandbox.io$all
Filter updated: Thu, 23 Sep 2021 00:02:18 +0000
2021-09-23 00:02:18 +00:00
||tlatx.com$all
Filter updated: Thu, 29 Jul 2021 00:01:57 +0000
2021-07-29 00:01:57 +00:00
||tlorfplqnrrstiopkvgmarjwyp-dot-gowa11111111.rj.r.appspot.com$all
Filter updated: Thu, 09 Sep 2021 12:02:27 +0000
2021-09-09 12:02:27 +00:00
||tlzwyjwiygqyjvtwrzhykkjmkp-dot-goff039302032323.rj.r.appspot.com$all
Filter updated: Tue, 08 Jun 2021 00:06:30 UTC
2021-06-08 00:06:30 +00:00
||tm55trk.com$all
Filter updated: Tue, 03 Nov 2020 00:06:18 UTC
2020-11-03 00:06:18 +00:00
||tmphysio.de$all
Filter updated: Wed, 15 Sep 2021 12:01:46 +0000
2021-09-15 12:01:46 +00:00
||tng84.hyperphp.com$all
Filter updated: Thu, 26 Nov 2020 12:06:43 UTC
2020-11-26 12:06:43 +00:00
||to-ken.biz$all
Filter updated: Fri, 30 Jul 2021 00:01:47 +0000
2021-07-30 00:01:47 +00:00
||to.to$all
Filter updated: Fri, 04 Sep 2020 12:06:38 UTC
2020-09-04 12:06:38 +00:00
||toancaupumps.com$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||toancaupumps.com/bk/v.html$all
Filter updated: Mon, 08 Mar 2021 12:06:34 UTC
2021-03-08 12:06:34 +00:00
||toanhoc247.edu.vn$all
Filter updated: Tue, 08 Dec 2020 12:06:43 UTC
2020-12-08 12:06:44 +00:00
||toddler-town.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||todosprodutos.com.br$all
Filter updated: Tue, 21 Sep 2021 12:02:11 +0000
2021-09-21 12:02:11 +00:00
||toitedundefined.info$all
Filter updated: Fri, 11 Sep 2020 12:06:39 UTC
2020-09-11 12:06:39 +00:00
||tokullarmobilya.com$all
Filter updated: Fri, 03 Sep 2021 12:01:48 +0000
2021-09-03 12:01:48 +00:00
||tomori22.my.id$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||tong464-my.sharepoint.com/personal/parevalo_tong464_org/_layouts/15/onedrive.aspx?id=/personal/parevalo_tong464_org/documents/northgate.pdf&parent=/personal/parevalo_tong464_org/documents&originalpath=ahr0chm6ly90b25nndy0lw15lnnoyxjlcg9pbnquy29tlzpioi9nl3blcnnvbmfsl3bhcmv2ywxvx3rvbmc0njrfb3jnl0vvq0nhshlxmflkrxa5cm1ravlyzklnqjfiz2jsvghqowroel9evvbxumvvngc_cnrpbwu9q0lkatrhlveyrwc$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||tool.3utilities.com$all
Filter updated: Tue, 06 Jul 2021 12:02:08 +0000
2021-07-06 12:02:09 +00:00
||tooljerejin.airsite.co$all
Filter updated: Fri, 04 Jun 2021 12:07:04 UTC
2021-06-04 12:07:04 +00:00
||top10songsnews.com$all
Filter updated: Thu, 08 Apr 2021 12:07:09 UTC
2021-04-08 12:07:09 +00:00
||top20bonus.com$all
Filter updated: Fri, 27 Aug 2021 12:01:40 +0000
2021-08-27 12:01:40 +00:00
||top30colombiapp.com$all
Filter updated: Tue, 14 Sep 2021 00:01:48 +0000
2021-09-14 00:01:48 +00:00
||topclassicrockvids.com$all
Filter updated: Sun, 02 May 2021 00:06:30 UTC
2021-05-02 00:06:30 +00:00
||topskills.ru$all
Filter updated: Sun, 19 Sep 2021 12:01:34 +0000
2021-09-19 12:01:35 +00:00
||topup-freefire999.duckdns.org$all
Filter updated: Sat, 28 Nov 2020 12:06:39 UTC
2020-11-28 12:06:39 +00:00
||torrinwine.com$all
Filter updated: Sun, 22 Aug 2021 00:01:52 +0000
2021-08-22 00:01:52 +00:00
||total.direct-energie.com$all
Filter updated: Fri, 13 Nov 2020 00:06:21 UTC
2020-11-13 00:06:21 +00:00
||tow1.photoclub-ebroicien.fr$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||tpq74.codesandbox.io$all
Filter updated: Thu, 13 May 2021 12:06:27 UTC
2021-05-13 12:06:28 +00:00
||tpservices.runescape.com-nu.ru$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||tr.im/alertaslbcp$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||track.dpdlocal.co.uk/parcels/15976651104108*19609/$all
Filter updated: Sun, 06 Dec 2020 00:06:44 UTC
2020-12-06 00:06:44 +00:00
||track.drerries.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||tracking-diepost-onlineservice.com$all
Filter updated: Fri, 16 Jul 2021 00:01:53 +0000
2021-07-16 00:01:53 +00:00
||tracking.gobelets.info$all
Filter updated: Fri, 24 Sep 2021 12:02:36 +0000
2021-09-24 12:02:36 +00:00
||trade-offers.link$all
Filter updated: Wed, 19 May 2021 12:06:41 UTC
2021-05-19 12:06:41 +00:00
||traderstruth.biz$all
Filter updated: Mon, 16 Aug 2021 00:01:59 +0000
2021-08-16 00:01:59 +00:00
||tradeswarehouse.com$all
Filter updated: Sun, 13 Jun 2021 00:06:42 UTC
2021-06-13 00:06:42 +00:00
||trafitoloquera.byethost33.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||trail.tmr.asia$all
Filter updated: Thu, 18 Feb 2021 12:07:12 UTC
2021-02-18 12:07:12 +00:00
||trams.mot.go.th$all
Filter updated: Fri, 30 Jul 2021 12:01:52 +0000
2021-07-30 12:01:52 +00:00
||trangnapthelienquan.com$all
Filter updated: Sun, 15 Aug 2021 12:01:40 +0000
2021-08-15 12:01:40 +00:00
||transferenciasinternacionalesseguridadbnet.000webhostapp.com$all
Filter updated: Mon, 02 Aug 2021 12:01:44 +0000
2021-08-02 12:01:44 +00:00
||transferpricing.firs.gov.ng$all
Filter updated: Wed, 03 Mar 2021 00:08:05 UTC
2021-03-03 00:08:05 +00:00
||transit-e.com$all
Filter updated: Sun, 16 May 2021 12:06:24 UTC
2021-05-16 12:06:24 +00:00
||translate.sogoucdn.com/pcvtsnapshotorigin?_t=1527230263291&from=en&notrans=0&query=&tabmode=1&tfr=englishpc&to=zh-chs&url=https://www.wellsfargo.com$all
||translate.sogoucdn.com/pcvtsnapshotorigin?_t=1572026205262%20open_in_new%20add%20link&from=en&notrans=0&query=paypal%20account&tabmode=2&tfr=englishpc&to=zh-chs&url=https://www.paypal.com/us/signin$all
||translate.sogoucdn.com/pcvtsnapshotorigin?url=https://www.paypal.com/us/signin&query=paypal%20account&tabmode=2&n$all
Filter updated: Fri, 16 Jul 2021 12:01:57 +0000
2021-07-16 12:01:57 +00:00
||translate.sogoucdn.com/pcvtsnapshotorigin?url=https://www.paypal.com/us/signin&query=paypal%20account&tabmode=2&notrans=0&tfr=englishpc&from=en&to=zh-chs&securl=&_t=1572026205262%20open_in_new%20add%20link%20open_in_new%20add%20link$all
Filter updated: Sat, 04 Sep 2021 00:17:00 +0000
2021-09-04 00:17:00 +00:00
||transmancomplain.com$all
Filter updated: Tue, 07 Sep 2021 12:01:49 +0000
2021-09-07 12:01:49 +00:00
||transmancomplain.net$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||travelingislifetours.com$all
Filter updated: Tue, 18 May 2021 00:06:34 UTC
2021-05-18 00:06:34 +00:00
||travelzeed.com$all
Filter updated: Mon, 06 Sep 2021 12:01:50 +0000
2021-09-06 12:01:50 +00:00
||travosh.com$all
Filter updated: Wed, 01 Sep 2021 12:01:58 +0000
2021-09-01 12:01:58 +00:00
||travpayments.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||tregollsschool-my.sharepoint.com/:x:/r/personal/dbullen_tregolls_cornwall_sch_uk/_layouts/15/wopiframe.aspx?guestaccesstoken=4w7nbxyv%2be5q5h6ifvqsvt%2ba0azuzpfgpywxpwtq6mu%3d&docid=1_1114d83a63e0f489b93e746d8b241db70&wdformid=%7bfff4536c%2d404d%2d410d%2da3b7%2d4cc8a8841296%7d&action=formsubmit$all
Filter updated: Fri, 30 Jul 2021 00:01:47 +0000
2021-07-30 00:01:47 +00:00
||trelock.com$all
Filter updated: Fri, 04 Dec 2020 00:06:15 UTC
2020-12-04 00:06:16 +00:00
||treqin.com$all
Filter updated: Tue, 13 Jul 2021 12:01:57 +0000
2021-07-13 12:01:57 +00:00
||triathlonindia.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||triathlonontario-my.sharepoint.com/:x:/r/personal/ed_triathlonontario_com/_layouts/15/wopiframe.aspx?guestaccesstoken=tx4pjpe6j3l456dw6h5p4rjclnpql4gy3umalpcsbgc%3d&docid=1_15c1c05a0348c406b917721edd22b400e&wdformid=%7b743b2d9a-465e-4a2d-a672-3b480e7184ff%7d&action=formsubmit&cid=2b766ac1-60f6-4883-8ff0-3a53524a1f1c$all
||triathlonontario-my.sharepoint.com/personal/ed_triathlonontario_com/_layouts/15/wopiframe.aspx?guestaccesstoken=tx4pjpe6j3l456dw6h5p4rjclnpql4gy3umalpcsbgc%3d&docid=1_15c1c05a0348c406b917721edd22b400e&wdformid=%7b743b2d9a-465e-4a2d-a672-3b480e7184ff%7d&action=formsubmit&cid=2b766ac1-60f6-4883-8ff0-3a53524a1f1c$all
Filter updated: Sat, 11 Sep 2021 00:34:15 +0000
2021-09-11 00:34:15 +00:00
||tricitiesguardian.com$all
Filter updated: Thu, 22 Jul 2021 00:01:54 +0000
2021-07-22 00:01:54 +00:00
||triggermarketing.biz$all
Filter updated: Sat, 29 May 2021 12:06:18 UTC
2021-05-29 12:06:19 +00:00
||trilles157.typeform.com$all
Filter updated: Sat, 28 Aug 2021 00:33:51 +0000
2021-08-28 00:33:51 +00:00
||trk.fjenterprisemarketinginc.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||truckcalling.com$all
Filter updated: Mon, 16 Aug 2021 00:01:59 +0000
2021-08-16 00:01:59 +00:00
||trucktrader.com.my$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||true-fish.ru$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||true.ddnsking.com$all
Filter updated: Thu, 23 Sep 2021 00:02:18 +0000
2021-09-23 00:02:18 +00:00
||trueperson.remsend.com$all
Filter updated: Fri, 13 Aug 2021 12:01:44 +0000
2021-08-13 12:01:44 +00:00
||ts.hust.edu.vn$all
Filter updated: Fri, 04 Jun 2021 12:07:04 UTC
2021-06-04 12:07:04 +00:00
||tsallagti.ru$all
Filter updated: Fri, 18 Dec 2020 12:06:22 UTC
2020-12-18 12:06:22 +00:00
||tsecure-paxful.com$all
Filter updated: Fri, 06 Aug 2021 12:01:57 +0000
2021-08-06 12:01:57 +00:00
||tsojkzeiyukvolziurnjijjbzc-dot-goff039302032323.rj.r.appspot.com$all
Filter updated: Wed, 28 Oct 2020 12:09:06 UTC
2020-10-28 12:09:06 +00:00
||tsuzuki.co.id$all
Filter updated: Sat, 03 Jul 2021 12:01:36 +0000
2021-07-03 12:01:37 +00:00
||ttsqyr.classsizecounts.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||tubepchiunuoc.com$all
||tudosobretudo.blog.br$all
Filter updated: Sat, 29 May 2021 00:06:23 UTC
2021-05-29 00:06:23 +00:00
||tupa90192.byethost7.com$all
Filter updated: Sun, 05 Sep 2021 00:02:15 +0000
2021-09-05 00:02:15 +00:00
||turawa-ostoja.pl$all
Filter updated: Tue, 07 Sep 2021 00:01:46 +0000
2021-09-07 00:01:46 +00:00
||turbantours.com$all
Filter updated: Fri, 15 Jan 2021 00:06:14 UTC
2021-01-15 00:06:14 +00:00
||turboflightpros.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||tutunjirealty.com$all
Filter updated: Thu, 29 Jul 2021 00:01:57 +0000
2021-07-29 00:01:57 +00:00
||tvbdtkfqotcdcwquhqbyxhpeiv-dot-gowa11111111.rj.r.appspot.com$all
Filter updated: Thu, 12 Aug 2021 12:01:52 +0000
2021-08-12 12:01:53 +00:00
||twitteranalytis.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||twowheelcool.com$all
Filter updated: Tue, 31 Aug 2021 12:01:54 +0000
2021-08-31 12:01:54 +00:00
||tx.vc$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||typesmartlyocr.com$all
Filter updated: Mon, 15 Mar 2021 12:43:24 UTC
2021-03-15 12:43:24 +00:00
||tyrecentre.ru$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||tyzwox.webwave.dev$all
Filter updated: Tue, 21 Sep 2021 12:02:11 +0000
2021-09-21 12:02:11 +00:00
||u.japanrakutenfill.ga$all
||u.jprakutenfill.ml$all
||u.jprankutenpart.ga$all
||u.jprankutenpartdo.ml$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||u.to/32megq$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||u.to/_picgw?yhjzos7ve80$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||u.to/isx3gg?notification-identity-office$all
||u.to/umxggg$all
||u.to/unrpgg$all
||u.to/wsddga$all
Filter updated: Sat, 29 May 2021 12:06:18 UTC
2021-05-29 12:06:19 +00:00
||u08qv44zu5h.typeform.com$all
Filter updated: Tue, 07 Sep 2021 12:01:49 +0000
2021-09-07 12:01:49 +00:00
||u12458371pj.ha004.t.justns.ru$all
Filter updated: Thu, 24 Jun 2021 12:06:27 +0000
2021-06-24 12:06:27 +00:00
||u1409685.cp.regruhosting.ru$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||u15838okb.ha002.t.justns.ru$all
Filter updated: Wed, 01 Sep 2021 00:02:20 +0000
2021-09-01 00:02:20 +00:00
||u22983419.ct.sendgrid.net$all
Filter updated: Tue, 01 Jun 2021 00:06:26 UTC
2021-06-01 00:06:26 +00:00
||u443456b3l.ha004.t.justns.ru$all
Filter updated: Sat, 29 May 2021 00:06:23 UTC
2021-05-29 00:06:23 +00:00
||u4ifw.csb.app$all
Filter updated: Fri, 30 Jul 2021 12:01:52 +0000
2021-07-30 12:01:52 +00:00
||u8tny.skipdns.link$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||u924157p.beget.tech$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||ubee.co.kr$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||uber.deli.mixh.jp$all
Filter updated: Mon, 13 Sep 2021 12:01:52 +0000
2021-09-13 12:01:52 +00:00
||ublcsp.com$all
Filter updated: Tue, 01 Jun 2021 12:06:34 UTC
2021-06-01 12:06:34 +00:00
||ubw.9e7.myftpupload.com$all
Filter updated: Sat, 18 Sep 2021 00:14:48 +0000
2021-09-18 00:14:48 +00:00
||ucek-up.000webhostapp.com$all
Filter updated: Fri, 10 Sep 2021 00:02:17 +0000
2021-09-10 00:02:17 +00:00
||ueditme.com$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||ufbk.jp.mkdinue.co$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||ufbk.jp.mkdinue.jp$all
Filter updated: Fri, 10 Sep 2021 00:02:17 +0000
2021-09-10 00:02:17 +00:00
||uglcsonfonia.org$all
Filter updated: Tue, 10 Aug 2021 00:01:49 +0000
2021-08-10 00:01:49 +00:00
||uguett.hyperphp.com$all
Filter updated: Mon, 16 Aug 2021 00:01:59 +0000
2021-08-16 00:01:59 +00:00
||uisbfsd.tk$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||ujs612.activehosted.com$all
Filter updated: Fri, 27 Aug 2021 00:01:47 +0000
2021-08-27 00:01:47 +00:00
||uk-security9238.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||uk0qx.codesandbox.io$all
||ukcare.in$all
Filter updated: Fri, 24 Sep 2021 12:02:36 +0000
2021-09-24 12:02:36 +00:00
||ukpostal-delivery.com$all
Filter updated: Thu, 26 Aug 2021 12:02:31 +0000
2021-08-26 12:02:31 +00:00
||ukpostal-fee.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||ukresidential-servicesupport.com$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||ulronn16yc8vpyedbtqfjghnrrjrpnjed9mdzzjuqbekzxhaqx.chenyunong.top$all
Filter updated: Mon, 13 Sep 2021 12:01:52 +0000
2021-09-13 12:01:52 +00:00
||ultimatecbdclub.com$all
Filter updated: Thu, 25 Mar 2021 00:06:37 UTC
2021-03-25 00:06:37 +00:00
||ultimatemotors.co.ke$all
Filter updated: Mon, 16 Aug 2021 00:01:59 +0000
2021-08-16 00:01:59 +00:00
||ultimateseguri9.ultimatefreehost.in$all
Filter updated: Mon, 08 Mar 2021 00:11:13 UTC
2021-03-08 00:11:13 +00:00
||umbrellaclubla.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||umconnectumt-my.sharepoint.com/personal/es127759_umconnect_umt_edu/_layouts/15/wopiframe.aspx?guestaccesstoken=e%2f5p4lmr7oxtbuuzst9ihpacebtz%2bhbogl5i950bhau%3d&docid=1_151b39d9e7dd54cfba500875349d3beb6&wdformid=%7bda6fcad9%2d9684%2d43af%2db959%2de2fa774eaba6%7d&action=formsubmit$all
||umconnectumt-my.sharepoint.com/personal/es127759_umconnect_umt_edu/_layouts/15/wopiframe.aspx?guestaccesstoken=h2b5qkvlooc%2bfvhpo6qkbxdfdzwzpa7doqhaikfrj08%3d&docid=1_1cab74931edec4bf39e6f4768e7830a02&wdformid=%7b6a702647%2db560%2d40c5%2d8890%2d109ec5ad9bc5%7d&action=formsubmit$all
||umconnectumt-my.sharepoint.com/personal/es127759_umconnect_umt_edu/_layouts/15/wopiframe.aspx?guestaccesstoken=inau9tsjk5bvaoypx/gfkvgo0iz4rq47kvts4tkb8yq=&docid=1_19c7a48ea3a0448c78765a480857920f0&wdformid={d8f70a7d-4204-4a87-a88e-bad6b0e4129e}&action=formsubmit$all
||umconnectumt-my.sharepoint.com/personal/es127759_umconnect_umt_edu/_layouts/15/wopiframe.aspx?guestaccesstoken=uh9hjveaooebgqolme%2f5qft71pw2stg2ojiiqxebzce%3d&docid=1_11e28ca5d86c6416f926736ea3e8ad885&wdformid=%7b70256f91%2df178%2d4e5f%2d847a%2df748294a79c9%7d&action=formsubmit$all
Filter updated: Wed, 08 Sep 2021 00:02:08 +0000
2021-09-08 00:02:08 +00:00
||umeacademy.com/wine$all
Filter updated: Mon, 17 May 2021 00:06:19 UTC
2021-05-17 00:06:19 +00:00
||ummatamima.buet.ac.bd$all
Filter updated: Thu, 17 Jun 2021 12:06:40 +0000
2021-06-17 12:06:40 +00:00
||umu.link$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||umzap.com$all
Filter updated: Sat, 29 May 2021 12:06:18 UTC
2021-05-29 12:06:19 +00:00
||un9d1h3qbs9.typeform.com$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||unacontinuaevoluzione.accesscam.org$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||unam.myfreesites.net$all
Filter updated: Fri, 15 Jan 2021 00:06:14 UTC
2021-01-15 00:06:14 +00:00
||unauthorised-login-attempt872.com$all
Filter updated: Wed, 13 Jan 2021 12:06:45 UTC
2021-01-13 12:06:45 +00:00
||unauthorised-request.com/lloyds$all
||unauthorised-request.com/lloyds/$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||unauthorised-request.com/lloyds/login.php$all
Filter updated: Thu, 25 Feb 2021 00:06:20 UTC
2021-02-25 00:06:20 +00:00
||unauthorisedpayeerequest.com/lloyds$all
Filter updated: Thu, 04 Mar 2021 12:07:52 UTC
2021-03-04 12:07:52 +00:00
||unauthoriserecentdevice.com$all
Filter updated: Thu, 29 Jul 2021 00:01:57 +0000
2021-07-29 00:01:57 +00:00
||unclaimed-moneysearch.com/?pid=405&utm_source=405&utm_campaign=405&chk=1&cid=669ca57cbbc8475ba2314fd339e262c0$all
Filter updated: Thu, 02 Sep 2021 00:01:59 +0000
2021-09-02 00:01:59 +00:00
||unclelouie.com$all
Filter updated: Mon, 20 Sep 2021 12:02:05 +0000
2021-09-20 12:02:05 +00:00
||undefinedbiopiracy.info$all
||underdodrat.info$all
Filter updated: Thu, 22 Apr 2021 12:08:20 UTC
2021-04-22 12:08:20 +00:00
||unef.edu.br/mofiles/z1v17xnm2o211yxxs9qsg0kq.php?secure&share=5ii6i3161907542327469989da34b13e2e4cfafd9127aa1127469989da34b13e2e4cfafd9127aa1127469989da34b13e2e4cfafd9127aa1127469989da34b13e2e4cfafd9127aa1127469989da34b13e2e4cfafd9127aa11$all
Filter updated: Wed, 14 Apr 2021 00:08:24 UTC
2021-04-14 00:08:24 +00:00
||unef.edu.br/oldfile/4ve4ydqk581f45nsvwwoshtu.php$all
||unef.edu.br/oldfile/proposal/common/?login.srf$all
Filter updated: Fri, 30 Apr 2021 12:07:08 UTC
2021-04-30 12:07:09 +00:00
||unef.edu.br/ues/swe/signln.php?email=nooruddin@prepaidlegal.com$all
Filter updated: Sat, 08 May 2021 00:06:32 UTC
2021-05-08 00:06:32 +00:00
||unef.edu.br/verify/login.php?cmd=login_submit&id=2f450dca7d9c5757fdd8f47c3521c9cd2f450dca7d9c5757fdd8f47c3521c9cd&session=2f450dca7d9c5757fdd8f47c3521c9cd2f450dca7d9c5757fdd8f47c3521c9cd$all
||unef.edu.br/verify/login.php?cmd=login_submit&id=b031e524548632bda97c28367fe1d929b031e524548632bda97c28367fe1d929&session=b031e524548632bda97c28367fe1d929b031e524548632bda97c28367fe1d929$all
Filter updated: Fri, 07 May 2021 12:12:56 UTC
2021-05-07 12:12:56 +00:00
||unef.edu.br/verify/step2.php$all
||unef.edu.br/verify/step3.php$all
Filter updated: Sat, 08 May 2021 00:06:32 UTC
2021-05-08 00:06:32 +00:00
||unef.edu.br/xec/ain/excelz/bizmail.php?email=&.rand=13vqcr8bp0gud&lc=1033&id=64855&mkt=en-us&cbcxt=mai&snsc=1$all
Filter updated: Tue, 17 Aug 2021 00:02:45 +0000
2021-08-17 00:02:45 +00:00
||unemploymentcenter.info$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||unfairworkaustralia.com.au$all
Filter updated: Thu, 03 Jun 2021 12:06:59 UTC
2021-06-03 12:07:00 +00:00
||uni0nbnkoffphsavign.serveuser.com$all
Filter updated: Sun, 11 Apr 2021 12:06:35 UTC
2021-04-11 12:06:35 +00:00
||unify.appbox.biz$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||unimaisfm.com.br$all
Filter updated: Sun, 19 Sep 2021 00:02:16 +0000
2021-09-19 00:02:17 +00:00
||unimentperu.uniment.org$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||unionheightsresidental.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||uniquesexygirls.net/cgi-bin/atc/out.cgi?id=19&u=http:/www.experiencebrettjackson.dreamhosters.com/wp-content/plugins/inc/.b6a0e0f97b98509200cbe8dc8a90813a/96478879526111436369212b881ee965/5efe4ee1cde8b3df84ef4dea939aa5b0/e4e1205f7238e90b308e29077e32e81a473fe78d/db43c8397d81b9af8eeefc39b3ce1d77aa6e7ad9/e3f74ab593863dfc0ac6cd4216b662149754a5ab/1c51f70a771f31724e803a541e6aa7ad1f412527/e4458c837adb31b10124b969de4c8f73b5be8c01/$all
Filter updated: Thu, 11 Mar 2021 00:09:12 UTC
2021-03-11 00:09:12 +00:00
||unisonsouthayr.org.uk$all
Filter updated: Wed, 22 Sep 2021 12:01:56 +0000
2021-09-22 12:01:56 +00:00
||uniswap-app.ielement.io$all
Filter updated: Thu, 05 Aug 2021 00:02:05 +0000
2021-08-05 00:02:05 +00:00
||uniswap.ch$all
Filter updated: Thu, 29 Jul 2021 00:01:57 +0000
2021-07-29 00:01:57 +00:00
||uniswap.deals$all
Filter updated: Fri, 23 Jul 2021 12:01:47 +0000
2021-07-23 12:01:47 +00:00
||uniswap.openwallet.dev$all
Filter updated: Tue, 27 Jul 2021 00:02:10 +0000
2021-07-27 00:02:10 +00:00
||uniswap.pages.dev$all
Filter updated: Thu, 29 Jul 2021 00:01:57 +0000
2021-07-29 00:01:57 +00:00
||uniswap.seal.finance$all
Filter updated: Wed, 25 Aug 2021 12:02:06 +0000
2021-08-25 12:02:07 +00:00
||uniswap.token.im$all
Filter updated: Tue, 27 Jul 2021 00:02:10 +0000
2021-07-27 00:02:10 +00:00
||uniswap.trading$all
Filter updated: Sun, 19 Sep 2021 00:02:16 +0000
2021-09-19 00:02:17 +00:00
||uniswap.tw$all
Filter updated: Sat, 13 Feb 2021 12:06:55 UTC
2021-02-13 12:06:55 +00:00
||uniswap.vn$all
Filter updated: Sat, 01 May 2021 12:06:37 UTC
2021-05-01 12:06:37 +00:00
||uniswapeth.net$all
Filter updated: Thu, 24 Jun 2021 00:06:35 +0000
2021-06-24 00:06:35 +00:00
||unitib.com/hu/lorincmeszarosnews$all
||unitib.com/hu/lorincmeszarosnews/$all
Filter updated: Tue, 21 Sep 2021 12:02:11 +0000
2021-09-21 12:02:11 +00:00
||unitus.mk.ua$all
Filter updated: Fri, 10 Sep 2021 00:02:17 +0000
2021-09-10 00:02:17 +00:00
||unlimitepharmacy.com$all
Filter updated: Tue, 12 Jan 2021 12:06:44 UTC
2021-01-12 12:06:44 +00:00
||unlock-suspension.com$all
Filter updated: Thu, 23 Sep 2021 00:02:18 +0000
2021-09-23 00:02:18 +00:00
||unm4sk-pt2.localserver.net$all
Filter updated: Tue, 16 Feb 2021 12:06:31 UTC
2021-02-16 12:06:31 +00:00
||unrecognisedpayeerequest.com/lloyds$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||unrecognisedpayeerequest.com/lloyds/login.php$all
Filter updated: Sun, 24 Jan 2021 12:06:45 UTC
2021-01-24 12:06:45 +00:00
||unregister-device-seclloyd.com$all
Filter updated: Tue, 23 Mar 2021 00:10:01 UTC
2021-03-23 00:10:01 +00:00
||unregpayee-lb.com$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||unsightlyirresponsibleerror.sugurit.repl.co$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||uofc-my.sharepoint.com/:b:/g/personal/arnuv_mayank1_ucalgary_ca/evgtz_pcletgonwkwyagc0wbkezwceoq_0hzi8h3ezxpnw$all
Filter updated: Sat, 11 Sep 2021 12:01:27 +0000
2021-09-11 12:01:27 +00:00
||upconcretepipe-my.sharepoint.com/personal/sdelaire_upconcretepipe_net/_layouts/15/doc.aspx?sourcedoc=%7b01466817-0a09-49f7-a646-12f1a7f04b1e%7d&action=default&slrid=454fdf9f-10c9-c000-5b23-b65ba66f4b23&originalpath=ahr0chm6ly91cgnvbmnyzxrlcglwzs1tes5zagfyzxbvaw50lmnvbs86bzovzy9wzxjzb25hbc9zzgvsywlyzv91cgnvbmnyzxrlcglwzv9uzxqvrwhkb1jnrupddmrkcgtzuzhhzndtedrcndc1bdv2bkhlamxsa25umwfllxvmzz9ydgltzt1rr2gxavrcutjvzw&cid=fc47738a-755f-4d0b-b2ae-453938c9b41a$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||update-1.mailfirewal.repl.co$all
Filter updated: Fri, 13 Aug 2021 00:01:48 +0000
2021-08-13 00:01:48 +00:00
||update-account-instagram.idigitalzone.com$all
Filter updated: Sun, 02 May 2021 00:06:30 UTC
2021-05-02 00:06:30 +00:00
||update-cyxhjas23qjhk.de$all
Filter updated: Fri, 30 Jul 2021 12:01:52 +0000
2021-07-30 12:01:52 +00:00
||update-officeinfo.finecashflow.com$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||update-walletasset.com/ronin$all
Filter updated: Sat, 13 Feb 2021 00:06:47 UTC
2021-02-13 00:06:47 +00:00
||update365online-secure.com$all
Filter updated: Tue, 19 Jan 2021 00:06:28 UTC
2021-01-19 00:06:28 +00:00
||updatemysantan.com$all
Filter updated: Tue, 01 Jun 2021 12:06:34 UTC
2021-06-01 12:06:34 +00:00
||updateseason.com$all
Filter updated: Sat, 11 Sep 2021 00:34:15 +0000
2021-09-11 00:34:15 +00:00
||updatevoda-billing.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||updted-access.demopage.co$all
Filter updated: Thu, 17 Jun 2021 00:06:32 +0000
2021-06-17 00:06:32 +00:00
||upgrade-25gb-email.alfaoneinfotech.net$all
Filter updated: Tue, 29 Jun 2021 00:01:48 +0000
2021-06-29 00:01:48 +00:00
||upgrade-25gb-email.thecornerstudio.com.au$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||uploads.codesandbox.io$all
Filter updated: Mon, 20 Sep 2021 12:02:05 +0000
2021-09-20 12:02:05 +00:00
||ups-onlinetracking.myastship.info$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||upscri.be/l4ucvi$all
Filter updated: Wed, 03 Feb 2021 00:06:20 UTC
2021-02-03 00:06:20 +00:00
||uqr.to/kr14?userid=1401523827$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||urbannetw45ork.ru/ujyhtgvfyhtgrvfcdsmay/next.php$all
Filter updated: Wed, 01 Sep 2021 12:01:58 +0000
2021-09-01 12:01:58 +00:00
||urbenorte.com$all
Filter updated: Sun, 14 Feb 2021 12:06:49 UTC
2021-02-14 12:06:49 +00:00
||urgent-halifaxlogin.com$all
Filter updated: Wed, 25 Aug 2021 00:01:57 +0000
2021-08-25 00:01:57 +00:00
||urlday.cc$all
Filter updated: Fri, 20 Aug 2021 12:01:48 +0000
2021-08-20 12:01:48 +00:00
||urlme.cc$all
Filter updated: Tue, 25 May 2021 12:06:34 UTC
2021-05-25 12:06:34 +00:00
||urlth.me$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||urlwee.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||urlz.fr/cbmp?0y=s0xwgzdgw1nekhohrmkkptrgjtjiijcootj1eujadhcpb7e5q8vbdox0zh6gjqgbbwl6pe007o3iylvjb9zluudsm0ohckjcxgf1xwwrzx33yf6$all
||urlz.fr/cbmp?b0y=ixziezoedgqp4x3dcttiovfvlgvwz5pyjnrk6zldj5qsbahkcalxkmrp4hg66nl0oegdhzbwkauqqpsasbddvvqhzzbm0pzkqtnzhwetosybf6z$all
||urlz.fr/cbmp?fu3r=nvmnwugybw81iq7gfcqsr29jfvkd4aeesnz8tdsiuzjlzkilseboqx3zu2r7sm8zew71keo2ugtmvjdv0t5sw6wek7o33xlhep3qonwegbfuiql$all
||urlz.fr/cbmp?lfd=djaslon8mlsyflzsegjpghhzikih86eiyhhoxrhjhs74e4bhhgbltmcwg0s1plbgettxgg1btiksqb7fbqipcgknazqohtchqlnwpkxaduml0am$all
||urlz.fr/cfxw?znqq?tco=w3a8wkqu$all
||urlz.fr/dfdu$all
||urlz.fr/dfsg$all
||urlz.fr/dhi5$all
||urlz.fr/dhxo$all
||urlz.fr/dqoq$all
||urlz.fr/dr7v$all
||urlz.fr/dwzw$all
||urlz.fr/dya0$all
||urlz.fr/dzin$all
Filter updated: Tue, 10 Nov 2020 12:06:43 UTC
2020-11-10 12:06:43 +00:00
||urlz.fr/eclu$all
Filter updated: Sun, 15 Nov 2020 12:06:42 UTC
2020-11-15 12:06:42 +00:00
||urlz.fr/ef96$all
Filter updated: Wed, 25 Nov 2020 00:06:21 UTC
2020-11-25 00:06:21 +00:00
||urlz.fr/ekkz$all
Filter updated: Wed, 16 Dec 2020 00:06:24 UTC
2020-12-16 00:06:24 +00:00
||urlz.fr/eu9x$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||urlz.fr/evyg$all
||urlz.fr/exvb$all
Filter updated: Fri, 09 Apr 2021 12:06:58 UTC
2021-04-09 12:06:58 +00:00
||urlz.fr/eztn$all
Filter updated: Sun, 28 Mar 2021 12:06:32 UTC
2021-03-28 12:06:32 +00:00
||urlz.fr/f0cd$all
Filter updated: Tue, 16 Mar 2021 12:06:41 UTC
2021-03-16 12:06:42 +00:00
||urlz.fr/f9nb$all
Filter updated: Sun, 21 Mar 2021 12:06:11 UTC
2021-03-21 12:06:11 +00:00
||urlz.fr/fbqd$all
Filter updated: Wed, 26 May 2021 12:06:39 UTC
2021-05-26 12:06:39 +00:00
||urlz.fr/fixz$all
||urlz.fr/fjc9$all
Filter updated: Wed, 14 Apr 2021 00:08:24 UTC
2021-04-14 00:08:24 +00:00
||urlz.fr/fnog$all
Filter updated: Sat, 03 Jul 2021 00:01:56 +0000
2021-07-03 00:01:56 +00:00
||urlz.fr/g2bd$all
Filter updated: Thu, 09 Sep 2021 00:01:56 +0000
2021-09-09 00:01:56 +00:00
||urusartuyu.byethost7.com$all
Filter updated: Fri, 24 Sep 2021 12:02:36 +0000
2021-09-24 12:02:36 +00:00
||us6.list-manage.com/survey?u=30dcf0671c07ea7995901ac2c&id=4ac0e6514c&attribution=false$all
Filter updated: Tue, 24 Aug 2021 12:02:00 +0000
2021-08-24 12:02:00 +00:00
||us6.list-manage.com/survey?u=a0de668519da12283a5dd2280&id=dcbef4991f&attribution=false&e=50fd152abb$all
Filter updated: Sun, 23 May 2021 00:06:33 UTC
2021-05-23 00:06:33 +00:00
||usaerrtyhui.blogspot.com$all
Filter updated: Sat, 11 Sep 2021 00:34:15 +0000
2021-09-11 00:34:15 +00:00
||usdtmarkets.com$all
Filter updated: Sat, 19 Dec 2020 00:06:42 UTC
2020-12-19 00:06:42 +00:00
||user-restore.com$all
Filter updated: Sat, 17 Jul 2021 12:01:37 +0000
2021-07-17 12:01:37 +00:00
||userreport01.byethost16.com$all
Filter updated: Sat, 21 Aug 2021 12:02:04 +0000
2021-08-21 12:02:04 +00:00
||users.tpg.com.au$all
Filter updated: Sat, 10 Jul 2021 00:01:42 +0000
2021-07-10 00:01:42 +00:00
||usps-delivery-support.logitel.com.au$all
Filter updated: Wed, 01 Sep 2021 12:01:58 +0000
2021-09-01 12:01:58 +00:00
||usps-tax-payment-track-id-928183921.logitel.com.au$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||usps2u.com$all
Filter updated: Sat, 12 Jun 2021 00:25:37 UTC
2021-06-12 00:25:37 +00:00
||usr.eaglecaravansaustralia.com.au$all
Filter updated: Sat, 09 Jan 2021 00:06:44 UTC
2021-01-09 00:06:44 +00:00
||utilizzamps.com$all
Filter updated: Thu, 23 Sep 2021 00:02:18 +0000
2021-09-23 00:02:18 +00:00
||uuid-validation.run-us-west2.goorm.io$all
Filter updated: Wed, 04 Aug 2021 00:02:10 +0000
2021-08-04 00:02:10 +00:00
||uuqcd6jmtq.stat-pulse.com$all
Filter updated: Thu, 23 Sep 2021 00:02:18 +0000
2021-09-23 00:02:18 +00:00
||uuuadoiy.ml$all
Filter updated: Mon, 16 Aug 2021 00:01:59 +0000
2021-08-16 00:01:59 +00:00
||uyafd.tk$all
Filter updated: Tue, 10 Aug 2021 00:01:49 +0000
2021-08-10 00:01:49 +00:00
||uytg.hyperphp.com$all
Filter updated: Thu, 22 Jul 2021 00:01:54 +0000
2021-07-22 00:01:54 +00:00
||uzaqztk7ovr.typeform.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||v.gd/eoauyu$all
||v.gd/ymvvn6$all
Filter updated: Mon, 26 Jul 2021 00:02:16 +0000
2021-07-26 00:02:17 +00:00
||v.ht/airdrop-v3$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||v.sys-mhlw.ga$all
||v.sys-mhlw.ml$all
||v.sys-mhlwgo.cf$all
Filter updated: Fri, 24 Sep 2021 12:02:36 +0000
2021-09-24 12:02:36 +00:00
||v2pancakeswap.info$all
Filter updated: Tue, 20 Apr 2021 00:06:42 UTC
2021-04-20 00:06:42 +00:00
||v7cf.gratishosting.cl$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||v7zrh.codesandbox.io$all
Filter updated: Tue, 19 Jan 2021 12:07:14 UTC
2021-01-19 12:07:14 +00:00
||vaikis.eu$all
Filter updated: Sun, 05 Sep 2021 00:02:15 +0000
2021-09-05 00:02:15 +00:00
||vakifiadem.b-cdn.net$all
Filter updated: Mon, 30 Aug 2021 12:01:50 +0000
2021-08-30 12:01:51 +00:00
||val-gardena.net/it/_islink.asp?url=26102549657133712.jijid.yoga$all
Filter updated: Fri, 12 Feb 2021 00:06:27 UTC
2021-02-12 00:06:27 +00:00
||valenteplay.com.br$all
Filter updated: Wed, 01 Sep 2021 12:01:58 +0000
2021-09-01 12:01:58 +00:00
||validacaixa2.blob.core.windows.net$all
Filter updated: Mon, 25 Jan 2021 12:06:29 UTC
2021-01-25 12:06:29 +00:00
||validate-onlinesecurity.com$all
Filter updated: Fri, 05 Feb 2021 12:06:59 UTC
2021-02-05 12:06:59 +00:00
||validation-newpayee.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||validationsystem.creatorlink.net$all
Filter updated: Sun, 29 Aug 2021 00:01:50 +0000
2021-08-29 00:01:51 +00:00
||validtion-accts131sd.ml$all
Filter updated: Mon, 02 Aug 2021 12:01:44 +0000
2021-08-02 12:01:44 +00:00
||valocsfunes.ga$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||vanmarckegroup-my.sharepoint.com$all
Filter updated: Sat, 12 Sep 2020 12:06:46 UTC
2020-09-12 12:06:46 +00:00
||vanvleetfamilyfarm.com$all
Filter updated: Sat, 10 Jul 2021 12:01:35 +0000
2021-07-10 12:01:35 +00:00
||vaoas.cc$all
Filter updated: Wed, 02 Jun 2021 12:06:27 UTC
2021-06-02 12:06:28 +00:00
||vassallo.com.ar$all
Filter updated: Sat, 18 Sep 2021 00:14:48 +0000
2021-09-18 00:14:48 +00:00
||vcpjo.weblium.site$all
Filter updated: Sun, 19 Sep 2021 00:02:16 +0000
2021-09-19 00:02:17 +00:00
||vechainthorconnects.net$all
Filter updated: Thu, 08 Apr 2021 00:06:59 UTC
2021-04-08 00:06:59 +00:00
||vegas-x.net$all
Filter updated: Tue, 24 Aug 2021 00:02:23 +0000
2021-08-24 00:02:24 +00:00
||vegemil.vn$all
Filter updated: Tue, 14 Sep 2021 00:01:48 +0000
2021-09-14 00:01:48 +00:00
||vehicam.com$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||veja-pl.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||vellingekommun-my.sharepoint.com/:o:/g/personal/karin_strand_vellinge_se/egyldcpw7zzet71gx887vwobrnhahqfmwqw5rejh4cib9a?e=sdoqrc$all
||velvet.by/drupal-7.56/scripts/bp$all
||velvet.by/drupal-7.56/scripts/bp/$all
||velvet.by/drupal-7.56/scripts/bp/2277e0f3c4c5c98e848c0e64d76d6fb5/$all
||velvet.by/drupal-7.56/scripts/bp/d03ef074f8887403b084d613916df607/$all
||velvet.by/drupal-7.56/scripts/bp/d4810797ed4ec28eeb047934428f14a1/$all
Filter updated: Thu, 19 Aug 2021 00:01:47 +0000
2021-08-19 00:01:47 +00:00
||velvish.com$all
Filter updated: Sun, 23 May 2021 12:06:28 UTC
2021-05-23 12:06:28 +00:00
||vendorcmdecport.vzpla.net$all
Filter updated: Tue, 31 Aug 2021 00:01:55 +0000
2021-08-31 00:01:55 +00:00
||verfication.verifyuser.ru$all
Filter updated: Mon, 11 Jan 2021 12:06:44 UTC
2021-01-11 12:06:44 +00:00
||verfiz.me$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||verif-loginrbc.web.app$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||verifica-titolare-mpsdispositivo.com$all
Filter updated: Wed, 26 May 2021 00:06:29 UTC
2021-05-26 00:06:29 +00:00
||verificar-7482376.vzpla.net$all
Filter updated: Sun, 11 Apr 2021 12:06:35 UTC
2021-04-11 12:06:35 +00:00
||verification-orange0.yolasite.com$all
Filter updated: Sun, 06 Jun 2021 00:06:22 UTC
2021-06-06 00:06:22 +00:00
||verification.page.home.support.app-netflix.com.mavhcodigital.com$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||verificationinfo03huntington.otzo.com/secure/mlogin2.html$all
Filter updated: Sun, 11 Oct 2020 12:06:44 UTC
2020-10-11 12:06:44 +00:00
||verificationmessage.blob.core.windows.net$all
Filter updated: Thu, 16 Sep 2021 00:01:52 +0000
2021-09-16 00:01:52 +00:00
||verifikasi-akun-anda0011.weeblysite.com$all
||verifikasi-akun-facebook0022.weeblysite.com$all
Filter updated: Thu, 09 Sep 2021 00:01:56 +0000
2021-09-09 00:01:56 +00:00
||verifikasi-identitas-co-id24.webnode.com$all
Filter updated: Fri, 06 Aug 2021 00:01:52 +0000
2021-08-06 00:01:52 +00:00
||verifiyedbluetickfeedback.ml$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||verify.chase.billing.info.igualdad.cl$all
Filter updated: Tue, 17 Aug 2021 12:01:39 +0000
2021-08-17 12:01:39 +00:00
||verify.paypal-help-service.com$all
Filter updated: Wed, 28 Jul 2021 12:01:46 +0000
2021-07-28 12:01:46 +00:00
||verify.session-id.com$all
Filter updated: Tue, 12 Jan 2021 00:06:08 UTC
2021-01-12 00:06:08 +00:00
||verifymytransfer.com$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||verifywell-85477.web.app$all
Filter updated: Thu, 23 Sep 2021 00:02:18 +0000
2021-09-23 00:02:18 +00:00
||verifyyourinfo.thebasketballfactoryinc.com$all
Filter updated: Tue, 07 Sep 2021 00:01:46 +0000
2021-09-07 00:01:46 +00:00
||verikasi-account2021.weebly.com$all
Filter updated: Fri, 24 Sep 2021 00:01:50 +0000
2021-09-24 00:01:51 +00:00
||vermmtb.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||vertiblau.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||verzeichnisse.creatorlink.net$all
Filter updated: Tue, 17 Aug 2021 12:01:39 +0000
2021-08-17 12:01:39 +00:00
||vestacommercialinc.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||vevobahis211.blogspot.com$all
||vevobahisbet.blogspot.com$all
||vevobahisgirissite.blogspot.com$all
||vevobahisgunceladres.blogspot.com$all
||vevobahisimgir.blogspot.com$all
||vevobahiss.blogspot.com$all
||vevobahiss1.blogspot.com$all
||vevobahissgir.blogspot.com$all
||vevobahissguncel.blogspot.com$all
||vevobahsgirisim.blogspot.com$all
||vevoobahis.blogspot.com$all
Filter updated: Tue, 29 Jun 2021 12:02:07 +0000
2021-06-29 12:02:07 +00:00
||vfr1.22web.org$all
Filter updated: Mon, 28 Dec 2020 12:06:19 UTC
2020-12-28 12:06:19 +00:00
||vhs.link$all
Filter updated: Wed, 01 Sep 2021 00:02:20 +0000
2021-09-01 00:02:20 +00:00
||viabcp-seguro.xyz$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||viamionline.com$all
Filter updated: Mon, 15 Mar 2021 12:43:24 UTC
2021-03-15 12:43:24 +00:00
||viamobte.blogspot.com/2021/03/blog-post.html$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||vibrant-perlman.23-94-190-112.plesk.page$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||vices.eu$all
Filter updated: Mon, 23 Aug 2021 00:01:47 +0000
2021-08-23 00:01:47 +00:00
||victorarath99.github.io$all
Filter updated: Mon, 06 Sep 2021 00:01:54 +0000
2021-09-06 00:01:54 +00:00
||vidco.dotcompal.co$all
Filter updated: Sun, 24 Jan 2021 00:06:54 UTC
2021-01-24 00:06:54 +00:00
||videobigo.com$all
Filter updated: Tue, 01 Jun 2021 12:06:34 UTC
2021-06-01 12:06:34 +00:00
||videowatchviral.blogspot.com$all
Filter updated: Thu, 23 Sep 2021 00:02:18 +0000
2021-09-23 00:02:18 +00:00
||vidio-12.duckdns.org$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||vidmova.xyz$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||vieni-immo.pl$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||vietschi.de$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||viettel-com-dot-c2c01-531c7.uc.r.appspot.com$all
Filter updated: Mon, 23 Aug 2021 12:02:18 +0000
2021-08-23 12:02:19 +00:00
||vikingwear.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||vilanovacenter.com$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||vinahay.com$all
Filter updated: Thu, 23 Sep 2021 00:02:18 +0000
2021-09-23 00:02:18 +00:00
||vincicash.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||violatesolutioncenter.com$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||vipbillspaymentcenternegosyo.com$all
Filter updated: Fri, 20 Aug 2021 12:01:48 +0000
2021-08-20 12:01:48 +00:00
||vipfbtools.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||vipmaterialpubg.com$all
||vir4lvideo-laginganuuu.duckdns.org$all
Filter updated: Tue, 21 Sep 2021 12:02:11 +0000
2021-09-21 12:02:11 +00:00
||virii-my-mtb.com$all
Filter updated: Tue, 30 Mar 2021 12:06:32 UTC
2021-03-30 12:06:33 +00:00
||virtual1dattss.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||virtualbank08.webcindario.com$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||virtuarbnc.000webhostapp.com$all
Filter updated: Sat, 17 Jul 2021 00:01:47 +0000
2021-07-17 00:01:47 +00:00
||vis-stort.github.io$all
Filter updated: Sat, 30 Jan 2021 12:06:39 UTC
2021-01-30 12:06:39 +00:00
||visadpsgiftcard.com$all
Filter updated: Fri, 23 Jul 2021 12:01:47 +0000
2021-07-23 12:01:47 +00:00
||visawingsoverseas.com$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||vishwakrupasteelindustries.com$all
Filter updated: Thu, 24 Dec 2020 12:06:14 UTC
2020-12-24 12:06:14 +00:00
||visione.co.id$all
Filter updated: Thu, 02 Sep 2021 12:02:02 +0000
2021-09-02 12:02:02 +00:00
||visualspider.top$all
Filter updated: Wed, 22 Sep 2021 12:01:56 +0000
2021-09-22 12:01:56 +00:00
||viuii.cn$all
Filter updated: Thu, 11 Feb 2021 12:07:21 UTC
2021-02-11 12:07:21 +00:00
||vivaanadventure.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||viviend.supernova-desarrollo.com$all
Filter updated: Thu, 16 Sep 2021 00:01:52 +0000
2021-09-16 00:01:52 +00:00
||vivocrm.ru$all
Filter updated: Thu, 23 Sep 2021 00:02:18 +0000
2021-09-23 00:02:18 +00:00
||vk-coolsgirl.ru$all
||vk-dreamsgirls.ru$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||vk.cc/9mjize$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||vk.com/away.php?to=http%3a%2f%2f13.77.220.204?key=a8umj$all
Filter updated: Tue, 21 Sep 2021 12:02:11 +0000
2021-09-21 12:02:11 +00:00
||vk.com/away.php?to=http%3a%2f%2f20.90.154.8/asu1$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||vk.com/away.php?to=http%3a%2f%2frajeshkhanal.com.np%2fwp-config.php&post=521188519_100&cc_key=$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||vk.com/away.php?to=http%3a%2f%2frois-zkxzx.run.goorm.io/safe-browser/$all
Filter updated: Wed, 08 Sep 2021 00:02:08 +0000
2021-09-08 00:02:08 +00:00
||vlces.runescape.com-oa.ru$all
Filter updated: Wed, 03 Mar 2021 00:08:05 UTC
2021-03-03 00:08:05 +00:00
||vmi454420.contaboserver.net$all
Filter updated: Thu, 08 Jul 2021 00:02:02 +0000
2021-07-08 00:02:02 +00:00
||vmospi111.freecluster.eu$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||vocal-esp.yolasite.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||vocal-sfr1.yolasite.com$all
Filter updated: Sat, 28 Nov 2020 00:06:06 UTC
2020-11-28 00:06:06 +00:00
||vocalcoachingbysloane.com$all
Filter updated: Wed, 28 Apr 2021 00:06:29 UTC
2021-04-28 00:06:29 +00:00
||vodafone.bill1820.com$all
Filter updated: Sat, 03 Oct 2020 00:06:51 UTC
2020-10-03 00:06:51 +00:00
||vodafonenotice.com$all
Filter updated: Thu, 26 Nov 2020 00:06:18 UTC
2020-11-26 00:06:18 +00:00
||vodafonenotice.com/banks/firstdirect.com/$all
Filter updated: Mon, 02 Aug 2021 00:02:18 +0000
2021-08-02 00:02:18 +00:00
||vodaupdatepayment.com$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||vodrenelmi.temp.swtest.ru$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||voed.ru$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||voipza.co.za$all
Filter updated: Fri, 24 Sep 2021 00:01:50 +0000
2021-09-24 00:01:51 +00:00
||voiture.in$all
Filter updated: Tue, 24 Aug 2021 12:02:00 +0000
2021-08-24 12:02:00 +00:00
||volvocarskc.us1.list-manage.com$all
Filter updated: Tue, 18 May 2021 00:06:34 UTC
2021-05-18 00:06:34 +00:00
||votre.service.client.forfait.orange.mobile.travelforever.co.uk$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||votrec0nsultationonlineboxclient.company.site$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||votreservi.temp.swtest.ru$all
||vozdeangola.com$all
Filter updated: Sun, 21 Mar 2021 12:06:11 UTC
2021-03-21 12:06:11 +00:00
||vpapara.com$all
Filter updated: Tue, 20 Jul 2021 00:01:58 +0000
2021-07-20 00:01:58 +00:00
||vps41123.inmotionhosting.com$all
Filter updated: Thu, 09 Sep 2021 00:01:56 +0000
2021-09-09 00:01:56 +00:00
||vqfeglpgsyvybmxptlirriqqvn-dot-goff039302032323.rj.r.appspot.com$all
Filter updated: Wed, 04 Aug 2021 00:02:10 +0000
2021-08-04 00:02:10 +00:00
||vqs.org.au$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||vrbankingg.me$all
Filter updated: Tue, 13 Jul 2021 00:02:30 +0000
2021-07-13 00:02:30 +00:00
||vrbe.in$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||vt3pa0.webwave.dev$all
||vtennis.vn$all
||vtxmail2018.myfreesites.net$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||vtxmailkonto.weebly.com$all
Filter updated: Thu, 08 Jul 2021 00:02:02 +0000
2021-07-08 00:02:02 +00:00
||vurl.bz$all
Filter updated: Fri, 17 Sep 2021 00:01:45 +0000
2021-09-17 00:01:46 +00:00
||vvpees-me-index.chskkh.cn$all
Filter updated: Sun, 19 Sep 2021 00:02:16 +0000
2021-09-19 00:02:17 +00:00
||vvpees-me-index.glqfr40.cn$all
Filter updated: Sun, 19 Sep 2021 12:01:34 +0000
2021-09-19 12:01:35 +00:00
||vvpees-me-index.gsy8nvc.cn$all
Filter updated: Sun, 19 Sep 2021 00:02:16 +0000
2021-09-19 00:02:17 +00:00
||vvpees-me-index.hw31g0.cn$all
||vvpees-me-index.j5vz2e0.cn$all
||vvpees-me-index.jsekzbo.cn$all
||vvpees-me-index.khtllo.cn$all
||vvpees-me-index.kq3i0u4.cn$all
||vvpees-me-index.la0adf.cn$all
||vvpees-me-index.lpwsv6.cn$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||vwbank.inforia.net$all
Filter updated: Wed, 15 Sep 2021 00:01:54 +0000
2021-09-15 00:01:55 +00:00
||vwvvbcpi-zonasegura.com$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||vwwviabcp.solicitudalnstante1.com$all
Filter updated: Mon, 16 Aug 2021 00:01:59 +0000
2021-08-16 00:01:59 +00:00
||vxdse.myfreesites.net$all
Filter updated: Fri, 16 Jul 2021 00:01:53 +0000
2021-07-16 00:01:53 +00:00
||vxmu688484.byethost7.com$all
Filter updated: Fri, 11 Jun 2021 00:06:40 UTC
2021-06-11 00:06:40 +00:00
||vyixwx.webwave.dev$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||vzrew.creatorlink.net$all
Filter updated: Thu, 29 Jul 2021 00:01:57 +0000
2021-07-29 00:01:57 +00:00
||vzuywafijlrpvnjtzqxkbnjoif-dot-gowa11111111.rj.r.appspot.com$all
Filter updated: Wed, 22 Sep 2021 00:02:26 +0000
2021-09-22 00:02:26 +00:00
||w01292112a.000webhostapp.com$all
Filter updated: Fri, 04 Jun 2021 12:07:04 UTC
2021-06-04 12:07:04 +00:00
||w2.deraya.org$all
Filter updated: Tue, 14 Sep 2021 12:01:44 +0000
2021-09-14 12:01:44 +00:00
||w2fshop.com.br$all
Filter updated: Thu, 27 May 2021 00:06:23 UTC
2021-05-27 00:06:23 +00:00
||w352883-www.fnweb.no$all
||w352885-www.fnweb.no$all
Filter updated: Mon, 12 Apr 2021 12:08:04 UTC
2021-04-12 12:08:04 +00:00
||w3max.com$all
Filter updated: Thu, 18 Feb 2021 12:07:12 UTC
2021-02-18 12:07:12 +00:00
||w5czf.csb.app$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||w6634s.webwave.dev$all
Filter updated: Thu, 16 Sep 2021 12:02:15 +0000
2021-09-16 12:02:15 +00:00
||w915f.achievementeffort.xyz$all
Filter updated: Sun, 19 Sep 2021 12:01:34 +0000
2021-09-19 12:01:35 +00:00
||w915f.honestyfavorite.xyz$all
Filter updated: Fri, 24 Sep 2021 12:02:36 +0000
2021-09-24 12:02:36 +00:00
||w915f.significantparalysis.xyz$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||wa-grupdewasa2021.duckdns.org$all
Filter updated: Sun, 22 Aug 2021 12:01:41 +0000
2021-08-22 12:01:41 +00:00
||wagrupnotnot8.duckdns.org$all
Filter updated: Mon, 06 Sep 2021 00:01:54 +0000
2021-09-06 00:01:54 +00:00
||wahed-koudsi2001.github.io$all
Filter updated: Tue, 21 Sep 2021 00:01:40 +0000
2021-09-21 00:01:40 +00:00
||waisterase.com$all
Filter updated: Sat, 11 Sep 2021 00:34:15 +0000
2021-09-11 00:34:15 +00:00
||wallawallaguardian.com$all
Filter updated: Wed, 08 Sep 2021 12:01:51 +0000
2021-09-08 12:01:51 +00:00
||walldesign.com.tr$all
Filter updated: Wed, 04 Aug 2021 00:02:10 +0000
2021-08-04 00:02:10 +00:00
||wallectconnect.co$all
Filter updated: Mon, 26 Jul 2021 00:02:16 +0000
2021-07-26 00:02:17 +00:00
||wallet-mymanero.com$all
Filter updated: Sun, 19 Sep 2021 00:02:16 +0000
2021-09-19 00:02:17 +00:00
||wallets-synchronise.com$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||walletupdating.com$all
Filter updated: Mon, 30 Aug 2021 00:02:03 +0000
2021-08-30 00:02:03 +00:00
||walletxcons.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||wallieget.com/8jdu/sb6/index.php?_$all
||wallieget.com/8jdu/sb6/index.php?_&_$all
Filter updated: Mon, 12 Jul 2021 00:01:55 +0000
2021-07-12 00:01:55 +00:00
||wallieget.com/8jdu/sb6/index.php?_&_&_$all
Filter updated: Thu, 19 Aug 2021 12:02:33 +0000
2021-08-19 12:02:33 +00:00
||wana78420.myfreesites.net$all
Filter updated: Fri, 27 Aug 2021 00:01:47 +0000
2021-08-27 00:01:47 +00:00
||wapiae.com.ar$all
Filter updated: Mon, 06 Sep 2021 12:01:50 +0000
2021-09-06 12:01:50 +00:00
||warmbuyer.xyz$all
Filter updated: Sun, 11 Apr 2021 12:06:35 UTC
2021-04-11 12:06:35 +00:00
||warningshadows.org$all
Filter updated: Sun, 18 Jul 2021 00:02:04 +0000
2021-07-18 00:02:04 +00:00
||warpromerica.byethost33.com$all
Filter updated: Wed, 14 Apr 2021 00:08:24 UTC
2021-04-14 00:08:24 +00:00
||warriorplus.com/o2/a/f5s4y/0$all
Filter updated: Tue, 31 Aug 2021 00:01:55 +0000
2021-08-31 00:01:55 +00:00
||watan99.com$all
Filter updated: Fri, 17 Sep 2021 12:01:51 +0000
2021-09-17 12:01:52 +00:00
||watchlove.michaelkorsoutlet2u.cn$all
Filter updated: Thu, 29 Jul 2021 00:01:57 +0000
2021-07-29 00:01:57 +00:00
||watermelonineasterhay.com$all
Filter updated: Tue, 13 Apr 2021 12:07:03 UTC
2021-04-13 12:07:03 +00:00
||watsontruck-my.sharepoint.com/:w:/p/fsmith/eaquumvjy5bahivo2ewv-6ebebnpl4k8qd6onbtt3c-sgw?e=rzivtb$all
Filter updated: Sat, 11 Sep 2021 00:34:15 +0000
2021-09-11 00:34:15 +00:00
||waycacoke.com$all
Filter updated: Tue, 14 Sep 2021 00:01:48 +0000
2021-09-14 00:01:48 +00:00
||waycoklked.com$all
Filter updated: Tue, 29 Jun 2021 12:02:07 +0000
2021-06-29 12:02:07 +00:00
||wazefornay.byethost16.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||wb-technologies.com$all
Filter updated: Thu, 20 May 2021 00:06:43 UTC
2021-05-20 00:06:44 +00:00
||wdjtyhmlvglzqrqmtmhf.rockcoastclothing.com$all
Filter updated: Tue, 07 Sep 2021 12:01:49 +0000
2021-09-07 12:01:49 +00:00
||we-are.team$all
Filter updated: Fri, 27 Aug 2021 12:01:40 +0000
2021-08-27 12:01:40 +00:00
||weaponoil.top$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||wearabletechtogo.com$all
Filter updated: Sun, 07 Feb 2021 00:06:51 UTC
2021-02-07 00:06:51 +00:00
||weaveessentialgoodness.cloud$all
Filter updated: Thu, 14 Jan 2021 12:06:32 UTC
2021-01-14 12:06:32 +00:00
||web-armas.royale-freefire1garena-bonus.com$all
Filter updated: Thu, 03 Sep 2020 12:06:37 UTC
2020-09-03 12:06:37 +00:00
||web-rechungbetrag-domain.de$all
Filter updated: Fri, 02 Jul 2021 12:01:53 +0000
2021-07-02 12:01:53 +00:00
||web-santander.byethost31.com$all
Filter updated: Thu, 01 Apr 2021 00:06:39 UTC
2021-04-01 00:06:40 +00:00
||web.bredbanque.trans.sylog.co$all
Filter updated: Thu, 14 Jan 2021 12:06:32 UTC
2021-01-14 12:06:32 +00:00
||web.royale-freefire1garena-bonus.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||web1-cpn.biz.net.id$all
Filter updated: Thu, 03 Sep 2020 12:06:37 UTC
2020-09-03 12:06:37 +00:00
||web1577.webbox444.server-home.org$all
Filter updated: Fri, 06 Aug 2021 00:01:52 +0000
2021-08-06 00:01:52 +00:00
||web2-edu-online.ru$all
Filter updated: Tue, 21 Sep 2021 12:02:11 +0000
2021-09-21 12:02:11 +00:00
||web6442.web07.bero-webspace.de$all
Filter updated: Sun, 15 Aug 2021 00:01:57 +0000
2021-08-15 00:01:57 +00:00
||webagricoapp.byethost5.com$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||webbacpichi.byethost14.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||webbbb.yolasite.com$all
Filter updated: Fri, 27 Aug 2021 12:01:40 +0000
2021-08-27 12:01:40 +00:00
||webcentrinim.wapka.website$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||webdatamltrainingdiag842.blob.core.windows.net$all
Filter updated: Wed, 15 Sep 2021 00:01:54 +0000
2021-09-15 00:01:55 +00:00
||webdisk.granadoemurahara.com.br$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||webexert.com$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||webexoduspro.com$all
Filter updated: Tue, 29 Jun 2021 12:02:07 +0000
2021-06-29 12:02:07 +00:00
||webfamily.com.br$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||webfiddle.net$all
Filter updated: Thu, 27 May 2021 00:06:23 UTC
2021-05-27 00:06:23 +00:00
||webgaliciatxt.ihostfull.com$all
Filter updated: Fri, 21 May 2021 00:06:36 UTC
2021-05-21 00:06:36 +00:00
||webhostingbingo.com$all
Filter updated: Wed, 04 Aug 2021 00:02:10 +0000
2021-08-04 00:02:10 +00:00
||webintersol.com$all
Filter updated: Tue, 21 Sep 2021 00:01:40 +0000
2021-09-21 00:01:40 +00:00
||webm1al.fromewill.cf$all
Filter updated: Wed, 16 Jun 2021 12:06:46 +0000
2021-06-16 12:06:46 +00:00
||webmail-2aaa0.web.app$all
Filter updated: Thu, 05 Aug 2021 00:02:05 +0000
2021-08-05 00:02:05 +00:00
||webmail-e174d.web.app$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||webmail-mimecast-verify123247876i244.s3.us-west-002.backblazeb2.com$all
Filter updated: Tue, 19 Jan 2021 00:06:28 UTC
2021-01-19 00:06:28 +00:00
||webmail-sso8uyg.web.app$all
Filter updated: Thu, 23 Sep 2021 00:02:18 +0000
2021-09-23 00:02:18 +00:00
||webmail.appemdobro.com$all
||webmail.nitelifebuzz.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||webmail.njea.org$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||webmail.serviceunit.co.uk/upgrade/$all
Filter updated: Tue, 02 Feb 2021 00:22:14 UTC
2021-02-02 00:22:15 +00:00
||webmail.telephone-sfr.com$all
Filter updated: Thu, 02 Sep 2021 12:02:02 +0000
2021-09-02 12:02:02 +00:00
||webmail.webapps-espclient.com$all
Filter updated: Thu, 03 Sep 2020 12:06:37 UTC
2020-09-03 12:06:37 +00:00
||webmailadmin0.myfreesites.net$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||webmall.updatethejpamazon.top$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||weboutlookstorageaccess.activehosted.com$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||webpromerica.webcindario.com$all
Filter updated: Thu, 11 Feb 2021 00:06:15 UTC
2021-02-11 00:06:15 +00:00
||webservicocef.com$all
Filter updated: Wed, 15 Sep 2021 12:01:46 +0000
2021-09-15 12:01:46 +00:00
||website--355347865560300265249-bank.business.site$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||websitebouwen.net$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||webstories.eu$all
Filter updated: Sun, 09 May 2021 00:07:04 UTC
2021-05-09 00:07:04 +00:00
||webuyworkshopequipment.com/wp-content/themes/sketch/js/sf_trash/c45b222914e3c78d$all
Filter updated: Sun, 09 May 2021 12:06:22 UTC
2021-05-09 12:06:22 +00:00
||webuyworkshopequipment.com/wp-content/themes/sketch/js/sf_trash/c45b222914e3c78d/$all
Filter updated: Sat, 13 Feb 2021 00:06:47 UTC
2021-02-13 00:06:47 +00:00
||wecluihfrf-76tygh.web.app$all
Filter updated: Thu, 16 Sep 2021 12:02:15 +0000
2021-09-16 12:02:15 +00:00
||wecr470d90e2b1ca04d07fe2a5308245c2ec.cloudns.nz$all
Filter updated: Fri, 09 Jul 2021 00:01:59 +0000
2021-07-09 00:01:59 +00:00
||wedbancaonline.byethost13.com$all
Filter updated: Fri, 27 Aug 2021 00:01:47 +0000
2021-08-27 00:01:47 +00:00
||weddingknock.top$all
Filter updated: Sat, 01 May 2021 00:08:55 UTC
2021-05-01 00:08:55 +00:00
||weddingstaffcompanies.com$all
Filter updated: Tue, 31 Aug 2021 12:01:54 +0000
2021-08-31 12:01:54 +00:00
||welcometospringfieldmo.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||wellingtoncloud-my.sharepoint.com/personal/lynne_barron_eaglehouseschool_com/_layouts/15/wopiframe.aspx?guestaccesstoken=5r%2fl6nh%2bt0nfkb7xwynvz8n1wumz0wz%2fpwkgri5p6%2fs%3d&docid=1_192cb7c38faeb476cb58ce8f71598361c&wdformid=%7b3e42bd82%2db59e%2d403b%2d9998%2d0c2dd21bd5e6%7d&action=formsubmit$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||wellsfargo-help-center.com$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||wellsfargos.aicsolutions.co.za$all
Filter updated: Mon, 06 Sep 2021 00:01:54 +0000
2021-09-06 00:01:54 +00:00
||wessex.fr$all
Filter updated: Mon, 06 Sep 2021 12:01:50 +0000
2021-09-06 12:01:50 +00:00
||westernpapersl.com$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||westete.xyz$all
Filter updated: Fri, 10 Sep 2021 00:02:17 +0000
2021-09-10 00:02:17 +00:00
||westpaclimited.com$all
Filter updated: Thu, 04 Feb 2021 12:06:49 UTC
2021-02-04 12:06:49 +00:00
||westportvillagegallery.com$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||wetra.4632.giov.swanngonorthwestregion.cf$all
Filter updated: Tue, 07 Sep 2021 00:01:46 +0000
2021-09-07 00:01:46 +00:00
||wetransfer-view-documentonline.yolasite.com$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||weuanine.com$all
Filter updated: Sat, 19 Jun 2021 00:06:27 +0000
2021-06-19 00:06:27 +00:00
||wewtraders.com$all
Filter updated: Tue, 14 Sep 2021 12:01:44 +0000
2021-09-14 12:01:44 +00:00
||wgcommunities.com$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||whatepouhill.byethost15.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||whatsap-join-grup-viral.duckdns.org$all
||whatsap-join16.duckdns.org$all
Filter updated: Thu, 10 Sep 2020 12:06:46 UTC
2020-09-10 12:06:46 +00:00
||whatsapp-18.ikwb.com$all
Filter updated: Thu, 05 Aug 2021 12:01:57 +0000
2021-08-05 12:01:57 +00:00
||whatsapp-clone-teamwork.firebaseapp.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||whatsapp-grubsx1.zzux.com$all
Filter updated: Tue, 29 Jun 2021 12:02:07 +0000
2021-06-29 12:02:07 +00:00
||whatsapp.blazagency.com$all
Filter updated: Thu, 03 Sep 2020 12:06:37 UTC
2020-09-03 12:06:37 +00:00
||whatsapp18girl.4pu.com$all
||whatsapps.instanthq.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||whatsapps.mrslove.com$all
||whattsapps.misecure.com$all
Filter updated: Fri, 30 Jul 2021 12:01:52 +0000
2021-07-30 12:01:52 +00:00
||whdlvjebkwgoblxjtluhurnjnj-dot-gowa11111111.rj.r.appspot.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||whitefordkenworth-my.sharepoint.com/personal/bwalters_lglk_com/_layouts/15/doc.aspx?sourcedoc={1d96cb1e-0031-41b8-8774-24bb2f7c4caa}&action=default&slrid=9ebb659f-7054-a000-b19b-7cb962889fc8&originalpath=ahr0chm6ly93agl0zwzvcmrrzw53b3j0ac1tes5zagfyzxbvaw50lmnvbs86bzovzy9wzxjzb25hbc9id2fsdgvyc19sz2xrx2nvbs9faddmbggweefmaejom1frdxk5ofrlb0jpn09poghoxzd0dfzfcw56wwr1yknbp3j0aw1lpvn3cwtevjhumkvn&cid=2ae6d679-a1b4-4b0f-a76a-46e32d437c42$all
Filter updated: Wed, 16 Jun 2021 00:06:45 +0000
2021-06-16 00:06:45 +00:00
||whitelist-network.com$all
Filter updated: Thu, 28 Jan 2021 00:06:21 UTC
2021-01-28 00:06:21 +00:00
||whoisnooey.com$all
Filter updated: Fri, 17 Sep 2021 00:01:45 +0000
2021-09-17 00:01:46 +00:00
||whtaiseoigcoolgoiuerlkjgodlaeg.xyz$all
Filter updated: Mon, 06 Sep 2021 00:01:54 +0000
2021-09-06 00:01:54 +00:00
||widadkamillah.github.io$all
Filter updated: Sun, 19 Sep 2021 00:02:16 +0000
2021-09-19 00:02:17 +00:00
||widesdays.com$all
Filter updated: Fri, 22 Jan 2021 00:06:31 UTC
2021-01-22 00:06:31 +00:00
||wifi.retinad.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||wikiarch.cz$all
Filter updated: Tue, 11 May 2021 00:06:39 UTC
2021-05-11 00:06:40 +00:00
||wildcard.streamsteam.ca$all
Filter updated: Mon, 16 Aug 2021 00:01:59 +0000
2021-08-16 00:01:59 +00:00
||wildcard.tv1space.az$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||williamquilan.fr$all
Filter updated: Thu, 26 Aug 2021 00:02:01 +0000
2021-08-26 00:02:01 +00:00
||williamscocrimestoppers.org$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||willingruralprolog.bobaw87301.repl.co$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||willmasters.org.uk$all
Filter updated: Tue, 01 Dec 2020 00:06:31 UTC
2020-12-01 00:06:31 +00:00
||willtoaccssnowand.cf$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||wilsonvaluation602-my.sharepoint.com/:o:/g/personal/brian_wilsonvaluation_com/evgzsh2f49natji6i_lnklcbz46ledpzwpckxs6jgi7zmw?e=un6z$all
Filter updated: Sat, 28 Aug 2021 12:01:47 +0000
2021-08-28 12:01:47 +00:00
||wimracttus.com$all
Filter updated: Fri, 17 Sep 2021 12:01:51 +0000
2021-09-17 12:01:52 +00:00
||win720.top$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||windocyte.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||windowshost404902.s3-ap-southeast-1.amazonaws.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||winfreyandco-my.sharepoint.com/:o:/g/personal/brandon_wincodc_com/esxchyyuht1diztxkz0fzm8boma-_ssknhdzjbh7xexnxa?e=vapt5b$all
Filter updated: Thu, 09 Sep 2021 00:01:56 +0000
2021-09-09 00:01:56 +00:00
||winville.biz$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||wireconfirmation68c10a25442a3e13.blogspot.com$all
Filter updated: Wed, 13 Jan 2021 12:06:45 UTC
2021-01-13 12:06:45 +00:00
||wires-business-starter.webflow.io$all
Filter updated: Wed, 10 Mar 2021 00:08:04 UTC
2021-03-10 00:08:05 +00:00
||wirtschaft.baesweiler.de$all
Filter updated: Sun, 07 Feb 2021 00:06:51 UTC
2021-02-07 00:06:51 +00:00
||wisconsin-dmv-mv3001.com$all
Filter updated: Thu, 23 Sep 2021 00:02:18 +0000
2021-09-23 00:02:18 +00:00
||with.ddnsking.com$all
Filter updated: Wed, 15 Sep 2021 00:01:54 +0000
2021-09-15 00:01:55 +00:00
||withkoji.com/@coxupdate78$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||withyoumall.updatethejpamazon.work$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||wivapeur.com$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||wj2vltyze29.typeform.com$all
Filter updated: Sun, 15 Aug 2021 00:01:57 +0000
2021-08-15 00:01:57 +00:00
||wkazisan.github.io$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||wlnsna.top$all
Filter updated: Fri, 30 Jul 2021 12:01:52 +0000
2021-07-30 12:01:52 +00:00
||wn82b.skipdns.link$all
Filter updated: Mon, 02 Nov 2020 12:06:35 UTC
2020-11-02 12:06:35 +00:00
||wonderful.gr$all
Filter updated: Fri, 25 Jun 2021 12:06:17 +0000
2021-06-25 12:06:17 +00:00
||woomcenter.com$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||woquito1-ecttps2.hostkda.com$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||worcester-passing-pharmacy-paxil.trycloudflare.com$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||workcuencapptss1.hostkda.com$all
Filter updated: Wed, 28 Jul 2021 00:02:03 +0000
2021-07-28 00:02:03 +00:00
||workforcerelief.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||workprotocoles-com.webs.com$all
Filter updated: Fri, 15 Jan 2021 12:06:30 UTC
2021-01-15 12:06:30 +00:00
||worldwidepbx.com$all
Filter updated: Fri, 04 Dec 2020 12:06:51 UTC
2020-12-04 12:06:51 +00:00
||wp-login.azurewebsites.net$all
Filter updated: Mon, 06 Sep 2021 12:01:50 +0000
2021-09-06 12:01:50 +00:00
||wp.d-sso.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||wqass-index.1d536mi.cn$all
||wqass-index.50vo76x.cn$all
||wqass-index.56a7d2b.cn$all
Filter updated: Tue, 21 Sep 2021 00:01:40 +0000
2021-09-21 00:01:40 +00:00
||wqass-index.5veki2.cn$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||wqass-index.8qv449o.cn$all
||wqass-index.ag3fuj4.cn$all
Filter updated: Tue, 21 Sep 2021 00:01:40 +0000
2021-09-21 00:01:40 +00:00
||wqass-index.aliz4k.cn$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||wqass-index.bsv8n1.cn$all
||wqass-index.cd45lif.cn$all
||wqass-index.cfc4347.cn$all
Filter updated: Mon, 20 Sep 2021 00:01:41 +0000
2021-09-20 00:01:41 +00:00
||wqass-index.d5s6yuv.cn$all
Filter updated: Tue, 21 Sep 2021 00:01:40 +0000
2021-09-21 00:01:40 +00:00
||wqass-index.epgnlu.cn$all
Filter updated: Mon, 20 Sep 2021 00:01:41 +0000
2021-09-20 00:01:41 +00:00
||wqass-index.fcf40z9.cn$all
Filter updated: Tue, 21 Sep 2021 00:01:40 +0000
2021-09-21 00:01:40 +00:00
||wqass-index.frmzt0.cn$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||wqass-index.g2y0v5r.cn$all
||wqass-index.gawvbke.cn$all
||wqass-index.iyddeunu.cn$all
||wqass-index.kzmojwlm.cn$all
Filter updated: Tue, 21 Sep 2021 00:01:40 +0000
2021-09-21 00:01:40 +00:00
||wqass-index.rfw65j.cn$all
Filter updated: Mon, 20 Sep 2021 00:01:41 +0000
2021-09-20 00:01:41 +00:00
||wqass-index.rivatobias2.cn$all
||wqass-index.sanyangkeji2012.cn$all
||wqass-index.shanghaizxzs.cn$all
||wqass-index.shritafinn.cn$all
Filter updated: Tue, 21 Sep 2021 00:01:40 +0000
2021-09-21 00:01:40 +00:00
||wqass-index.wa8gvl.cn$all
Filter updated: Fri, 24 Sep 2021 00:01:50 +0000
2021-09-24 00:01:51 +00:00
||wqass-index.y0cpqm.cn$all
Filter updated: Mon, 20 Sep 2021 00:01:41 +0000
2021-09-20 00:01:41 +00:00
||wqass-index.ytjiade.cn$all
Filter updated: Mon, 09 Aug 2021 12:01:58 +0000
2021-08-09 12:01:58 +00:00
||wqdqnna.ga$all
Filter updated: Sun, 12 Sep 2021 12:01:35 +0000
2021-09-12 12:01:35 +00:00
||wrap.co$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||wriot-alternate.app.link$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||wsdqmovil.tr.gg$all
Filter updated: Wed, 07 Oct 2020 12:06:27 UTC
2020-10-07 12:06:27 +00:00
||wsxwaaaa.web.app$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||wu7q5.app.link$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||wulalalela.cyou$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||wvk12-my.sharepoint.com/personal/pklewis_k12_wv_us/_layouts/15/wopiframe.aspx?guestaccesstoken=tqintdtuii%2bam%2fbqmtnjkenggs2dptoi8hs2jqftjkq%3d&docid=1_1446052cffa4c4871bd24bb98fe86ed6d&wdformid=%7bdf30d25d%2d0b59%2d47e5%2d956e%2dc601397ea4d7%7d&action=formsubmit&cid=57cdb8ab-426b-4eff-a51f-903ee3684f96$all
Filter updated: Wed, 10 Mar 2021 12:10:46 UTC
2021-03-10 12:10:46 +00:00
||wvwv.xn--zonsegurasbn1cmp-hmb1nth.com$all
Filter updated: Wed, 24 Feb 2021 00:06:23 UTC
2021-02-24 00:06:23 +00:00
||ww2.activartusoperacionesenlinea.zonasegurabeta.com.pe.vegam.co$all
Filter updated: Sat, 17 Jul 2021 12:01:37 +0000
2021-07-17 12:01:37 +00:00
||wwproamerivto.byethost13.com$all
Filter updated: Fri, 30 Jul 2021 12:01:52 +0000
2021-07-30 12:01:52 +00:00
||www-046cw.skipdns.link$all
||www-4ng31.skipdns.link$all
Filter updated: Thu, 15 Oct 2020 00:06:34 UTC
2020-10-15 00:06:34 +00:00
||www-cursosdigitalesmx-com.filesusr.com$all
Filter updated: Sat, 07 Aug 2021 00:20:48 +0000
2021-08-07 00:20:48 +00:00
||www-dd91n.skipdns.link$all
Filter updated: Mon, 16 Nov 2020 00:06:15 UTC
2020-11-16 00:06:16 +00:00
||www-degelyehuda-org-il.filesusr.com$all
Filter updated: Wed, 11 Aug 2021 00:01:55 +0000
2021-08-11 00:01:55 +00:00
||www-e2g5k.skipdns.link$all
Filter updated: Sat, 14 Nov 2020 00:06:47 UTC
2020-11-14 00:06:47 +00:00
||www-europe564598-com.filesusr.com$all
Filter updated: Fri, 23 Oct 2020 00:06:28 UTC
2020-10-23 00:06:29 +00:00
||www-europessign-com.filesusr.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||www-facebook-com.facebook.suptr32.skyfencenet.com/login/device-based/regular/login/?login_attempt=1&lwv=120&lwc=1348131$all
Filter updated: Fri, 30 Jul 2021 12:01:52 +0000
2021-07-30 12:01:52 +00:00
||www-hi9z3.skipdns.link$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||www-interbank-pe.aulavirtual.click$all
Filter updated: Tue, 14 Sep 2021 12:01:44 +0000
2021-09-14 12:01:44 +00:00
||www-key-com.test.edgekey.net$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||www-microsoft-com.office365.auto1.casb.beta.forcepointgov.com$all
Filter updated: Sat, 31 Jul 2021 00:01:51 +0000
2021-07-31 00:01:51 +00:00
||www-n2q3r.skipdns.link$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||www-orico-co-jp.chfsp4.top$all
||www-paypal-com.732876.com$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||www-paypoy.banks-bvurs-co-jp.nuanen.top$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||www-paypoy.banks-cvyes-co-jp.chunfa.top$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||www-paypoy.banks-jfnch-co-jp.chuiqu.top/wctx?routekey=v3$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||www-paypoy.banks-mbkcd-co-jp.chuasi.top$all
||www-paypoy.banks-sybtf-co-jp.shuabi.top$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||www-paypoy.banks-vjdhv-co-jp.chuawu.top/wctx/$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||www-paypoy.banks-wxhdc-co-jp.yuanta.top$all
Filter updated: Fri, 30 Jul 2021 12:01:52 +0000
2021-07-30 12:01:52 +00:00
||www-s302y.skipdns.link$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||www-snbc.cardrs-ecgij-com.gqgsto.top$all
Filter updated: Thu, 23 Sep 2021 00:02:18 +0000
2021-09-23 00:02:18 +00:00
||www-snbc.cardrs-gvxtd-com.kanbai.top$all
Filter updated: Fri, 24 Sep 2021 12:02:36 +0000
2021-09-24 12:02:36 +00:00
||www-snbc.cardrs-ovmsh-com.zbsstdf.fun$all
Filter updated: Mon, 02 Aug 2021 00:02:18 +0000
2021-08-02 00:02:18 +00:00
||www.httpservlces.runescape.com-m.ru$all
Filter updated: Thu, 05 Aug 2021 00:02:05 +0000
2021-08-05 00:02:05 +00:00
||www.m.ervlces.runescape.com-fe.ru$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||www.m.pma.runescape.com-m.ru$all
Filter updated: Thu, 19 Aug 2021 12:02:33 +0000
2021-08-19 12:02:33 +00:00
||www.m.tpservlces.runescape.com-ov.ru$all
Filter updated: Tue, 03 Aug 2021 12:01:54 +0000
2021-08-03 12:01:54 +00:00
||www.pma.runescape.com-gb.ru$all
Filter updated: Thu, 23 Sep 2021 12:01:47 +0000
2021-09-23 12:01:47 +00:00
||www3.colegiosantaangelamerici.edu.co$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||wwwapp-metams.top$all
||wwwfaecebookinfoo.co.vu$all
Filter updated: Mon, 26 Jul 2021 00:02:16 +0000
2021-07-26 00:02:17 +00:00
||wxcefappmobile.com$all
Filter updated: Sat, 31 Jul 2021 12:01:55 +0000
2021-07-31 12:01:55 +00:00
||wxyicacxwzypydwqaovplzetgg-dot-goff039302032323.rj.r.appspot.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||wypadki24.e-kei.pl$all
||wzplh.app.link$all
||x2mqj8a.app.link$all
Filter updated: Sun, 29 Nov 2020 12:06:41 UTC
2020-11-29 12:06:41 +00:00
||xaydungtamhoanganh.com$all
Filter updated: Wed, 21 Jul 2021 00:01:57 +0000
2021-07-21 00:01:57 +00:00
||xcvbm.hyperphp.com$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||xess-nitro.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||xfinityconnect4you.blogspot.com$all
Filter updated: Fri, 07 May 2021 12:12:56 UTC
2021-05-07 12:12:56 +00:00
||xfitpalestre.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||xgyul.codesandbox.io$all
Filter updated: Fri, 04 Sep 2020 12:06:38 UTC
2020-09-04 12:06:38 +00:00
||xh13v.mjt.lu$all
Filter updated: Sat, 05 Sep 2020 00:06:45 UTC
2020-09-05 00:06:45 +00:00
||xh140.mjt.lu$all
Filter updated: Fri, 04 Sep 2020 12:06:38 UTC
2020-09-04 12:06:38 +00:00
||xh14n.mjt.lu$all
||xh156.mjt.lu$all
||xh1ou.mjt.lu$all
Filter updated: Sat, 05 Sep 2020 00:06:45 UTC
2020-09-05 00:06:45 +00:00
||xh1pl.mjt.lu$all
Filter updated: Fri, 04 Sep 2020 12:06:38 UTC
2020-09-04 12:06:38 +00:00
||xh1u4.mjt.lu$all
Filter updated: Tue, 31 Aug 2021 00:01:55 +0000
2021-08-31 00:01:55 +00:00
||xh7sz.hyperphp.com$all
Filter updated: Fri, 04 Sep 2020 12:06:38 UTC
2020-09-04 12:06:38 +00:00
||xhlgt.mjt.lu$all
||xhlr4.mjt.lu$all
||xhlvl.mjt.lu$all
||xhmnq.mjt.lu$all
||xhmnu.mjt.lu$all
Filter updated: Thu, 10 Sep 2020 00:06:24 UTC
2020-09-10 00:06:24 +00:00
||xhmnv.mjt.lu$all
Filter updated: Fri, 04 Sep 2020 12:06:38 UTC
2020-09-04 12:06:38 +00:00
||xhmqu.mjt.lu$all
||xhs02.mjt.lu$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||xid-human-validation.run-us-west2.goorm.io$all
Filter updated: Fri, 13 Aug 2021 12:01:44 +0000
2021-08-13 12:01:44 +00:00
||xiorsil.freecluster.eu$all
Filter updated: Fri, 04 Sep 2020 12:06:38 UTC
2020-09-04 12:06:38 +00:00
||xj333.mjt.lu$all
Filter updated: Thu, 10 Dec 2020 12:06:41 UTC
2020-12-10 12:06:42 +00:00
||xj33s.mjt.lu$all
||xj33w.mjt.lu$all
||xj3pr.mjt.lu$all
Filter updated: Wed, 09 Dec 2020 12:06:49 UTC
2020-12-09 12:06:49 +00:00
||xj45g.mjt.lu$all
Filter updated: Thu, 10 Dec 2020 12:06:41 UTC
2020-12-10 12:06:42 +00:00
||xj45o.mjt.lu$all
||xj4og.mjt.lu$all
Filter updated: Wed, 30 Dec 2020 00:06:08 UTC
2020-12-30 00:06:08 +00:00
||xjm7s.mjt.lu$all
Filter updated: Thu, 10 Dec 2020 12:06:41 UTC
2020-12-10 12:06:42 +00:00
||xjmr7.mjt.lu$all
Filter updated: Sat, 05 Sep 2020 00:06:45 UTC
2020-09-05 00:06:45 +00:00
||xju3s.mjt.lu$all
Filter updated: Sat, 12 Sep 2020 12:06:46 UTC
2020-09-12 12:06:46 +00:00
||xjupr.mjt.lu$all
Filter updated: Thu, 22 Jul 2021 12:02:07 +0000
2021-07-22 12:02:07 +00:00
||xkdwm.csb.app$all
Filter updated: Thu, 19 Aug 2021 00:01:47 +0000
2021-08-19 00:01:47 +00:00
||xkljfg.ml$all
Filter updated: Thu, 09 Sep 2021 12:02:27 +0000
2021-09-09 12:02:27 +00:00
||xlebcacitbtgbejjfyjzsnhujh-dot-goff039302032323.rj.r.appspot.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||xmley.codesandbox.io$all
Filter updated: Fri, 11 Jun 2021 12:06:37 UTC
2021-06-11 12:06:38 +00:00
||xn--80aafkatpetleclg.xn--p1ai/?domain=benjamas.vantanatavatot@sc.com$all
||xn--80aafkatpetleclg.xn--p1ai/?domain=benjamas.vantanatavatot@sc.com2.$all
||xn--80aafkatpetleclg.xn--p1ai/?domain=organization$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||xn--bankofmerca-3ij68171c.vg$all
||xn--bnkofmerc-qcbee85c.vg$all
Filter updated: Mon, 26 Oct 2020 00:06:20 UTC
2020-10-26 00:06:20 +00:00
||xn--gmal-sya.com$all
Filter updated: Sun, 15 Aug 2021 12:01:40 +0000
2021-08-15 12:01:40 +00:00
||xn--ltappen-80a.se$all
Filter updated: Tue, 21 Sep 2021 12:02:11 +0000
2021-09-21 12:02:11 +00:00
||xn--metemsk-twa.com$all
Filter updated: Fri, 11 Dec 2020 00:06:35 UTC
2020-12-11 00:06:35 +00:00
||xn--pacincia-xl-qbb.com$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||xn--pckswap-8va0c7c53d.com$all
Filter updated: Tue, 19 Jan 2021 12:07:14 UTC
2021-01-19 12:07:14 +00:00
||xn--pxful-v11b.com$all
Filter updated: Tue, 29 Jun 2021 00:01:48 +0000
2021-06-29 00:01:48 +00:00
||xn--rpondeur-vocal12-bqb.yolasite.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||xn--se-connecter--votre-compte-microsoft52-mcd.yolasite.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||xn--ugbd1cbxo23egh.com$all
Filter updated: Wed, 08 Sep 2021 12:01:51 +0000
2021-09-08 12:01:51 +00:00
||xolxol.phwww.vlces.runescape.com-oa.ru$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||xpixl.me$all
Filter updated: Tue, 09 Mar 2021 12:08:37 UTC
2021-03-09 12:08:37 +00:00
||xqhq4.mjt.lu$all
Filter updated: Fri, 08 Jan 2021 00:06:25 UTC
2021-01-08 00:06:25 +00:00
||xqr3i.mjt.lu$all
Filter updated: Sat, 16 Jan 2021 00:06:58 UTC
2021-01-16 00:06:58 +00:00
||xqr3n.mjt.lu$all
Filter updated: Thu, 31 Dec 2020 12:06:18 UTC
2020-12-31 12:06:18 +00:00
||xqr3u.mjt.lu$all
Filter updated: Thu, 24 Dec 2020 00:06:18 UTC
2020-12-24 00:06:18 +00:00
||xrx6r.mjt.lu$all
Filter updated: Tue, 29 Dec 2020 12:06:20 UTC
2020-12-29 12:06:20 +00:00
||xrxh1.mjt.lu$all
Filter updated: Fri, 01 Jan 2021 00:06:18 UTC
2021-01-01 00:06:18 +00:00
||xrxh2.mjt.lu$all
Filter updated: Thu, 07 Jan 2021 12:06:18 UTC
2021-01-07 12:06:18 +00:00
||xrxhl.mjt.lu$all
Filter updated: Wed, 28 Jul 2021 00:02:03 +0000
2021-07-28 00:02:03 +00:00
||xsop5vp0rfd.typeform.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||xsuitmaterial.com$all
Filter updated: Sat, 17 Jul 2021 00:01:47 +0000
2021-07-17 00:01:47 +00:00
||xtbnkpro.hostfree.pw$all
Filter updated: Sat, 08 May 2021 00:06:32 UTC
2021-05-08 00:06:32 +00:00
||xtio.ch$all
Filter updated: Tue, 05 Jan 2021 12:06:21 UTC
2021-01-05 12:06:22 +00:00
||xtw42.mjt.lu$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||xurl.es/l0f93$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||xvideojordihot.duckdns.org$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||xxx-com-dot-c2c01-531c7.uc.r.appspot.com$all
Filter updated: Thu, 14 Jan 2021 00:06:20 UTC
2021-01-14 00:06:20 +00:00
||xyproject.xtensio.com$all
Filter updated: Tue, 14 Sep 2021 12:01:44 +0000
2021-09-14 12:01:44 +00:00
||xyysyndromepedia.com$all
Filter updated: Tue, 15 Sep 2020 00:06:22 UTC
2020-09-15 00:06:22 +00:00
||y3s2ye.webwave.dev$all
Filter updated: Mon, 12 Jul 2021 12:02:03 +0000
2021-07-12 12:02:03 +00:00
||y768766y.byethost6.com$all
Filter updated: Wed, 08 Sep 2021 12:01:51 +0000
2021-09-08 12:01:51 +00:00
||yaboshi.com$all
Filter updated: Tue, 14 Sep 2021 12:01:44 +0000
2021-09-14 12:01:44 +00:00
||yaewom.yeovessn.com$all
Filter updated: Fri, 16 Jul 2021 00:01:53 +0000
2021-07-16 00:01:53 +00:00
||yafa-coach.co.il$all
Filter updated: Fri, 23 Apr 2021 00:06:35 UTC
2021-04-23 00:06:35 +00:00
||yahoos-initial-project-cf784a.webflow.io$all
Filter updated: Fri, 24 Sep 2021 12:02:36 +0000
2021-09-24 12:02:36 +00:00
||yahuomall.square.site$all
Filter updated: Tue, 01 Jun 2021 12:06:34 UTC
2021-06-01 12:06:34 +00:00
||yairix.github.io$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||yakutcement.ru$all
Filter updated: Fri, 19 Feb 2021 12:06:46 UTC
2021-02-19 12:06:46 +00:00
||yalena.me$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||yandxxxpro2021.duckdns.org$all
Filter updated: Tue, 31 Aug 2021 00:01:55 +0000
2021-08-31 00:01:55 +00:00
||yaninasozopol.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||yankeyhokai.com$all
Filter updated: Tue, 14 Sep 2021 12:01:44 +0000
2021-09-14 12:01:44 +00:00
||yaopeowm.yeovessn.com$all
Filter updated: Sat, 24 Jul 2021 00:33:22 +0000
2021-07-24 00:33:22 +00:00
||yape.greenter.dev$all
Filter updated: Sat, 13 Mar 2021 12:07:44 UTC
2021-03-13 12:07:44 +00:00
||yaqoobi.org$all
Filter updated: Sat, 03 Jul 2021 00:01:56 +0000
2021-07-03 00:01:56 +00:00
||yarwoodfineart.com/chpost/ch/$all
Filter updated: Mon, 16 Aug 2021 00:01:59 +0000
2021-08-16 00:01:59 +00:00
||yashengineers.co.in$all
Filter updated: Sun, 13 Sep 2020 12:06:52 UTC
2020-09-13 12:06:52 +00:00
||yastatic.net/awaps-ad-sdk-js-bundles/1.0-3871/bundles-es2017/inpage.bundle.js$all
Filter updated: Wed, 08 Sep 2021 12:01:51 +0000
2021-09-08 12:01:51 +00:00
||ybs.51haoyayi.cn$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||yetpack.com$all
Filter updated: Thu, 20 May 2021 12:06:36 UTC
2021-05-20 12:06:36 +00:00
||ygdguwg.dgzwtmga.cn$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||yogiramsuratkumar.org$all
Filter updated: Wed, 08 Sep 2021 12:01:51 +0000
2021-09-08 12:01:51 +00:00
||yoplwg2740634.byethost17.com$all
Filter updated: Wed, 25 Aug 2021 12:02:06 +0000
2021-08-25 12:02:07 +00:00
||youengage.me/p/61164367233af501000121a2$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||youngil.co.kr$all
Filter updated: Sat, 14 Aug 2021 12:02:02 +0000
2021-08-14 12:02:02 +00:00
||yourdeathstar.com$all
Filter updated: Wed, 22 Sep 2021 00:02:26 +0000
2021-09-22 00:02:26 +00:00
||yourthegame.xyz$all
Filter updated: Wed, 28 Apr 2021 00:06:29 UTC
2021-04-28 00:06:29 +00:00
||youtube.com/redirect?event=video_description&redir_token=quffluhqazjnrtryamdoudhsmxhgbfzqvnm4ymrczlk5d3xbq3jtc0trauh6afm2v2zrzjzzwvdwlxqxwtvntvjkx19olvbmbkg2whdradbnmlzon2jxoudezdjium5hqtnpav9qsgtfufjizeltb0jgr1ddr0d0vk5qsurlmewtrvfnnmg2n28xswlcujzla2t4bfloewzsaw&q=https%3a%2f%2fbit.ly%2f2qq1myh$all
Filter updated: Fri, 16 Jul 2021 12:01:57 +0000
2021-07-16 12:01:57 +00:00
||youtudaysmensfoo.byethost31.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||youwingirisimiz.blogspot.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||ytco.in$all
Filter updated: Tue, 25 May 2021 12:06:34 UTC
2021-05-25 12:06:34 +00:00
||ythfdsf.aio49f4vsd.workers.dev$all
Filter updated: Sun, 12 Sep 2021 00:02:13 +0000
2021-09-12 00:02:13 +00:00
||ytthn.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||ytthn.com/click-dqkla3al-hfdqch9w?bt=25&tl=1&url=http://www.microsoft.com/&sa=k4cph5afjt010fz50ihbd$all
Filter updated: Wed, 02 Jun 2021 00:06:23 UTC
2021-06-02 00:06:23 +00:00
||yun.ir/0561j6$all
Filter updated: Tue, 27 Jul 2021 12:01:59 +0000
2021-07-27 12:01:59 +00:00
||yun.ir/2s45v2$all
Filter updated: Wed, 02 Jun 2021 00:06:23 UTC
2021-06-02 00:06:23 +00:00
||yun.ir/b0al9f$all
Filter updated: Sat, 25 Sep 2021 00:01:48 +0000
2021-09-25 00:01:48 +00:00
||yun.ir/cc42w$all
Filter updated: Fri, 24 Sep 2021 00:01:50 +0000
2021-09-24 00:01:51 +00:00
||yusril-moh.000webhostapp.com$all
feat: add AdGuard-specific blocklist - https://gitlab.com/curben/urlhaus-filter/-/commit/7878367eeb8c5505f2c00fef7afd7636f8ad4fbe
2020-09-03 01:59:03 +00:00
||yuuu6.codesandbox.io$all
Filter updated: Sat, 10 Jul 2021 00:01:42 +0000
2021-07-10 00:01:42 +00:00
||yvaledesoser.t.justns.ru$all
Filter updated: Sun, 02 May 2021 00:06:30 UTC
2021-05-02 00:06:30 +00:00
||yvesauzon0-mon-site-web-cheetah.cheetah.builderall.com$all
Filter updated: Fri, 30 Apr 2021 00:08:30 UTC
2021-04-30 00:08:30 +00:00
||yvessgaspard-mon-site-web-cheetah.free.builderall.com$all
Filter updated: Sun, 26 Sep 2021 00:02:13 +0000
2021-09-26 00:02:13 +00:00
||yvqkqq.top$all
Filter updated: Wed, 28 Jul 2021 12:01:46 +0000
2021-07-28 12:01:46 +00:00
||ywlrwalvihcbekfschnroffqhf-dot-goff039302032323.rj.r.appspot.com$all
Filter updated: Thu, 01 Apr 2021 12:06:44 UTC
2021-04-01 12:06:45 +00:00
||z-pay.biz$all
Filter updated: Sat, 29 May 2021 12:06:18 UTC
2021-05-29 12:06:19 +00:00
||z3voicrxxvs.typeform.com$all
Filter updated: Sat, 10 Jul 2021 00:01:42 +0000
2021-07-10 00:01:42 +00:00
||zacma.bialystok.pl$all
Filter updated: Sun, 05 Sep 2021 12:01:36 +0000
2021-09-05 12:01:37 +00:00
||zadi.me$all
Filter updated: Sat, 17 Apr 2021 00:06:31 UTC
2021-04-17 00:06:31 +00:00
||zahlbaum.de$all
Filter updated: Fri, 17 Sep 2021 00:01:45 +0000
2021-09-17 00:01:46 +00:00
||zanbeel.com$all
Filter updated: Fri, 24 Sep 2021 00:01:50 +0000
2021-09-24 00:01:51 +00:00
||zcr7y.club$all
Filter updated: Sat, 25 Sep 2021 12:01:35 +0000
2021-09-25 12:01:36 +00:00
||zcrtygroup.club$all
Filter updated: Wed, 22 Sep 2021 00:02:26 +0000
2021-09-22 00:02:26 +00:00
||zdcdrtfguh-vuhjjiu-bjnnjnj.s3.amazonaws.com/index.html$all
Filter updated: Fri, 24 Sep 2021 12:02:36 +0000
2021-09-24 12:02:36 +00:00
||zdlymx.top$all
Filter updated: Sun, 27 Sep 2020 12:06:36 UTC
2020-09-27 12:06:36 +00:00
||zeebracross.com$all
Filter updated: Tue, 14 Sep 2021 12:01:44 +0000
2021-09-14 12:01:44 +00:00
||zeig.ml$all
Filter updated: Thu, 10 Sep 2020 12:06:46 UTC
2020-09-10 12:06:46 +00:00
||zekkafreitas-vando-magazine.cheetah.builderall.com$all
Filter updated: Sun, 06 Jun 2021 12:06:15 UTC
2021-06-06 12:06:16 +00:00
||zfhub.com.br$all
Filter updated: Tue, 29 Sep 2020 00:06:27 UTC
2020-09-29 00:06:27 +00:00
||zi-3-gporange1.free.builderall.com$all
Filter updated: Wed, 05 May 2021 00:06:44 UTC
2021-05-05 00:06:44 +00:00
||zimbabwe.net.za$all
Filter updated: Fri, 30 Jul 2021 12:01:52 +0000
2021-07-30 12:01:52 +00:00
||zip10.skipdns.link$all
Filter updated: Fri, 11 Jun 2021 00:06:40 UTC
2021-06-11 00:06:40 +00:00
||zix-zero.org.ru$all
Filter updated: Sat, 29 May 2021 12:06:18 UTC
2021-05-29 12:06:19 +00:00
||zlej3mqyoty.typeform.com$all
Filter updated: Tue, 21 Sep 2021 12:02:11 +0000
2021-09-21 12:02:11 +00:00
||zoho-active.web.app$all
||zoho-adminserv.web.app$all
||zoho-mailservices.web.app$all
||zoho-online.web.app$all
||zoho-validationserv.web.app$all
Filter updated: Tue, 10 Aug 2021 00:01:49 +0000
2021-08-10 00:01:49 +00:00
||zonasegura-pichincha.pe-ini.com$all
||zonasegura-pichincha.pe-nts.com$all
Filter updated: Mon, 27 Sep 2021 12:02:07 +0000
2021-09-27 12:02:07 +00:00
||zonasegurabetarbcp.online$all
Filter updated: Sun, 26 Sep 2021 12:01:30 +0000
2021-09-26 12:01:30 +00:00
||zonasegurabetarbcp.site$all
||zonasegurabn1pe.online$all
Filter updated: Wed, 22 Sep 2021 00:02:26 +0000
2021-09-22 00:02:26 +00:00
||zonaseguran1.bn.virtual.cartinperu.com$all
Filter updated: Sun, 08 Aug 2021 00:02:06 +0000
2021-08-08 00:02:06 +00:00
||zonasegurapichincha.pe-ini.com$all
Filter updated: Tue, 29 Jun 2021 12:02:07 +0000
2021-06-29 12:02:07 +00:00
||zonaseguridadec.2host.me$all
Filter updated: Tue, 21 Sep 2021 00:01:40 +0000
2021-09-21 00:01:40 +00:00
||zonassegurabetasviabcpe.com$all
||zonassegurabetasviasbcpe.com$all
||zonassegurabetaviabcp-pe.com$all
||zonassegurabetaviabcpe.com$all
Filter updated: Fri, 24 Sep 2021 12:02:36 +0000
2021-09-24 12:02:36 +00:00
||zoomstart.onlinestartserviceforyourworkstudymeeting.indyflat-tax.com$all
Filter updated: Tue, 14 Sep 2021 12:01:44 +0000
2021-09-14 12:01:44 +00:00
||zorten.com$all
Filter updated: Tue, 03 Aug 2021 12:01:54 +0000
2021-08-03 12:01:54 +00:00
||zphum.skipdns.link$all
Filter updated: Wed, 28 Jul 2021 12:01:46 +0000
2021-07-28 12:01:46 +00:00
||zpmjikyjmhrzakneiddpiifdla-dot-gowa11111111.rj.r.appspot.com$all
Filter updated: Mon, 20 Sep 2021 12:02:05 +0000
2021-09-20 12:02:05 +00:00
||zpr.io/kms8u47zlxwk$all
Filter updated: Wed, 28 Jul 2021 12:01:46 +0000
2021-07-28 12:01:46 +00:00
||zpr.io/rafby#%0%$all
Filter updated: Tue, 08 Jun 2021 12:06:44 UTC
2021-06-08 12:06:44 +00:00
||zpr.io/rafby#camilgeyer@prepaidlegal.com$all
Filter updated: Sat, 24 Jul 2021 00:33:22 +0000
2021-07-24 00:33:22 +00:00
||zpr.io/rafby#clarencecalhoun@prepaidlegal.com$all
Filter updated: Tue, 29 Jun 2021 12:02:07 +0000
2021-06-29 12:02:07 +00:00
||zpr.io/rafby#jaygallagher@prepaidlegal.com$all
Filter updated: Fri, 07 May 2021 12:12:56 UTC
2021-05-07 12:12:56 +00:00
||zpr.io/rafby#omflavin@legalshieldcorp.com$all
Filter updated: Wed, 21 Jul 2021 00:01:57 +0000
2021-07-21 00:01:57 +00:00
||zpr.io/rb7bg#camilgeyer@prepaidlegal.com$all
Filter updated: Fri, 19 Mar 2021 00:09:38 UTC
2021-03-19 00:09:38 +00:00
||zpr.io/ruttb$all
||zpr.io/twq3f$all
Filter updated: Thu, 17 Jun 2021 12:06:40 +0000
2021-06-17 12:06:40 +00:00
||zroei-pccnb.flounderfit.com/#jaekyeum.kim@sc.com$all
Filter updated: Tue, 02 Feb 2021 12:06:42 UTC
2021-02-02 12:06:42 +00:00
||zvuqh.app.link$all