Update go mod deps

Makefile

@@ -1,4 +1,4 @@
-VERSION := 0.9.5.1
+VERSION := 0.9.5.2
 .PHONY: lint vis clean common client server passwd subpkgs install uninstall reinstall
 
 ## Tag version of binaries with build info wrt.

go.mod

@@ -1,30 +1,31 @@
 module blitter.com/go/xs
 
-go 1.17
+go 1.18
 
 require (
 	blitter.com/go/cryptmt v1.0.2
 	blitter.com/go/goutmp v1.0.6
 	blitter.com/go/herradurakex v1.0.0
-	blitter.com/go/hopscotch v0.0.0-20211113042251-b8a306eea4dc
+	blitter.com/go/hopscotch v0.0.0-20220617051533-4b42ccd4e00a
 	blitter.com/go/kyber v0.0.0-20200130200857-6f2021cb88d9
 	blitter.com/go/newhope v0.0.0-20200130200750-192fc08a8aae
 	github.com/aead/chacha20 v0.0.0-20180709150244-8b13a72661da
 	github.com/creack/pty v1.1.18
 	github.com/jameskeane/bcrypt v0.0.0-20120420032655-c3cd44c1e20f
 	github.com/kuking/go-frodokem v1.0.2
-	github.com/mattn/go-isatty v0.0.14
+	github.com/mattn/go-isatty v0.0.16
 	github.com/xtaci/kcp-go v5.4.20+incompatible
-	golang.org/x/crypto v0.0.0-20220408190544-5352b0902921
+	golang.org/x/crypto v0.0.0-20220829220503-c86fa9a7ed90
-	golang.org/x/sys v0.0.0-20220408201424-a24fb2fb8a0f
+	golang.org/x/sys v0.0.0-20220909162455-aba9fc2a8ff2
 	gopkg.in/hlandau/passlib.v1 v1.0.11
 )
 
 require (
 	blitter.com/go/chacha20 v0.0.0-20200130200441-214e4085f54c // indirect
+	blitter.com/go/groestl v0.0.0-20220410000905-c4decbf31d64 // indirect
 	blitter.com/go/mtwist v1.0.1 // indirect
-	github.com/klauspost/cpuid/v2 v2.0.6 // indirect
+	github.com/klauspost/cpuid/v2 v2.1.1 // indirect
-	github.com/klauspost/reedsolomon v1.9.16 // indirect
+	github.com/klauspost/reedsolomon v1.11.0 // indirect
 	github.com/pkg/errors v0.9.1 // indirect
 	github.com/templexxx/cpufeat v0.0.0-20180724012125-cef66df7f161 // indirect
 	github.com/templexxx/xor v0.0.0-20191217153810-f85b25db303b // indirect

go.sum

@@ -4,10 +4,12 @@ blitter.com/go/cryptmt v1.0.2 h1:ZcLhQk7onUssXyQwG3GdXDXctCVnNL+b7aFuvwOdKXc=
 blitter.com/go/cryptmt v1.0.2/go.mod h1:tdME2J3O4agaDAYIYNQzzuB28yVGnPSMmV3a/ucSU84=
 blitter.com/go/goutmp v1.0.6 h1:jRKRw2WalVBza4T50etAfbvT2xp9G5uykIHTvyB5r0k=
 blitter.com/go/goutmp v1.0.6/go.mod h1:DnK/uLBu1/1yLFiuVlmwvWErzAWVp+pDv7t6ZaQRLNc=
+blitter.com/go/groestl v0.0.0-20220410000905-c4decbf31d64 h1:SH6cZ4JiOTmWGeVd5hCgt8gsMvfPPHWpEwNdxfsBugM=
+blitter.com/go/groestl v0.0.0-20220410000905-c4decbf31d64/go.mod h1:YMdIR/gCtFwU/a09jyWAwUu2J9CQejUFwkfD+PyVg+4=
 blitter.com/go/herradurakex v1.0.0 h1:6XaxY+JLT1HUWPF0gYJnjX3pVjrw4YhYZEzZ1U0wkyc=
 blitter.com/go/herradurakex v1.0.0/go.mod h1:m3+vYZX+2dDjdo+n/HDnXEYJX9pwmNeQLgAfJM8mtxw=
-blitter.com/go/hopscotch v0.0.0-20211113042251-b8a306eea4dc h1:IS+jxdKSdlqp6TWG3yMoBde/cctBEMwMDg588JHxgTE=
+blitter.com/go/hopscotch v0.0.0-20220617051533-4b42ccd4e00a h1:1fEN7eJMG9TweQuGMAgQlTJ0Wl7lsdDL4Nt5gHZijhY=
-blitter.com/go/hopscotch v0.0.0-20211113042251-b8a306eea4dc/go.mod h1:9Da1oy0t9aUw3wviba+2mP1inbLGbDuCKAO3mmGQha4=
+blitter.com/go/hopscotch v0.0.0-20220617051533-4b42ccd4e00a/go.mod h1:LtcFd2/R9xcau5SZIYeaHvdqAM7Y5pyvdZYT5J9HAME=
 blitter.com/go/kyber v0.0.0-20200130200857-6f2021cb88d9 h1:D45AnrNphtvczBXRp5JQicZRTgaK/Is5bgPDDvRKhTc=
 blitter.com/go/kyber v0.0.0-20200130200857-6f2021cb88d9/go.mod h1:SK6QfGG72lIfKW1Td0wH7f0wwN5nSIhV3K+wvzGNjrw=
 blitter.com/go/mtwist v1.0.1 h1:PxmoWexfMpLmc8neHP/PcRc3s17ct7iz4d5W/qJVt04=
@@ -45,14 +47,14 @@ github.com/google/go-cmp v0.3.1/go.mod h1:8QqcDgzrUqlUb/G2PQTWiueGozuR1884gddMyw
 github.com/google/go-cmp v0.4.0/go.mod h1:v8dTdLbMG2kIc/vJvl+f65V22dbkXbowE6jgT/gNBxE=
 github.com/jameskeane/bcrypt v0.0.0-20120420032655-c3cd44c1e20f h1:UWGE8Vi+1Agt0lrvnd7UsmvwqWKRzb9byK9iQmsbY0Y=
 github.com/jameskeane/bcrypt v0.0.0-20120420032655-c3cd44c1e20f/go.mod h1:u+9Snq0w+ZdYKi8BBoaxnEwWu0fY4Kvu9ByFpM51t1s=
-github.com/klauspost/cpuid/v2 v2.0.6 h1:dQ5ueTiftKxp0gyjKSx5+8BtPWkyQbd95m8Gys/RarI=
+github.com/klauspost/cpuid/v2 v2.1.1 h1:t0wUqjowdm8ezddV5k0tLWVklVuvLJpoHeb4WBdydm0=
-github.com/klauspost/cpuid/v2 v2.0.6/go.mod h1:FInQzS24/EEf25PyTYn52gqo7WaD8xa0213Md/qVLRg=
+github.com/klauspost/cpuid/v2 v2.1.1/go.mod h1:RVVoqg1df56z8g3pUjL/3lE5UfnlrJX8tyFgg4nqhuY=
-github.com/klauspost/reedsolomon v1.9.16 h1:mR0AwphBwqFv/I3B9AHtNKvzuowI1vrj8/3UX4XRmHA=
+github.com/klauspost/reedsolomon v1.11.0 h1:fc24kMFf4I6dXJwSkVAsw8Za/dMcJrV5ImeDjG3ss1M=
-github.com/klauspost/reedsolomon v1.9.16/go.mod h1:eqPAcE7xar5CIzcdfwydOEdcmchAKAP/qs14y4GCBOk=
+github.com/klauspost/reedsolomon v1.11.0/go.mod h1:FXLZzlJIdfqEnQLdUKWNRuMZg747hZ4oYp2Ml60Lb/k=
 github.com/kuking/go-frodokem v1.0.2 h1:sxdguENCyr6WnLbJ/cjz0AYCW75H1b+E6zXY2ldZnUU=
 github.com/kuking/go-frodokem v1.0.2/go.mod h1:83ZX1kHOd72ouCsvbffCqJIj7Ih83MQTAjH2QbqzLZk=
-github.com/mattn/go-isatty v0.0.14 h1:yVuAays6BHfxijgZPzw+3Zlu5yQgKGP2/hcQbHb7S9Y=
+github.com/mattn/go-isatty v0.0.16 h1:bq3VjFmv/sOjHtdEhmkEV4x1AJtvUvOJ2PFAZ5+peKQ=
-github.com/mattn/go-isatty v0.0.14/go.mod h1:7GGIvUiUoEMVVmxf/4nioHXj79iQHKdU27kJ6hsGG94=
+github.com/mattn/go-isatty v0.0.16/go.mod h1:kYGgaQfpe5nmfYZH+SKPsOc2e4SrIfOl2e/yFXSvRLM=
 github.com/pkg/errors v0.9.1 h1:FEBLx1zS214owpjy7qsBeixbURkuhQAwrK5UwLGTwt4=
 github.com/pkg/errors v0.9.1/go.mod h1:bwawxfHBFNV+L2hUp1rHADufV3IMtnDRdf1r5NINEl0=
 github.com/pmezard/go-difflib v1.0.0 h1:4DBwDE0NGyQoBHbLQYPwSUPoCMWR5BEzIk/f1lZbAQM=
@@ -79,8 +81,8 @@ golang.org/x/crypto v0.0.0-20200128174031-69ecbb4d6d5d/go.mod h1:LzIPMQfyMNhhGPh
 golang.org/x/crypto v0.0.0-20200510223506-06a226fb4e37/go.mod h1:LzIPMQfyMNhhGPhUkYOs5KpL4U8rLKemX1yGLhDgUto=
 golang.org/x/crypto v0.0.0-20200622213623-75b288015ac9/go.mod h1:LzIPMQfyMNhhGPhUkYOs5KpL4U8rLKemX1yGLhDgUto=
 golang.org/x/crypto v0.0.0-20201012173705-84dcc777aaee/go.mod h1:LzIPMQfyMNhhGPhUkYOs5KpL4U8rLKemX1yGLhDgUto=
-golang.org/x/crypto v0.0.0-20220408190544-5352b0902921 h1:iU7T1X1J6yxDr0rda54sWGkHgOp5XJrqm79gcNlC2VM=
+golang.org/x/crypto v0.0.0-20220829220503-c86fa9a7ed90 h1:Y/gsMcFOcR+6S6f3YeMKl5g+dZMEWqcz5Czj/GWYbkM=
-golang.org/x/crypto v0.0.0-20220408190544-5352b0902921/go.mod h1:IxCIyHEi3zRg3s0A5j5BB6A9Jmi73HwBIUl50j+osU4=
+golang.org/x/crypto v0.0.0-20220829220503-c86fa9a7ed90/go.mod h1:IxCIyHEi3zRg3s0A5j5BB6A9Jmi73HwBIUl50j+osU4=
 golang.org/x/exp v0.0.0-20190121172915-509febef88a4/go.mod h1:CJ0aWSM057203Lf6IL+f9T1iT9GByDxfZKAQTCR3kQA=
 golang.org/x/lint v0.0.0-20181026193005-c67002cb31c3/go.mod h1:UVdnD1Gm6xHRNCYTkRU2/jEulfH38KcIWyp/GAMgvoE=
 golang.org/x/lint v0.0.0-20190227174305-5b3e6a55c961/go.mod h1:wehouNa3lNwaWXcvxsM5YxQ5yQlVC4a0KAMCusXpPoU=
@@ -102,16 +104,12 @@ golang.org/x/sys v0.0.0-20190215142949-d0b11bdaac8a/go.mod h1:STP8DvDyc/dI5b8T5h
 golang.org/x/sys v0.0.0-20190412213103-97732733099d/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
 golang.org/x/sys v0.0.0-20190902133755-9109b7679e13/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
 golang.org/x/sys v0.0.0-20200930185726-fdedc70b468f/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
-golang.org/x/sys v0.0.0-20201119102817-f84b799fce68/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
+golang.org/x/sys v0.0.0-20220704084225-05e143d24a9e/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
-golang.org/x/sys v0.0.0-20210423082822-04245dca01da/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs=
+golang.org/x/sys v0.0.0-20220811171246-fbc7d0a398ab/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
-golang.org/x/sys v0.0.0-20210615035016-665e8c7367d1/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
+golang.org/x/sys v0.0.0-20220909162455-aba9fc2a8ff2 h1:wM1k/lXfpc5HdkJJyW9GELpd8ERGdnh8sMGL6Gzq3Ho=
-golang.org/x/sys v0.0.0-20210630005230-0f9fa26af87c/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
+golang.org/x/sys v0.0.0-20220909162455-aba9fc2a8ff2/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
-golang.org/x/sys v0.0.0-20220408201424-a24fb2fb8a0f h1:8w7RhxzTVgUzw/AH/9mUV5q0vMgy40SQRursCcfmkCw=
-golang.org/x/sys v0.0.0-20220408201424-a24fb2fb8a0f/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
-golang.org/x/term v0.0.0-20201126162022-7de9c90e9dd1/go.mod h1:bj7SfCRtBDWHUb9snDiAeCFNEtKQo2Wmx5Cou7ajbmo=
 golang.org/x/text v0.3.0/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ=
 golang.org/x/text v0.3.3/go.mod h1:5Zoc/QRtKVWzQhOtBMvqHzDpF6irO9z98xDceosuGiQ=
-golang.org/x/text v0.3.6/go.mod h1:5Zoc/QRtKVWzQhOtBMvqHzDpF6irO9z98xDceosuGiQ=
 golang.org/x/tools v0.0.0-20180917221912-90fa682c2a6e/go.mod h1:n7NCudcB/nEzxVGmLbDWY5pfWTLqBcC2KZ6jyYvM4mQ=
 golang.org/x/tools v0.0.0-20190114222345-bf090417da8b/go.mod h1:n7NCudcB/nEzxVGmLbDWY5pfWTLqBcC2KZ6jyYvM4mQ=
 golang.org/x/tools v0.0.0-20190226205152-f727befe758c/go.mod h1:9Yl7xja0Znq3iFh3HoIrodX9oNMXvdceNzlUR8zjMvY=

vendor/blitter.com/go/hopscotch/hopscotch.go

@@ -25,10 +25,11 @@ import (
 	_ "crypto/sha512"
 
 	b2b "golang.org/x/crypto/blake2b"
+	groestl "blitter.com/go/groestl"
 )
 
 const (
-	maxResched = 10 // above 20 starts to show outlines in 'tuxtest' ... so 10 max
+	maxResched = 99 // above 20 starts to show outlines in 'tuxtest' ... so 10 max
 )
 
 type Cipher struct {
@@ -71,9 +72,10 @@ func New(r io.Reader, w io.Writer, resched int, key []byte) (c *Cipher) {
 	}
 
 	// Init all the hash algs we're going to 'hop' around with initial keystream
-	c.h = make([]hash.Hash, 2)
+	c.h = make([]hash.Hash, 3)
 	c.h[0] = sha512.New()
 	c.h[1], _ = b2b.New512(c.k)
+	c.h[2] = groestl.New512()
 	c.keyUpdate(c.k)
 
 	c.rekeyCtr = len(c.hs) * c.resched // lower multiplier == greater security, lower speed
@@ -109,6 +111,11 @@ func (c *Cipher) keyUpdate(data []byte) {
 		sliceTmp := b2b.Sum512(data)
 		c.hs = append(c.hs, sliceTmp[:]...)
 	}
+	{
+		c.h[2].Write(data)
+		sliceTmp := groestl.Sum512(data)
+		c.hs = append(c.hs, sliceTmp[:]...)
+	}
 }
 
 func (c *Cipher) yield(ib byte) (ob byte) {
@@ -118,25 +125,38 @@ func (c *Cipher) yield(ib byte) (ob byte) {
 	//fmt.Fprintf(os.Stderr, "[c.hidx:%v c.idx:%v]\n", c.hidx, c.idx)
 
 	// NOTE: using a non-prime modulus degrades CV % from ~ 0.055 to ~ 0.07
-	switch c.ctr % 3 {
+	switch c.ctr % 5 {
 	case 0:
 		ob = c.bTmp ^ ib ^ byte(c.ctr) ^ byte(c.idx) ^
 			c.hs[len(c.hs)-19] ^ c.hs[len(c.hs)-2] ^ c.hs[len(c.hs)-3] ^ c.hs[len(c.hs)-5] ^
-			c.hs[len(c.hs)-7] ^ c.hs[len(c.hs)-11] ^ c.hs[len(c.hs)-13] ^ c.hs[len(c.hs)-17]
+			c.hs[len(c.hs)-7] ^ c.hs[len(c.hs)-11] ^ c.hs[len(c.hs)-13] ^ c.hs[len(c.hs)-17] ^
+			c.hs[len(c.hs)-47] ^ c.hs[len(c.hs)-43] ^ c.hs[len(c.hs)-41] ^ c.hs[len(c.hs)-39]
 
 	case 1:
 		ob = c.bTmp ^ ib ^ byte(c.ctr) ^ byte(c.idx) ^
 			c.hs[len(c.hs)-5] ^ c.hs[len(c.hs)-7] ^ c.hs[len(c.hs)-11] ^ c.hs[len(c.hs)-13] ^
-			c.hs[len(c.hs)-17] ^ c.hs[len(c.hs)-19] ^ c.hs[len(c.hs)-23] ^ c.hs[len(c.hs)-29]
+			c.hs[len(c.hs)-17] ^ c.hs[len(c.hs)-19] ^ c.hs[len(c.hs)-23] ^ c.hs[len(c.hs)-29] ^
+			c.hs[len(c.hs)-43] ^ c.hs[len(c.hs)-41] ^ c.hs[len(c.hs)-39] ^ c.hs[len(c.hs)-37]
 
 	case 2:
 		ob = c.bTmp ^ ib ^ byte(c.ctr) ^ byte(c.idx) ^
 			c.hs[len(c.hs)-13] ^ c.hs[len(c.hs)-17] ^ c.hs[len(c.hs)-23] ^ c.hs[len(c.hs)-27] ^
-			c.hs[len(c.hs)-29] ^ c.hs[len(c.hs)-31] ^ c.hs[len(c.hs)-2] ^ c.hs[len(c.hs)-3]
+			c.hs[len(c.hs)-29] ^ c.hs[len(c.hs)-31] ^ c.hs[len(c.hs)-2] ^ c.hs[len(c.hs)-3] ^
+			c.hs[len(c.hs)-37] ^ c.hs[len(c.hs)-41] ^ c.hs[len(c.hs)-39] ^ c.hs[len(c.hs)-47]
+	case 3:
+		ob = c.bTmp ^ ib ^ byte(c.ctr) ^ byte(c.idx) ^
+			c.hs[len(c.hs)-13] ^ c.hs[len(c.hs)-17] ^ c.hs[len(c.hs)-23] ^ c.hs[len(c.hs)-27] ^
+			c.hs[len(c.hs)-29] ^ c.hs[len(c.hs)-31] ^ c.hs[len(c.hs)-5] ^ c.hs[len(c.hs)-3] ^
+			c.hs[len(c.hs)-43] ^ c.hs[len(c.hs)-41] ^ c.hs[len(c.hs)-39] ^ c.hs[len(c.hs)-37]
+	case 4:
+		ob = c.bTmp ^ ib ^ byte(c.ctr) ^ byte(c.idx) ^
+			c.hs[len(c.hs)-13] ^ c.hs[len(c.hs)-17] ^ c.hs[len(c.hs)-23] ^ c.hs[len(c.hs)-27] ^
+			c.hs[len(c.hs)-29] ^ c.hs[len(c.hs)-31] ^ c.hs[len(c.hs)-7] ^ c.hs[len(c.hs)-3] ^
+			c.hs[len(c.hs)-33] ^ c.hs[len(c.hs)-41] ^ c.hs[len(c.hs)-45] ^ c.hs[len(c.hs)-43]
 	}
 
 	if c.ctr%c.rekeyCtr == 0 {
-		bufTmp := make([]byte, 32)
+		bufTmp := make([]byte, 16*3)
 		_, _ = c.prng.Read(bufTmp)
 		c.keyUpdate(bufTmp)
 	}

vendor/github.com/klauspost/cpuid/v2/.travis.yml

@@ -1,67 +0,0 @@
-language: go
-
-os:
-  - linux
-  - osx
-  - windows
-
-arch:
-  - amd64
-  - arm64
-
-go:
-  - 1.13.x
-  - 1.14.x
-  - 1.15.x
-  - 1.16.x
-  - master
-
-env:
-  - CGO_ENABLED=0
-
-script:
-  - go vet ./...
-  - go test -test.v -test.run ^TestCPUID$
-  - CGO_ENABLED=1 go test -race ./...
-  - go test -tags=nounsafe -test.v -test.run ^TestCPUID$
-  - go test -tags=noasm ./...
-  - go run ./cmd/cpuid/main.go
-  - go run ./cmd/cpuid/main.go -json
-
-matrix:
-  allow_failures:
-    - go: 'master'
-  fast_finish: true
-  include:
-    - stage: other
-      go: 1.16.x
-      os: linux
-      arch: amd64
-      script:
-        - diff <(gofmt -d .) <(printf "")
-        - diff <(gofmt -d ./private) <(printf "")
-        - curl -sfL https://git.io/goreleaser | VERSION=v0.157.0 sh -s -- check # check goreleaser config for deprecations
-        - curl -sL https://git.io/goreleaser | VERSION=v0.157.0 sh -s -- --snapshot --skip-publish --rm-dist
-        - go get github.com/klauspost/asmfmt&&go install github.com/klauspost/asmfmt/cmd/asmfmt
-        - diff <(asmfmt -d .) <(printf "")
-        - GOOS=linux GOARCH=386 go test .
-        - ./test-architectures.sh
-    - stage: other
-      go: 1.15.x
-      os: linux
-      arch: amd64
-      script:
-        - ./test-architectures.sh
-
-deploy:
-  - provider: script
-    skip_cleanup: true
-    script: curl -sL https://git.io/goreleaser | VERSION=v0.157.0 bash || true
-    on:
-      tags: true
-      condition: ($TRAVIS_OS_NAME = linux) && ($TRAVIS_CPU_ARCH = amd64)
-      go: 1.16.x
-branches:
-  only:
-    - master
-    - /^v\d+\.\d+(\.\d+)?(-\S*)?$/

vendor/github.com/klauspost/cpuid/v2/README.md

@@ -39,10 +39,10 @@ func main() {
 	fmt.Println("ThreadsPerCore:", CPU.ThreadsPerCore)
 	fmt.Println("LogicalCores:", CPU.LogicalCores)
 	fmt.Println("Family", CPU.Family, "Model:", CPU.Model, "Vendor ID:", CPU.VendorID)
-	fmt.Println("Features:", fmt.Sprintf(strings.Join(CPU.FeatureSet(), ",")))
+	fmt.Println("Features:", strings.Join(CPU.FeatureSet(), ","))
 	fmt.Println("Cacheline bytes:", CPU.CacheLine)
 	fmt.Println("L1 Data Cache:", CPU.Cache.L1D, "bytes")
-	fmt.Println("L1 Instruction Cache:", CPU.Cache.L1D, "bytes")
+	fmt.Println("L1 Instruction Cache:", CPU.Cache.L1I, "bytes")
 	fmt.Println("L2 Cache:", CPU.Cache.L2, "bytes")
 	fmt.Println("L3 Cache:", CPU.Cache.L3, "bytes")
 	fmt.Println("Frequency", CPU.Hz, "hz")
@@ -132,6 +132,127 @@ func main() {
 }
 ```
 
+## commandline
+
+Download as binary from: https://github.com/klauspost/cpuid/releases
+
+Install from source:
+
+`go install github.com/klauspost/cpuid/v2/cmd/cpuid@latest`
+
+### Example
+
+```
+λ cpuid
+Name: AMD Ryzen 9 3950X 16-Core Processor
+Vendor String: AuthenticAMD
+Vendor ID: AMD
+PhysicalCores: 16
+Threads Per Core: 2
+Logical Cores: 32
+CPU Family 23 Model: 113
+Features: ADX,AESNI,AVX,AVX2,BMI1,BMI2,CLMUL,CLZERO,CMOV,CMPXCHG8,CPBOOST,CX16,F16C,FMA3,FXSR,FXSROPT,HTT,HYPERVISOR,LAHF,LZCNT,MCAOVERFLOW,MMX,MMXEXT,MOVBE,NX,OSXSAVE,POPCNT,RDRAND,RDSEED,RDTSCP,SCE,SHA,SSE,SSE2,SSE3,SSE4,SSE42,SSE4A,SSSE3,SUCCOR,X87,XSAVE
+Microarchitecture level: 3
+Cacheline bytes: 64
+L1 Instruction Cache: 32768 bytes
+L1 Data Cache: 32768 bytes
+L2 Cache: 524288 bytes
+L3 Cache: 16777216 bytes
+
+```
+### JSON Output:
+
+```
+λ cpuid --json
+{
+  "BrandName": "AMD Ryzen 9 3950X 16-Core Processor",
+  "VendorID": 2,
+  "VendorString": "AuthenticAMD",
+  "PhysicalCores": 16,
+  "ThreadsPerCore": 2,
+  "LogicalCores": 32,
+  "Family": 23,
+  "Model": 113,
+  "CacheLine": 64,
+  "Hz": 0,
+  "BoostFreq": 0,
+  "Cache": {
+    "L1I": 32768,
+    "L1D": 32768,
+    "L2": 524288,
+    "L3": 16777216
+  },
+  "SGX": {
+    "Available": false,
+    "LaunchControl": false,
+    "SGX1Supported": false,
+    "SGX2Supported": false,
+    "MaxEnclaveSizeNot64": 0,
+    "MaxEnclaveSize64": 0,
+    "EPCSections": null
+  },
+  "Features": [
+    "ADX",
+    "AESNI",
+    "AVX",
+    "AVX2",
+    "BMI1",
+    "BMI2",
+    "CLMUL",
+    "CLZERO",
+    "CMOV",
+    "CMPXCHG8",
+    "CPBOOST",
+    "CX16",
+    "F16C",
+    "FMA3",
+    "FXSR",
+    "FXSROPT",
+    "HTT",
+    "HYPERVISOR",
+    "LAHF",
+    "LZCNT",
+    "MCAOVERFLOW",
+    "MMX",
+    "MMXEXT",
+    "MOVBE",
+    "NX",
+    "OSXSAVE",
+    "POPCNT",
+    "RDRAND",
+    "RDSEED",
+    "RDTSCP",
+    "SCE",
+    "SHA",
+    "SSE",
+    "SSE2",
+    "SSE3",
+    "SSE4",
+    "SSE42",
+    "SSE4A",
+    "SSSE3",
+    "SUCCOR",
+    "X87",
+    "XSAVE"
+  ],
+  "X64Level": 3
+}
+```
+
+### Check CPU microarch level
+
+```
+λ cpuid --check-level=3
+2022/03/18 17:04:40 AMD Ryzen 9 3950X 16-Core Processor
+2022/03/18 17:04:40 Microarchitecture level 3 is supported. Max level is 3.
+Exit Code 0
+
+λ cpuid --check-level=4
+2022/03/18 17:06:18 AMD Ryzen 9 3950X 16-Core Processor
+2022/03/18 17:06:18 Microarchitecture level 4 not supported. Max level is 3.
+Exit Code 1
+```
+
 # license
 
 This code is published under an MIT license. See LICENSE file for more information.

vendor/github.com/klauspost/cpuid/v2/cpuid.go

@@ -14,6 +14,7 @@ import (
 	"flag"
 	"fmt"
 	"math"
+	"math/bits"
 	"os"
 	"runtime"
 	"strings"
@@ -83,6 +84,7 @@ const (
 	AVX512DQ                            // AVX-512 Doubleword and Quadword Instructions
 	AVX512ER                            // AVX-512 Exponential and Reciprocal Instructions
 	AVX512F                             // AVX-512 Foundation
+	AVX512FP16                          // AVX-512 FP16 Instructions
 	AVX512IFMA                          // AVX-512 Integer Fused Multiply-Add Instructions
 	AVX512PF                            // AVX-512 Prefetch Instructions
 	AVX512VBMI                          // AVX-512 Vector Bit Manipulation Instructions
@@ -91,21 +93,32 @@ const (
 	AVX512VNNI                          // AVX-512 Vector Neural Network Instructions
 	AVX512VP2INTERSECT                  // AVX-512 Intersect for D/Q
 	AVX512VPOPCNTDQ                     // AVX-512 Vector Population Count Doubleword and Quadword
-	AVXSLOW                             // Indicates the CPU performs 2 128 bit operations instead of one.
+	AVXSLOW                             // Indicates the CPU performs 2 128 bit operations instead of one
+	AVXVNNI                             // AVX (VEX encoded) VNNI neural network instructions
 	BMI1                                // Bit Manipulation Instruction Set 1
 	BMI2                                // Bit Manipulation Instruction Set 2
+	CETIBT                              // Intel CET Indirect Branch Tracking
+	CETSS                               // Intel CET Shadow Stack
 	CLDEMOTE                            // Cache Line Demote
 	CLMUL                               // Carry-less Multiplication
+	CLZERO                              // CLZERO instruction supported
 	CMOV                                // i686 CMOV
+	CMPSB_SCADBS_SHORT                  // Fast short CMPSB and SCASB
+	CMPXCHG8                            // CMPXCHG8 instruction
+	CPBOOST                             // Core Performance Boost
 	CX16                                // CMPXCHG16B Instruction
 	ENQCMD                              // Enqueue Command
 	ERMS                                // Enhanced REP MOVSB/STOSB
 	F16C                                // Half-precision floating-point conversion
 	FMA3                                // Intel FMA 3. Does not imply AVX.
 	FMA4                                // Bulldozer FMA4 functions
-	GFNI                                // Galois Field New Instructions
+	FXSR                                // FXSAVE, FXRESTOR instructions, CR4 bit 9
+	FXSROPT                             // FXSAVE/FXRSTOR optimizations
+	GFNI                                // Galois Field New Instructions. May require other features (AVX, AVX512VL,AVX512F) based on usage.
 	HLE                                 // Hardware Lock Elision
+	HRESET                              // If set CPU supports history reset and the IA32_HRESET_ENABLE MSR
 	HTT                                 // Hyperthreading (enabled)
+	HWA                                 // Hardware assert supported. Indicates support for MSRC001_10
 	HYPERVISOR                          // This bit has been reserved by Intel & AMD for use by hypervisors
 	IBPB                                // Indirect Branch Restricted Speculation (IBRS) and Indirect Branch Predictor Barrier (IBPB)
 	IBS                                 // Instruction Based Sampling (AMD)
@@ -117,22 +130,48 @@ const (
 	IBSOPSAM                            // Instruction Based Sampling Feature (AMD)
 	IBSRDWROPCNT                        // Instruction Based Sampling Feature (AMD)
 	IBSRIPINVALIDCHK                    // Instruction Based Sampling Feature (AMD)
+	IBS_PREVENTHOST                     // Disallowing IBS use by the host supported
+	INT_WBINVD                          // WBINVD/WBNOINVD are interruptible.
+	INVLPGB                             // NVLPGB and TLBSYNC instruction supported
+	LAHF                                // LAHF/SAHF in long mode
+	LAM                                 // If set, CPU supports Linear Address Masking
+	LBRVIRT                             // LBR virtualization
 	LZCNT                               // LZCNT instruction
+	MCAOVERFLOW                         // MCA overflow recovery support.
+	MCOMMIT                             // MCOMMIT instruction supported
 	MMX                                 // standard MMX
 	MMXEXT                              // SSE integer functions or AMD MMX ext
+	MOVBE                               // MOVBE instruction (big-endian)
 	MOVDIR64B                           // Move 64 Bytes as Direct Store
 	MOVDIRI                             // Move Doubleword as Direct Store
+	MOVSB_ZL                            // Fast Zero-Length MOVSB
 	MPX                                 // Intel MPX (Memory Protection Extensions)
+	MSRIRC                              // Instruction Retired Counter MSR available
+	MSR_PAGEFLUSH                       // Page Flush MSR available
+	NRIPS                               // Indicates support for NRIP save on VMEXIT
 	NX                                  // NX (No-Execute) bit
+	OSXSAVE                             // XSAVE enabled by OS
+	PCONFIG                             // PCONFIG for Intel Multi-Key Total Memory Encryption
 	POPCNT                              // POPCNT instruction
+	RDPRU                               // RDPRU instruction supported
 	RDRAND                              // RDRAND instruction is available
 	RDSEED                              // RDSEED instruction is available
 	RDTSCP                              // RDTSCP Instruction
 	RTM                                 // Restricted Transactional Memory
+	RTM_ALWAYS_ABORT                    // Indicates that the loaded microcode is forcing RTM abort.
 	SERIALIZE                           // Serialize Instruction Execution
+	SEV                                 // AMD Secure Encrypted Virtualization supported
+	SEV_64BIT                           // AMD SEV guest execution only allowed from a 64-bit host
+	SEV_ALTERNATIVE                     // AMD SEV Alternate Injection supported
+	SEV_DEBUGSWAP                       // Full debug state swap supported for SEV-ES guests
+	SEV_ES                              // AMD SEV Encrypted State supported
+	SEV_RESTRICTED                      // AMD SEV Restricted Injection supported
+	SEV_SNP                             // AMD SEV Secure Nested Paging supported
 	SGX                                 // Software Guard Extensions
 	SGXLC                               // Software Guard Extensions Launch Control
 	SHA                                 // Intel SHA Extensions
+	SME                                 // AMD Secure Memory Encryption supported
+	SME_COHERENT                        // AMD Hardware cache coherency across encryption domains enforced
 	SSE                                 // SSE functions
 	SSE2                                // P4 SSE functions
 	SSE3                                // Prescott SSE3 functions
@@ -141,14 +180,38 @@ const (
 	SSE4A                               // AMD Barcelona microarchitecture SSE4a instructions
 	SSSE3                               // Conroe SSSE3 functions
 	STIBP                               // Single Thread Indirect Branch Predictors
+	STOSB_SHORT                         // Fast short STOSB
+	SUCCOR                              // Software uncorrectable error containment and recovery capability.
+	SVM                                 // AMD Secure Virtual Machine
+	SVMDA                               // Indicates support for the SVM decode assists.
+	SVMFBASID                           // SVM, Indicates that TLB flush events, including CR3 writes and CR4.PGE toggles, flush only the current ASID's TLB entries. Also indicates support for the extended VMCBTLB_Control
+	SVML                                // AMD SVM lock. Indicates support for SVM-Lock.
+	SVMNP                               // AMD SVM nested paging
+	SVMPF                               // SVM pause intercept filter. Indicates support for the pause intercept filter
+	SVMPFT                              // SVM PAUSE filter threshold. Indicates support for the PAUSE filter cycle count threshold
+	SYSCALL                             // System-Call Extension (SCE): SYSCALL and SYSRET instructions.
+	SYSEE                               // SYSENTER and SYSEXIT instructions
 	TBM                                 // AMD Trailing Bit Manipulation
+	TOPEXT                              // TopologyExtensions: topology extensions support. Indicates support for CPUID Fn8000_001D_EAX_x[N:0]-CPUID Fn8000_001E_EDX.
+	TME                                 // Intel Total Memory Encryption. The following MSRs are supported: IA32_TME_CAPABILITY, IA32_TME_ACTIVATE, IA32_TME_EXCLUDE_MASK, and IA32_TME_EXCLUDE_BASE.
+	TSCRATEMSR                          // MSR based TSC rate control. Indicates support for MSR TSC ratio MSRC000_0104
 	TSXLDTRK                            // Intel TSX Suspend Load Address Tracking
-	VAES                                // Vector AES
+	VAES                                // Vector AES. AVX(512) versions requires additional checks.
+	VMCBCLEAN                           // VMCB clean bits. Indicates support for VMCB clean bits.
+	VMPL                                // AMD VM Permission Levels supported
+	VMSA_REGPROT                        // AMD VMSA Register Protection supported
 	VMX                                 // Virtual Machine Extensions
-	VPCLMULQDQ                          // Carry-Less Multiplication Quadword
+	VPCLMULQDQ                          // Carry-Less Multiplication Quadword. Requires AVX for 3 register versions.
+	VTE                                 // AMD Virtual Transparent Encryption supported
 	WAITPKG                             // TPAUSE, UMONITOR, UMWAIT
 	WBNOINVD                            // Write Back and Do Not Invalidate Cache
+	X87                                 // FPU
+	XGETBV1                             // Supports XGETBV with ECX = 1
 	XOP                                 // Bulldozer XOP functions
+	XSAVE                               // XSAVE, XRESTOR, XSETBV, XGETBV
+	XSAVEC                              // Supports XSAVEC and the compacted form of XRSTOR.
+	XSAVEOPT                            // XSAVEOPT available
+	XSAVES                              // Supports XSAVES/XRSTORS and IA32_XSS
 
 	// ARM features:
 	AESARM   // AES instructions
@@ -175,7 +238,6 @@ const (
 	SM3      // SM3 instructions
 	SM4      // SM4 instructions
 	SVE      // Scalable Vector Extension
-
 	// Keep it last. It automatically defines the size of []flagSet
 	lastID
 
@@ -193,8 +255,10 @@ type CPUInfo struct {
 	LogicalCores   int     // Number of physical cores times threads that can run on each core through the use of hyperthreading. Will be 0 if undetectable.
 	Family         int     // CPU family number
 	Model          int     // CPU model number
+	Stepping       int     // CPU stepping info
 	CacheLine      int     // Cache line size in bytes. Will be 0 if undetectable.
-	Hz             int64   // Clock speed, if known, 0 otherwise
+	Hz             int64   // Clock speed, if known, 0 otherwise. Will attempt to contain base clock speed.
+	BoostFreq      int64   // Max clock speed, if known, 0 otherwise
 	Cache          struct {
 		L1I int // L1 Instruction Cache (per core or shared). Will be -1 if undetected
 		L1D int // L1 Data Cache (per core or shared). Will be -1 if undetected
@@ -298,6 +362,41 @@ func (c CPUInfo) Has(id FeatureID) bool {
 	return c.featureSet.inSet(id)
 }
 
+// AnyOf returns whether the CPU supports one or more of the requested features.
+func (c CPUInfo) AnyOf(ids ...FeatureID) bool {
+	for _, id := range ids {
+		if c.featureSet.inSet(id) {
+			return true
+		}
+	}
+	return false
+}
+
+// https://en.wikipedia.org/wiki/X86-64#Microarchitecture_levels
+var level1Features = flagSetWith(CMOV, CMPXCHG8, X87, FXSR, MMX, SYSCALL, SSE, SSE2)
+var level2Features = flagSetWith(CMOV, CMPXCHG8, X87, FXSR, MMX, SYSCALL, SSE, SSE2, CX16, LAHF, POPCNT, SSE3, SSE4, SSE42, SSSE3)
+var level3Features = flagSetWith(CMOV, CMPXCHG8, X87, FXSR, MMX, SYSCALL, SSE, SSE2, CX16, LAHF, POPCNT, SSE3, SSE4, SSE42, SSSE3, AVX, AVX2, BMI1, BMI2, F16C, FMA3, LZCNT, MOVBE, OSXSAVE)
+var level4Features = flagSetWith(CMOV, CMPXCHG8, X87, FXSR, MMX, SYSCALL, SSE, SSE2, CX16, LAHF, POPCNT, SSE3, SSE4, SSE42, SSSE3, AVX, AVX2, BMI1, BMI2, F16C, FMA3, LZCNT, MOVBE, OSXSAVE, AVX512F, AVX512BW, AVX512CD, AVX512DQ, AVX512VL)
+
+// X64Level returns the microarchitecture level detected on the CPU.
+// If features are lacking or non x64 mode, 0 is returned.
+// See https://en.wikipedia.org/wiki/X86-64#Microarchitecture_levels
+func (c CPUInfo) X64Level() int {
+	if c.featureSet.hasSet(level4Features) {
+		return 4
+	}
+	if c.featureSet.hasSet(level3Features) {
+		return 3
+	}
+	if c.featureSet.hasSet(level2Features) {
+		return 2
+	}
+	if c.featureSet.hasSet(level1Features) {
+		return 1
+	}
+	return 0
+}
+
 // Disable will disable one or several features.
 func (c *CPUInfo) Disable(ids ...FeatureID) bool {
 	for _, id := range ids {
@@ -320,11 +419,10 @@ func (c CPUInfo) IsVendor(v Vendor) bool {
 	return c.VendorID == v
 }
 
+// FeatureSet returns all available features as strings.
 func (c CPUInfo) FeatureSet() []string {
-	s := make([]string, 0)
+	s := make([]string, 0, c.featureSet.nEnabled())
-	for _, f := range c.featureSet.Strings() {
+	s = append(s, c.featureSet.Strings()...)
-		s = append(s, f)
-	}
 	return s
 }
 
@@ -363,25 +461,42 @@ func (c CPUInfo) LogicalCPU() int {
 	return int(ebx >> 24)
 }
 
-// hertz tries to compute the clock speed of the CPU. If leaf 15 is
+// frequencies tries to compute the clock speed of the CPU. If leaf 15 is
 // supported, use it, otherwise parse the brand string. Yes, really.
-func hertz(model string) int64 {
+func (c *CPUInfo) frequencies() {
+	c.Hz, c.BoostFreq = 0, 0
 	mfi := maxFunctionID()
 	if mfi >= 0x15 {
 		eax, ebx, ecx, _ := cpuid(0x15)
 		if eax != 0 && ebx != 0 && ecx != 0 {
-			return int64((int64(ecx) * int64(ebx)) / int64(eax))
+			c.Hz = (int64(ecx) * int64(ebx)) / int64(eax)
 		}
 	}
+	if mfi >= 0x16 {
+		a, b, _, _ := cpuid(0x16)
+		// Base...
+		if a&0xffff > 0 {
+			c.Hz = int64(a&0xffff) * 1_000_000
+		}
+		// Boost...
+		if b&0xffff > 0 {
+			c.BoostFreq = int64(b&0xffff) * 1_000_000
+		}
+	}
+	if c.Hz > 0 {
+		return
+	}
+
 	// computeHz determines the official rated speed of a CPU from its brand
 	// string. This insanity is *actually the official documented way to do
 	// this according to Intel*, prior to leaf 0x15 existing. The official
 	// documentation only shows this working for exactly `x.xx` or `xxxx`
 	// cases, e.g., `2.50GHz` or `1300MHz`; this parser will accept other
 	// sizes.
+	model := c.BrandName
 	hz := strings.LastIndex(model, "Hz")
 	if hz < 3 {
-		return 0
+		return
 	}
 	var multiplier int64
 	switch model[hz-1] {
@@ -393,7 +508,7 @@ func hertz(model string) int64 {
 		multiplier = 1000 * 1000 * 1000 * 1000
 	}
 	if multiplier == 0 {
-		return 0
+		return
 	}
 	freq := int64(0)
 	divisor := int64(0)
@@ -405,21 +520,22 @@ func hertz(model string) int64 {
 			decimalShift *= 10
 		} else if model[i] == '.' {
 			if divisor != 0 {
-				return 0
+				return
 			}
 			divisor = decimalShift
 		} else {
-			return 0
+			return
 		}
 	}
 	// we didn't find a space
 	if i < 0 {
-		return 0
+		return
 	}
 	if divisor != 0 {
-		return (freq * multiplier) / divisor
+		c.Hz = (freq * multiplier) / divisor
+		return
 	}
-	return freq * multiplier
+	c.Hz = freq * multiplier
 }
 
 // VM Will return true if the cpu id indicates we are in
@@ -468,6 +584,32 @@ func (s *flagSet) or(other flagSet) {
 	}
 }
 
+// hasSet returns whether all features are present.
+func (s flagSet) hasSet(other flagSet) bool {
+	for i, v := range other[:] {
+		if s[i]&v != v {
+			return false
+		}
+	}
+	return true
+}
+
+// nEnabled will return the number of enabled flags.
+func (s flagSet) nEnabled() (n int) {
+	for _, v := range s[:] {
+		n += bits.OnesCount64(uint64(v))
+	}
+	return n
+}
+
+func flagSetWith(feat ...FeatureID) flagSet {
+	var res flagSet
+	for _, f := range feat {
+		res.set(f)
+	}
+	return res
+}
+
 // ParseFeature will parse the string and return the ID of the matching feature.
 // Will return UNKNOWN if not found.
 func ParseFeature(s string) FeatureID {
@@ -548,7 +690,7 @@ func threadsPerCore() int {
 		if vend == AMD {
 			// Workaround for AMD returning 0, assume 2 if >= Zen 2
 			// It will be more correct than not.
-			fam, _ := familyModel()
+			fam, _, _ := familyModel()
 			_, _, _, d := cpuid(1)
 			if (d&(1<<28)) != 0 && fam >= 23 {
 				return 2
@@ -586,14 +728,27 @@ func logicalCores() int {
 	}
 }
 
-func familyModel() (int, int) {
+func familyModel() (family, model, stepping int) {
 	if maxFunctionID() < 0x1 {
-		return 0, 0
+		return 0, 0, 0
 	}
 	eax, _, _, _ := cpuid(1)
-	family := ((eax >> 8) & 0xf) + ((eax >> 20) & 0xff)
+	// If BaseFamily[3:0] is less than Fh then ExtendedFamily[7:0] is reserved and Family is equal to BaseFamily[3:0].
-	model := ((eax >> 4) & 0xf) + ((eax >> 12) & 0xf0)
+	family = int((eax >> 8) & 0xf)
-	return int(family), int(model)
+	extFam := family == 0x6 // Intel is 0x6, needs extended model.
+	if family == 0xf {
+		// Add ExtFamily
+		family += int((eax >> 20) & 0xff)
+		extFam = true
+	}
+	// If BaseFamily[3:0] is less than 0Fh then ExtendedModel[3:0] is reserved and Model is equal to BaseModel[3:0].
+	model = int((eax >> 4) & 0xf)
+	if extFam {
+		// Add ExtModel
+		model += int((eax >> 12) & 0xf0)
+	}
+	stepping = int(eax & 0xf)
+	return family, model, stepping
 }
 
 func physicalCores() int {
@@ -677,6 +832,7 @@ func (c *CPUInfo) cacheSize() {
 		if maxFunctionID() < 4 {
 			return
 		}
+		c.Cache.L1I, c.Cache.L1D, c.Cache.L2, c.Cache.L3 = 0, 0, 0, 0
 		for i := uint32(0); ; i++ {
 			eax, ebx, ecx, _ := cpuidex(4, i)
 			cacheType := eax & 15
@@ -727,9 +883,14 @@ func (c *CPUInfo) cacheSize() {
 		c.Cache.L2 = int(((ecx >> 16) & 0xFFFF) * 1024)
 
 		// CPUID Fn8000_001D_EAX_x[N:0] Cache Properties
-		if maxExtendedFunction() < 0x8000001D {
+		if maxExtendedFunction() < 0x8000001D || !c.Has(TOPEXT) {
 			return
 		}
+
+		// Xen Hypervisor is buggy and returns the same entry no matter ECX value.
+		// Hack: When we encounter the same entry 100 times we break.
+		nSame := 0
+		var last uint32
 		for i := uint32(0); i < math.MaxUint32; i++ {
 			eax, ebx, ecx, _ := cpuidex(0x8000001D, i)
 
@@ -745,6 +906,16 @@ func (c *CPUInfo) cacheSize() {
 				return
 			}
 
+			// Check for the same value repeated.
+			comb := eax ^ ebx ^ ecx
+			if comb == last {
+				nSame++
+				if nSame == 100 {
+					return
+				}
+			}
+			last = comb
+
 			switch level {
 			case 1:
 				switch typ {
@@ -769,8 +940,6 @@ func (c *CPUInfo) cacheSize() {
 			}
 		}
 	}
-
-	return
 }
 
 type SGXEPCSection struct {
@@ -831,21 +1000,26 @@ func support() flagSet {
 	if mfi < 0x1 {
 		return fs
 	}
-	family, model := familyModel()
+	family, model, _ := familyModel()
 
 	_, _, c, d := cpuid(1)
+	fs.setIf((d&(1<<0)) != 0, X87)
+	fs.setIf((d&(1<<8)) != 0, CMPXCHG8)
+	fs.setIf((d&(1<<11)) != 0, SYSEE)
 	fs.setIf((d&(1<<15)) != 0, CMOV)
 	fs.setIf((d&(1<<23)) != 0, MMX)
-	fs.setIf((d&(1<<25)) != 0, MMXEXT)
+	fs.setIf((d&(1<<24)) != 0, FXSR)
+	fs.setIf((d&(1<<25)) != 0, FXSROPT)
 	fs.setIf((d&(1<<25)) != 0, SSE)
 	fs.setIf((d&(1<<26)) != 0, SSE2)
 	fs.setIf((c&1) != 0, SSE3)
 	fs.setIf((c&(1<<5)) != 0, VMX)
-	fs.setIf((c&0x00000200) != 0, SSSE3)
+	fs.setIf((c&(1<<9)) != 0, SSSE3)
-	fs.setIf((c&0x00080000) != 0, SSE4)
+	fs.setIf((c&(1<<19)) != 0, SSE4)
-	fs.setIf((c&0x00100000) != 0, SSE42)
+	fs.setIf((c&(1<<20)) != 0, SSE42)
 	fs.setIf((c&(1<<25)) != 0, AESNI)
 	fs.setIf((c&(1<<1)) != 0, CLMUL)
+	fs.setIf(c&(1<<22) != 0, MOVBE)
 	fs.setIf(c&(1<<23) != 0, POPCNT)
 	fs.setIf(c&(1<<30) != 0, RDRAND)
 
@@ -861,6 +1035,8 @@ func support() flagSet {
 	if vend == AMD && (d&(1<<28)) != 0 && mfi >= 4 {
 		fs.setIf(threadsPerCore() > 1, HTT)
 	}
+	fs.setIf(c&1<<26 != 0, XSAVE)
+	fs.setIf(c&1<<27 != 0, OSXSAVE)
 	// Check XGETBV/XSAVE (26), OXSAVE (27) and AVX (28) bits
 	const avxCheck = 1<<26 | 1<<27 | 1<<28
 	if c&avxCheck == avxCheck {
@@ -886,7 +1062,6 @@ func support() flagSet {
 	// Check AVX2, AVX2 requires OS support, but BMI1/2 don't.
 	if mfi >= 7 {
 		_, ebx, ecx, edx := cpuidex(7, 0)
-		eax1, _, _, _ := cpuidex(7, 1)
 		if fs.inSet(AVX) && (ebx&0x00000020) != 0 {
 			fs.set(AVX2)
 		}
@@ -903,19 +1078,38 @@ func support() flagSet {
 		fs.setIf(ebx&(1<<18) != 0, RDSEED)
 		fs.setIf(ebx&(1<<19) != 0, ADX)
 		fs.setIf(ebx&(1<<29) != 0, SHA)
+
 		// CPUID.(EAX=7, ECX=0).ECX
 		fs.setIf(ecx&(1<<5) != 0, WAITPKG)
+		fs.setIf(ecx&(1<<7) != 0, CETSS)
+		fs.setIf(ecx&(1<<8) != 0, GFNI)
+		fs.setIf(ecx&(1<<9) != 0, VAES)
+		fs.setIf(ecx&(1<<10) != 0, VPCLMULQDQ)
+		fs.setIf(ecx&(1<<13) != 0, TME)
 		fs.setIf(ecx&(1<<25) != 0, CLDEMOTE)
 		fs.setIf(ecx&(1<<27) != 0, MOVDIRI)
 		fs.setIf(ecx&(1<<28) != 0, MOVDIR64B)
 		fs.setIf(ecx&(1<<29) != 0, ENQCMD)
 		fs.setIf(ecx&(1<<30) != 0, SGXLC)
+
 		// CPUID.(EAX=7, ECX=0).EDX
+		fs.setIf(edx&(1<<11) != 0, RTM_ALWAYS_ABORT)
 		fs.setIf(edx&(1<<14) != 0, SERIALIZE)
 		fs.setIf(edx&(1<<16) != 0, TSXLDTRK)
+		fs.setIf(edx&(1<<18) != 0, PCONFIG)
+		fs.setIf(edx&(1<<20) != 0, CETIBT)
 		fs.setIf(edx&(1<<26) != 0, IBPB)
 		fs.setIf(edx&(1<<27) != 0, STIBP)
 
+		// CPUID.(EAX=7, ECX=1)
+		eax1, _, _, _ := cpuidex(7, 1)
+		fs.setIf(fs.inSet(AVX) && eax1&(1<<4) != 0, AVXVNNI)
+		fs.setIf(eax1&(1<<10) != 0, MOVSB_ZL)
+		fs.setIf(eax1&(1<<11) != 0, STOSB_SHORT)
+		fs.setIf(eax1&(1<<12) != 0, CMPSB_SCADBS_SHORT)
+		fs.setIf(eax1&(1<<22) != 0, HRESET)
+		fs.setIf(eax1&(1<<26) != 0, LAM)
+
 		// Only detect AVX-512 features if XGETBV is supported
 		if c&((1<<26)|(1<<27)) == (1<<26)|(1<<27) {
 			// Check for OS support
@@ -940,15 +1134,13 @@ func support() flagSet {
 				// ecx
 				fs.setIf(ecx&(1<<1) != 0, AVX512VBMI)
 				fs.setIf(ecx&(1<<6) != 0, AVX512VBMI2)
-				fs.setIf(ecx&(1<<8) != 0, GFNI)
-				fs.setIf(ecx&(1<<9) != 0, VAES)
-				fs.setIf(ecx&(1<<10) != 0, VPCLMULQDQ)
 				fs.setIf(ecx&(1<<11) != 0, AVX512VNNI)
 				fs.setIf(ecx&(1<<12) != 0, AVX512BITALG)
 				fs.setIf(ecx&(1<<14) != 0, AVX512VPOPCNTDQ)
 				// edx
 				fs.setIf(edx&(1<<8) != 0, AVX512VP2INTERSECT)
 				fs.setIf(edx&(1<<22) != 0, AMXBF16)
+				fs.setIf(edx&(1<<23) != 0, AVX512FP16)
 				fs.setIf(edx&(1<<24) != 0, AMXTILE)
 				fs.setIf(edx&(1<<25) != 0, AMXINT8)
 				// eax1 = CPUID.(EAX=7, ECX=1).EAX
@@ -956,33 +1148,91 @@ func support() flagSet {
 			}
 		}
 	}
-
+	// Processor Extended State Enumeration Sub-leaf (EAX = 0DH, ECX = 1)
+	// EAX
+	// Bit 00: XSAVEOPT is available.
+	// Bit 01: Supports XSAVEC and the compacted form of XRSTOR if set.
+	// Bit 02: Supports XGETBV with ECX = 1 if set.
+	// Bit 03: Supports XSAVES/XRSTORS and IA32_XSS if set.
+	// Bits 31 - 04: Reserved.
+	// EBX
+	// Bits 31 - 00: The size in bytes of the XSAVE area containing all states enabled by XCRO | IA32_XSS.
+	// ECX
+	// Bits 31 - 00: Reports the supported bits of the lower 32 bits of the IA32_XSS MSR. IA32_XSS[n] can be set to 1 only if ECX[n] is 1.
+	// EDX?
+	// Bits 07 - 00: Used for XCR0. Bit 08: PT state. Bit 09: Used for XCR0. Bits 12 - 10: Reserved. Bit 13: HWP state. Bits 31 - 14: Reserved.
+	if mfi >= 0xd {
+		if fs.inSet(XSAVE) {
+			eax, _, _, _ := cpuidex(0xd, 1)
+			fs.setIf(eax&(1<<0) != 0, XSAVEOPT)
+			fs.setIf(eax&(1<<1) != 0, XSAVEC)
+			fs.setIf(eax&(1<<2) != 0, XGETBV1)
+			fs.setIf(eax&(1<<3) != 0, XSAVES)
+		}
+	}
 	if maxExtendedFunction() >= 0x80000001 {
 		_, _, c, d := cpuid(0x80000001)
 		if (c & (1 << 5)) != 0 {
 			fs.set(LZCNT)
 			fs.set(POPCNT)
 		}
-		fs.setIf((c&(1<<10)) != 0, IBS)
+		// ECX
-		fs.setIf((d&(1<<31)) != 0, AMD3DNOW)
+		fs.setIf((c&(1<<0)) != 0, LAHF)
-		fs.setIf((d&(1<<30)) != 0, AMD3DNOWEXT)
+		fs.setIf((c&(1<<2)) != 0, SVM)
-		fs.setIf((d&(1<<23)) != 0, MMX)
-		fs.setIf((d&(1<<22)) != 0, MMXEXT)
 		fs.setIf((c&(1<<6)) != 0, SSE4A)
+		fs.setIf((c&(1<<10)) != 0, IBS)
+		fs.setIf((c&(1<<22)) != 0, TOPEXT)
+
+		// EDX
+		fs.setIf(d&(1<<11) != 0, SYSCALL)
 		fs.setIf(d&(1<<20) != 0, NX)
+		fs.setIf(d&(1<<22) != 0, MMXEXT)
+		fs.setIf(d&(1<<23) != 0, MMX)
+		fs.setIf(d&(1<<24) != 0, FXSR)
+		fs.setIf(d&(1<<25) != 0, FXSROPT)
 		fs.setIf(d&(1<<27) != 0, RDTSCP)
+		fs.setIf(d&(1<<30) != 0, AMD3DNOWEXT)
+		fs.setIf(d&(1<<31) != 0, AMD3DNOW)
 
 		/* XOP and FMA4 use the AVX instruction coding scheme, so they can't be
 		 * used unless the OS has AVX support. */
 		if fs.inSet(AVX) {
-			fs.setIf((c&0x00000800) != 0, XOP)
+			fs.setIf((c&(1<<11)) != 0, XOP)
-			fs.setIf((c&0x00010000) != 0, FMA4)
+			fs.setIf((c&(1<<16)) != 0, FMA4)
 		}
 
 	}
+	if maxExtendedFunction() >= 0x80000007 {
+		_, b, _, d := cpuid(0x80000007)
+		fs.setIf((b&(1<<0)) != 0, MCAOVERFLOW)
+		fs.setIf((b&(1<<1)) != 0, SUCCOR)
+		fs.setIf((b&(1<<2)) != 0, HWA)
+		fs.setIf((d&(1<<9)) != 0, CPBOOST)
+	}
+
 	if maxExtendedFunction() >= 0x80000008 {
 		_, b, _, _ := cpuid(0x80000008)
 		fs.setIf((b&(1<<9)) != 0, WBNOINVD)
+		fs.setIf((b&(1<<8)) != 0, MCOMMIT)
+		fs.setIf((b&(1<<13)) != 0, INT_WBINVD)
+		fs.setIf((b&(1<<4)) != 0, RDPRU)
+		fs.setIf((b&(1<<3)) != 0, INVLPGB)
+		fs.setIf((b&(1<<1)) != 0, MSRIRC)
+		fs.setIf((b&(1<<0)) != 0, CLZERO)
+	}
+
+	if fs.inSet(SVM) && maxExtendedFunction() >= 0x8000000A {
+		_, _, _, edx := cpuid(0x8000000A)
+		fs.setIf((edx>>0)&1 == 1, SVMNP)
+		fs.setIf((edx>>1)&1 == 1, LBRVIRT)
+		fs.setIf((edx>>2)&1 == 1, SVML)
+		fs.setIf((edx>>3)&1 == 1, NRIPS)
+		fs.setIf((edx>>4)&1 == 1, TSCRATEMSR)
+		fs.setIf((edx>>5)&1 == 1, VMCBCLEAN)
+		fs.setIf((edx>>6)&1 == 1, SVMFBASID)
+		fs.setIf((edx>>7)&1 == 1, SVMDA)
+		fs.setIf((edx>>10)&1 == 1, SVMPF)
+		fs.setIf((edx>>12)&1 == 1, SVMPFT)
 	}
 
 	if maxExtendedFunction() >= 0x8000001b && fs.inSet(IBS) {
@@ -997,6 +1247,24 @@ func support() flagSet {
 		fs.setIf((eax>>7)&1 == 1, IBSRIPINVALIDCHK)
 	}
 
+	if maxExtendedFunction() >= 0x8000001f && vend == AMD {
+		a, _, _, _ := cpuid(0x8000001f)
+		fs.setIf((a>>0)&1 == 1, SME)
+		fs.setIf((a>>1)&1 == 1, SEV)
+		fs.setIf((a>>2)&1 == 1, MSR_PAGEFLUSH)
+		fs.setIf((a>>3)&1 == 1, SEV_ES)
+		fs.setIf((a>>4)&1 == 1, SEV_SNP)
+		fs.setIf((a>>5)&1 == 1, VMPL)
+		fs.setIf((a>>10)&1 == 1, SME_COHERENT)
+		fs.setIf((a>>11)&1 == 1, SEV_64BIT)
+		fs.setIf((a>>12)&1 == 1, SEV_RESTRICTED)
+		fs.setIf((a>>13)&1 == 1, SEV_ALTERNATIVE)
+		fs.setIf((a>>14)&1 == 1, SEV_DEBUGSWAP)
+		fs.setIf((a>>15)&1 == 1, IBS_PREVENTHOST)
+		fs.setIf((a>>16)&1 == 1, VTE)
+		fs.setIf((a>>24)&1 == 1, VMSA_REGPROT)
+	}
+
 	return fs
 }
 

vendor/github.com/klauspost/cpuid/v2/detect_arm64.go

@@ -1,6 +1,7 @@
 // Copyright (c) 2015 Klaus Post, released under MIT License. See LICENSE file.
 
-//+build arm64,!gccgo,!noasm,!appengine
+//go:build arm64 && !gccgo && !noasm && !appengine
+// +build arm64,!gccgo,!noasm,!appengine
 
 package cpuid
 

vendor/github.com/klauspost/cpuid/v2/detect_ref.go

@@ -1,6 +1,7 @@
 // Copyright (c) 2015 Klaus Post, released under MIT License. See LICENSE file.
 
-//+build !amd64,!386,!arm64 gccgo noasm appengine
+//go:build (!amd64 && !386 && !arm64) || gccgo || noasm || appengine
+// +build !amd64,!386,!arm64 gccgo noasm appengine
 
 package cpuid
 

vendor/github.com/klauspost/cpuid/v2/detect_x86.go

@@ -1,6 +1,7 @@
 // Copyright (c) 2015 Klaus Post, released under MIT License. See LICENSE file.
 
-//+build 386,!gccgo,!noasm,!appengine amd64,!gccgo,!noasm,!appengine
+//go:build (386 && !gccgo && !noasm && !appengine) || (amd64 && !gccgo && !noasm && !appengine)
+// +build 386,!gccgo,!noasm,!appengine amd64,!gccgo,!noasm,!appengine
 
 package cpuid
 
@@ -23,13 +24,13 @@ func addInfo(c *CPUInfo, safe bool) {
 	c.maxExFunc = maxExtendedFunction()
 	c.BrandName = brandName()
 	c.CacheLine = cacheLine()
-	c.Family, c.Model = familyModel()
+	c.Family, c.Model, c.Stepping = familyModel()
 	c.featureSet = support()
 	c.SGX = hasSGX(c.featureSet.inSet(SGX), c.featureSet.inSet(SGXLC))
 	c.ThreadsPerCore = threadsPerCore()
 	c.LogicalCores = logicalCores()
 	c.PhysicalCores = physicalCores()
 	c.VendorID, c.VendorString = vendorID()
-	c.Hz = hertz(c.BrandName)
 	c.cacheSize()
+	c.frequencies()
 }

vendor/github.com/klauspost/cpuid/v2/featureid_string.go

@@ -24,103 +24,165 @@ func _() {
 	_ = x[AVX512DQ-14]
 	_ = x[AVX512ER-15]
 	_ = x[AVX512F-16]
-	_ = x[AVX512IFMA-17]
+	_ = x[AVX512FP16-17]
-	_ = x[AVX512PF-18]
+	_ = x[AVX512IFMA-18]
-	_ = x[AVX512VBMI-19]
+	_ = x[AVX512PF-19]
-	_ = x[AVX512VBMI2-20]
+	_ = x[AVX512VBMI-20]
-	_ = x[AVX512VL-21]
+	_ = x[AVX512VBMI2-21]
-	_ = x[AVX512VNNI-22]
+	_ = x[AVX512VL-22]
-	_ = x[AVX512VP2INTERSECT-23]
+	_ = x[AVX512VNNI-23]
-	_ = x[AVX512VPOPCNTDQ-24]
+	_ = x[AVX512VP2INTERSECT-24]
-	_ = x[AVXSLOW-25]
+	_ = x[AVX512VPOPCNTDQ-25]
-	_ = x[BMI1-26]
+	_ = x[AVXSLOW-26]
-	_ = x[BMI2-27]
+	_ = x[AVXVNNI-27]
-	_ = x[CLDEMOTE-28]
+	_ = x[BMI1-28]
-	_ = x[CLMUL-29]
+	_ = x[BMI2-29]
-	_ = x[CMOV-30]
+	_ = x[CETIBT-30]
-	_ = x[CX16-31]
+	_ = x[CETSS-31]
-	_ = x[ENQCMD-32]
+	_ = x[CLDEMOTE-32]
-	_ = x[ERMS-33]
+	_ = x[CLMUL-33]
-	_ = x[F16C-34]
+	_ = x[CLZERO-34]
-	_ = x[FMA3-35]
+	_ = x[CMOV-35]
-	_ = x[FMA4-36]
+	_ = x[CMPSB_SCADBS_SHORT-36]
-	_ = x[GFNI-37]
+	_ = x[CMPXCHG8-37]
-	_ = x[HLE-38]
+	_ = x[CPBOOST-38]
-	_ = x[HTT-39]
+	_ = x[CX16-39]
-	_ = x[HYPERVISOR-40]
+	_ = x[ENQCMD-40]
-	_ = x[IBPB-41]
+	_ = x[ERMS-41]
-	_ = x[IBS-42]
+	_ = x[F16C-42]
-	_ = x[IBSBRNTRGT-43]
+	_ = x[FMA3-43]
-	_ = x[IBSFETCHSAM-44]
+	_ = x[FMA4-44]
-	_ = x[IBSFFV-45]
+	_ = x[FXSR-45]
-	_ = x[IBSOPCNT-46]
+	_ = x[FXSROPT-46]
-	_ = x[IBSOPCNTEXT-47]
+	_ = x[GFNI-47]
-	_ = x[IBSOPSAM-48]
+	_ = x[HLE-48]
-	_ = x[IBSRDWROPCNT-49]
+	_ = x[HRESET-49]
-	_ = x[IBSRIPINVALIDCHK-50]
+	_ = x[HTT-50]
-	_ = x[LZCNT-51]
+	_ = x[HWA-51]
-	_ = x[MMX-52]
+	_ = x[HYPERVISOR-52]
-	_ = x[MMXEXT-53]
+	_ = x[IBPB-53]
-	_ = x[MOVDIR64B-54]
+	_ = x[IBS-54]
-	_ = x[MOVDIRI-55]
+	_ = x[IBSBRNTRGT-55]
-	_ = x[MPX-56]
+	_ = x[IBSFETCHSAM-56]
-	_ = x[NX-57]
+	_ = x[IBSFFV-57]
-	_ = x[POPCNT-58]
+	_ = x[IBSOPCNT-58]
-	_ = x[RDRAND-59]
+	_ = x[IBSOPCNTEXT-59]
-	_ = x[RDSEED-60]
+	_ = x[IBSOPSAM-60]
-	_ = x[RDTSCP-61]
+	_ = x[IBSRDWROPCNT-61]
-	_ = x[RTM-62]
+	_ = x[IBSRIPINVALIDCHK-62]
-	_ = x[SERIALIZE-63]
+	_ = x[IBS_PREVENTHOST-63]
-	_ = x[SGX-64]
+	_ = x[INT_WBINVD-64]
-	_ = x[SGXLC-65]
+	_ = x[INVLPGB-65]
-	_ = x[SHA-66]
+	_ = x[LAHF-66]
-	_ = x[SSE-67]
+	_ = x[LAM-67]
-	_ = x[SSE2-68]
+	_ = x[LBRVIRT-68]
-	_ = x[SSE3-69]
+	_ = x[LZCNT-69]
-	_ = x[SSE4-70]
+	_ = x[MCAOVERFLOW-70]
-	_ = x[SSE42-71]
+	_ = x[MCOMMIT-71]
-	_ = x[SSE4A-72]
+	_ = x[MMX-72]
-	_ = x[SSSE3-73]
+	_ = x[MMXEXT-73]
-	_ = x[STIBP-74]
+	_ = x[MOVBE-74]
-	_ = x[TBM-75]
+	_ = x[MOVDIR64B-75]
-	_ = x[TSXLDTRK-76]
+	_ = x[MOVDIRI-76]
-	_ = x[VAES-77]
+	_ = x[MOVSB_ZL-77]
-	_ = x[VMX-78]
+	_ = x[MPX-78]
-	_ = x[VPCLMULQDQ-79]
+	_ = x[MSRIRC-79]
-	_ = x[WAITPKG-80]
+	_ = x[MSR_PAGEFLUSH-80]
-	_ = x[WBNOINVD-81]
+	_ = x[NRIPS-81]
-	_ = x[XOP-82]
+	_ = x[NX-82]
-	_ = x[AESARM-83]
+	_ = x[OSXSAVE-83]
-	_ = x[ARMCPUID-84]
+	_ = x[PCONFIG-84]
-	_ = x[ASIMD-85]
+	_ = x[POPCNT-85]
-	_ = x[ASIMDDP-86]
+	_ = x[RDPRU-86]
-	_ = x[ASIMDHP-87]
+	_ = x[RDRAND-87]
-	_ = x[ASIMDRDM-88]
+	_ = x[RDSEED-88]
-	_ = x[ATOMICS-89]
+	_ = x[RDTSCP-89]
-	_ = x[CRC32-90]
+	_ = x[RTM-90]
-	_ = x[DCPOP-91]
+	_ = x[RTM_ALWAYS_ABORT-91]
-	_ = x[EVTSTRM-92]
+	_ = x[SERIALIZE-92]
-	_ = x[FCMA-93]
+	_ = x[SEV-93]
-	_ = x[FP-94]
+	_ = x[SEV_64BIT-94]
-	_ = x[FPHP-95]
+	_ = x[SEV_ALTERNATIVE-95]
-	_ = x[GPA-96]
+	_ = x[SEV_DEBUGSWAP-96]
-	_ = x[JSCVT-97]
+	_ = x[SEV_ES-97]
-	_ = x[LRCPC-98]
+	_ = x[SEV_RESTRICTED-98]
-	_ = x[PMULL-99]
+	_ = x[SEV_SNP-99]
-	_ = x[SHA1-100]
+	_ = x[SGX-100]
-	_ = x[SHA2-101]
+	_ = x[SGXLC-101]
-	_ = x[SHA3-102]
+	_ = x[SHA-102]
-	_ = x[SHA512-103]
+	_ = x[SME-103]
-	_ = x[SM3-104]
+	_ = x[SME_COHERENT-104]
-	_ = x[SM4-105]
+	_ = x[SSE-105]
-	_ = x[SVE-106]
+	_ = x[SSE2-106]
-	_ = x[lastID-107]
+	_ = x[SSE3-107]
+	_ = x[SSE4-108]
+	_ = x[SSE42-109]
+	_ = x[SSE4A-110]
+	_ = x[SSSE3-111]
+	_ = x[STIBP-112]
+	_ = x[STOSB_SHORT-113]
+	_ = x[SUCCOR-114]
+	_ = x[SVM-115]
+	_ = x[SVMDA-116]
+	_ = x[SVMFBASID-117]
+	_ = x[SVML-118]
+	_ = x[SVMNP-119]
+	_ = x[SVMPF-120]
+	_ = x[SVMPFT-121]
+	_ = x[SYSCALL-122]
+	_ = x[SYSEE-123]
+	_ = x[TBM-124]
+	_ = x[TOPEXT-125]
+	_ = x[TME-126]
+	_ = x[TSCRATEMSR-127]
+	_ = x[TSXLDTRK-128]
+	_ = x[VAES-129]
+	_ = x[VMCBCLEAN-130]
+	_ = x[VMPL-131]
+	_ = x[VMSA_REGPROT-132]
+	_ = x[VMX-133]
+	_ = x[VPCLMULQDQ-134]
+	_ = x[VTE-135]
+	_ = x[WAITPKG-136]
+	_ = x[WBNOINVD-137]
+	_ = x[X87-138]
+	_ = x[XGETBV1-139]
+	_ = x[XOP-140]
+	_ = x[XSAVE-141]
+	_ = x[XSAVEC-142]
+	_ = x[XSAVEOPT-143]
+	_ = x[XSAVES-144]
+	_ = x[AESARM-145]
+	_ = x[ARMCPUID-146]
+	_ = x[ASIMD-147]
+	_ = x[ASIMDDP-148]
+	_ = x[ASIMDHP-149]
+	_ = x[ASIMDRDM-150]
+	_ = x[ATOMICS-151]
+	_ = x[CRC32-152]
+	_ = x[DCPOP-153]
+	_ = x[EVTSTRM-154]
+	_ = x[FCMA-155]
+	_ = x[FP-156]
+	_ = x[FPHP-157]
+	_ = x[GPA-158]
+	_ = x[JSCVT-159]
+	_ = x[LRCPC-160]
+	_ = x[PMULL-161]
+	_ = x[SHA1-162]
+	_ = x[SHA2-163]
+	_ = x[SHA3-164]
+	_ = x[SHA512-165]
+	_ = x[SM3-166]
+	_ = x[SM4-167]
+	_ = x[SVE-168]
+	_ = x[lastID-169]
 	_ = x[firstID-0]
 }
 
-const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXINT8AMXTILEAVXAVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXSLOWBMI1BMI2CLDEMOTECLMULCMOVCX16ENQCMDERMSF16CFMA3FMA4GFNIHLEHTTHYPERVISORIBPBIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKLZCNTMMXMMXEXTMOVDIR64BMOVDIRIMPXNXPOPCNTRDRANDRDSEEDRDTSCPRTMSERIALIZESGXSGXLCSHASSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPTBMTSXLDTRKVAESVMXVPCLMULQDQWAITPKGWBNOINVDXOPAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFPFPHPGPAJSCVTLRCPCPMULLSHA1SHA2SHA3SHA512SM3SM4SVElastID"
+const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXINT8AMXTILEAVXAVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXSLOWAVXVNNIBMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCX16ENQCMDERMSF16CFMA3FMA4FXSRFXSROPTGFNIHLEHRESETHTTHWAHYPERVISORIBPBIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_PREVENTHOSTINT_WBINVDINVLPGBLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCOMMITMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMPXMSRIRCMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTRDPRURDRANDRDSEEDRDTSCPRTMRTM_ALWAYS_ABORTSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSHASMESME_COHERENTSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTOPEXTTMETSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFPFPHPGPAJSCVTLRCPCPMULLSHA1SHA2SHA3SHA512SM3SM4SVElastID"
 
-var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 58, 62, 72, 84, 92, 100, 108, 116, 123, 133, 141, 151, 162, 170, 180, 198, 213, 220, 224, 228, 236, 241, 245, 249, 255, 259, 263, 267, 271, 275, 278, 281, 291, 295, 298, 308, 319, 325, 333, 344, 352, 364, 380, 385, 388, 394, 403, 410, 413, 415, 421, 427, 433, 439, 442, 451, 454, 459, 462, 465, 469, 473, 477, 482, 487, 492, 497, 500, 508, 512, 515, 525, 532, 540, 543, 549, 557, 562, 569, 576, 584, 591, 596, 601, 608, 612, 614, 618, 621, 626, 631, 636, 640, 644, 648, 654, 657, 660, 663, 669}
+var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 58, 62, 72, 84, 92, 100, 108, 116, 123, 133, 143, 151, 161, 172, 180, 190, 208, 223, 230, 237, 241, 245, 251, 256, 264, 269, 275, 279, 297, 305, 312, 316, 322, 326, 330, 334, 338, 342, 349, 353, 356, 362, 365, 368, 378, 382, 385, 395, 406, 412, 420, 431, 439, 451, 467, 482, 492, 499, 503, 506, 513, 518, 529, 536, 539, 545, 550, 559, 566, 574, 577, 583, 596, 601, 603, 610, 617, 623, 628, 634, 640, 646, 649, 665, 674, 677, 686, 701, 714, 720, 734, 741, 744, 749, 752, 755, 767, 770, 774, 778, 782, 787, 792, 797, 802, 813, 819, 822, 827, 836, 840, 845, 850, 856, 863, 868, 871, 877, 880, 890, 898, 902, 911, 915, 927, 930, 940, 943, 950, 958, 961, 968, 971, 976, 982, 990, 996, 1002, 1010, 1015, 1022, 1029, 1037, 1044, 1049, 1054, 1061, 1065, 1067, 1071, 1074, 1079, 1084, 1089, 1093, 1097, 1101, 1107, 1110, 1113, 1116, 1122}
 
 func (i FeatureID) String() string {
 	if i < 0 || i >= FeatureID(len(_FeatureID_index)-1) {

vendor/github.com/klauspost/cpuid/v2/os_darwin_arm64.go

@@ -2,18 +2,120 @@
 
 package cpuid
 
-import "runtime"
+import (
+	"runtime"
+	"strings"
+
+	"golang.org/x/sys/unix"
+)
 
 func detectOS(c *CPUInfo) bool {
+	if runtime.GOOS != "ios" {
+		tryToFillCPUInfoFomSysctl(c)
+	}
 	// There are no hw.optional sysctl values for the below features on Mac OS 11.0
 	// to detect their supported state dynamically. Assume the CPU features that
 	// Apple Silicon M1 supports to be available as a minimal set of features
 	// to all Go programs running on darwin/arm64.
 	// TODO: Add more if we know them.
 	c.featureSet.setIf(runtime.GOOS != "ios", AESARM, PMULL, SHA1, SHA2)
-	c.PhysicalCores = runtime.NumCPU()
+
-	// For now assuming 1 thread per core...
-	c.ThreadsPerCore = 1
-	c.LogicalCores = c.PhysicalCores
 	return true
 }
+
+func sysctlGetBool(name string) bool {
+	value, err := unix.SysctlUint32(name)
+	if err != nil {
+		return false
+	}
+	return value != 0
+}
+
+func sysctlGetString(name string) string {
+	value, err := unix.Sysctl(name)
+	if err != nil {
+		return ""
+	}
+	return value
+}
+
+func sysctlGetInt(unknown int, names ...string) int {
+	for _, name := range names {
+		value, err := unix.SysctlUint32(name)
+		if err != nil {
+			continue
+		}
+		if value != 0 {
+			return int(value)
+		}
+	}
+	return unknown
+}
+
+func sysctlGetInt64(unknown int, names ...string) int {
+	for _, name := range names {
+		value64, err := unix.SysctlUint64(name)
+		if err != nil {
+			continue
+		}
+		if int(value64) != unknown {
+			return int(value64)
+		}
+	}
+	return unknown
+}
+
+func setFeature(c *CPUInfo, name string, feature FeatureID) {
+	c.featureSet.setIf(sysctlGetBool(name), feature)
+}
+func tryToFillCPUInfoFomSysctl(c *CPUInfo) {
+	c.BrandName = sysctlGetString("machdep.cpu.brand_string")
+
+	if len(c.BrandName) != 0 {
+		c.VendorString = strings.Fields(c.BrandName)[0]
+	}
+
+	c.PhysicalCores = sysctlGetInt(runtime.NumCPU(), "hw.physicalcpu")
+	c.ThreadsPerCore = sysctlGetInt(1, "machdep.cpu.thread_count", "kern.num_threads") /
+		sysctlGetInt(1, "hw.physicalcpu")
+	c.LogicalCores = sysctlGetInt(runtime.NumCPU(), "machdep.cpu.core_count")
+	c.Family = sysctlGetInt(0, "machdep.cpu.family", "hw.cpufamily")
+	c.Model = sysctlGetInt(0, "machdep.cpu.model")
+	c.CacheLine = sysctlGetInt64(0, "hw.cachelinesize")
+	c.Cache.L1I = sysctlGetInt64(-1, "hw.l1icachesize")
+	c.Cache.L1D = sysctlGetInt64(-1, "hw.l1icachesize")
+	c.Cache.L2 = sysctlGetInt64(-1, "hw.l2cachesize")
+	c.Cache.L3 = sysctlGetInt64(-1, "hw.l3cachesize")
+
+	// from https://developer.arm.com/downloads/-/exploration-tools/feature-names-for-a-profile
+	setFeature(c, "hw.optional.arm.FEAT_AES", AESARM)
+	setFeature(c, "hw.optional.AdvSIMD", ASIMD)
+	setFeature(c, "hw.optional.arm.FEAT_DotProd", ASIMDDP)
+	setFeature(c, "hw.optional.arm.FEAT_RDM", ASIMDRDM)
+	setFeature(c, "hw.optional.FEAT_CRC32", CRC32)
+	setFeature(c, "hw.optional.arm.FEAT_DPB", DCPOP)
+	// setFeature(c, "", EVTSTRM)
+	setFeature(c, "hw.optional.arm.FEAT_FCMA", FCMA)
+	setFeature(c, "hw.optional.arm.FEAT_FP", FP)
+	setFeature(c, "hw.optional.arm.FEAT_FP16", FPHP)
+	setFeature(c, "hw.optional.arm.FEAT_PAuth", GPA)
+	setFeature(c, "hw.optional.arm.FEAT_JSCVT", JSCVT)
+	setFeature(c, "hw.optional.arm.FEAT_LRCPC", LRCPC)
+	setFeature(c, "hw.optional.arm.FEAT_PMULL", PMULL)
+	setFeature(c, "hw.optional.arm.FEAT_SHA1", SHA1)
+	setFeature(c, "hw.optional.arm.FEAT_SHA256", SHA2)
+	setFeature(c, "hw.optional.arm.FEAT_SHA3", SHA3)
+	setFeature(c, "hw.optional.arm.FEAT_SHA512", SHA512)
+	// setFeature(c, "", SM3)
+	// setFeature(c, "", SM4)
+	setFeature(c, "hw.optional.arm.FEAT_SVE", SVE)
+
+	// from empirical observation
+	setFeature(c, "hw.optional.AdvSIMD_HPFPCvt", ASIMDHP)
+	setFeature(c, "hw.optional.armv8_1_atomics", ATOMICS)
+	setFeature(c, "hw.optional.floatingpoint", FP)
+	setFeature(c, "hw.optional.armv8_2_sha3", SHA3)
+	setFeature(c, "hw.optional.armv8_2_sha512", SHA512)
+	setFeature(c, "hw.optional.armv8_3_compnum", FCMA)
+	setFeature(c, "hw.optional.armv8_crc32", CRC32)
+}

vendor/github.com/klauspost/cpuid/v2/os_other_arm64.go

@@ -1,8 +1,7 @@
 // Copyright (c) 2020 Klaus Post, released under MIT License. See LICENSE file.
 
-// +build arm64
+//go:build arm64 && !linux && !darwin
-// +build !linux
+// +build arm64,!linux,!darwin
-// +build !darwin
 
 package cpuid
 

vendor/github.com/klauspost/cpuid/v2/os_safe_linux_arm64.go

@@ -1,6 +1,7 @@
 // Copyright (c) 2021 Klaus Post, released under MIT License. See LICENSE file.
 
-//+build nounsafe
+//go:build nounsafe
+// +build nounsafe
 
 package cpuid
 

vendor/github.com/klauspost/cpuid/v2/os_unsafe_linux_arm64.go

@@ -1,6 +1,7 @@
 // Copyright (c) 2021 Klaus Post, released under MIT License. See LICENSE file.
 
-//+build !nounsafe
+//go:build !nounsafe
+// +build !nounsafe
 
 package cpuid
 

vendor/github.com/klauspost/reedsolomon/.travis.yml

@@ -1,65 +0,0 @@
-language: go
-
-os:
-  - linux
-  - osx
-  - windows
-
-arch:
-  - amd64
-  - arm64
-  - ppc64le
-  - s390x
-
-go:
-  - 1.14.x
-  - 1.15.x
-  - 1.16.x
-  - master
-
-env:
-  - GO111MODULE=off CGO_ENABLED=0
-
-install:
- - go get ./...
-
-script:
- - go vet ./...
- - go test -cpu=1,2 .
- - go test -tags=noasm -cpu=1,2 .
- - go build examples/simple-decoder.go
- - go build examples/simple-encoder.go
- - go build examples/stream-decoder.go
- - go build examples/stream-encoder.go
-
-jobs:
-  allow_failures:
-    - go: 'master'
-    - arch: s390x
-  fast_finish: true
-  include:
-    - stage: other
-      go: 1.16.x
-      os: linux
-      arch: amd64
-      script:
-        - diff <(gofmt -d .) <(printf "")
-        - diff <(gofmt -d ./examples) <(printf "")
-        - go get github.com/klauspost/asmfmt&&go install github.com/klauspost/asmfmt/cmd/asmfmt
-        - diff <(asmfmt -d .) <(printf "")
-        - CGO_ENABLED=1 go test -cpu=1 -short -race .
-        - CGO_ENABLED=1 go test -cpu=2 -short -race .
-        - CGO_ENABLED=1 go test -tags=noasm -cpu=1 -short -race .
-        - CGO_ENABLED=1 go test -tags=noasm -cpu=4 -short -race .
-        - CGO_ENABLED=1 go test -no-avx512 -short -race .
-        - CGO_ENABLED=1 go test -no-avx512 -no-avx2 -short -race .
-        - CGO_ENABLED=1 go test -no-avx512 -no-avx2 -no-ssse3 -short -race .
-        - GOOS=linux GOARCH=386 go test -short .
-    - stage: other
-      go: 1.15.x
-      os: linux
-      arch: amd64
-      script:
-        - go test -no-avx512
-        - go test -no-avx512 -no-avx2
-        - go test -no-avx512 -no-avx2 -no-ssse3

vendor/github.com/klauspost/reedsolomon/README.md

@@ -1,8 +1,5 @@
 # Reed-Solomon
-[![Go Reference](https://pkg.go.dev/badge/github.com/klauspost/reedsolomon.svg)](https://pkg.go.dev/github.com/klauspost/reedsolomon) [![Build Status][3]][4]
+[![Go Reference](https://pkg.go.dev/badge/github.com/klauspost/reedsolomon.svg)](https://pkg.go.dev/github.com/klauspost/reedsolomon) [![Go](https://github.com/klauspost/reedsolomon/actions/workflows/go.yml/badge.svg)](https://github.com/klauspost/reedsolomon/actions/workflows/go.yml)
-
-[3]: https://travis-ci.org/klauspost/reedsolomon.svg?branch=master
-[4]: https://travis-ci.org/klauspost/reedsolomon
 
 Reed-Solomon Erasure Coding in Go, with speeds exceeding 1GB/s/cpu core implemented in pure Go.
 
@@ -11,9 +8,12 @@ This is a Go port of the [JavaReedSolomon](https://github.com/Backblaze/JavaReed
 
 For an introduction on erasure coding, see the post on the [Backblaze blog](https://www.backblaze.com/blog/reed-solomon/).
 
+For encoding high shard counts (>256) a Leopard implementation is used.
+For most platforms this performs close to the original Leopard implementation in terms of speed. 
+
 Package home: https://github.com/klauspost/reedsolomon
 
-Godoc: https://pkg.go.dev/github.com/klauspost/reedsolomon?tab=doc
+Godoc: https://pkg.go.dev/github.com/klauspost/reedsolomon
 
 # Installation
 To get the package use the standard:
@@ -21,11 +21,18 @@ To get the package use the standard:
 go get -u github.com/klauspost/reedsolomon
 ```
 
-Using Go modules recommended.
+Using Go modules is recommended.
 
 # Changes
+
+## 2022
+
+* Leopard GF16 mode added, for up to 63336 shards. 
+* [WithJerasureMatrix](https://pkg.go.dev/github.com/klauspost/reedsolomon?tab=doc#WithJerasureMatrix) allows constructing a [Jerasure](https://github.com/tsuraan/Jerasure) compatible matrix.
+
 ## 2021
 
+* Use `GOAMD64=v4` to enable faster AVX2.
 * Add progressive shard encoding.
 * Wider AVX2 loops
 * Limit concurrency on AVX2, since we are likely memory bound.
@@ -33,6 +40,8 @@ Using Go modules recommended.
 * Allow disabling inversion cache.
 * Faster AVX2 encoding.
 
+<details>
+	<summary>See older changes</summary>
 
 ## May 2020
 
@@ -96,6 +105,8 @@ The [`StreamEncoder`](https://godoc.org/github.com/klauspost/reedsolomon#StreamE
 handles this without modifying the interface. 
 This is a good lesson on why returning interfaces is not a good design.
 
+</details>
+
 # Usage
 
 This section assumes you know the basics of Reed-Solomon encoding. 
@@ -105,23 +116,19 @@ This package performs the calculation of the parity sets. The usage is therefore
 
 First of all, you need to choose your distribution of data and parity shards. 
 A 'good' distribution is very subjective, and will depend a lot on your usage scenario. 
-A good starting point is above 5 and below 257 data shards (the maximum supported number), 
-and the number of parity shards to be 2 or above, and below the number of data shards.
 
 To create an encoder with 10 data shards (where your data goes) and 3 parity shards (calculated):
 ```Go
     enc, err := reedsolomon.New(10, 3)
 ```
 This encoder will work for all parity sets with this distribution of data and parity shards. 
-The error will only be set if you specify 0 or negative values in any of the parameters, 
-or if you specify more than 256 data shards.
 
 If you will primarily be using it with one shard size it is recommended to use 
 [`WithAutoGoroutines(shardSize)`](https://pkg.go.dev/github.com/klauspost/reedsolomon?tab=doc#WithAutoGoroutines)
 as an additional parameter. This will attempt to calculate the optimal number of goroutines to use for the best speed.
 It is not required that all shards are this size. 
 
-The you send and receive data  is a simple slice of byte slices; `[][]byte`. 
+Then you send and receive data that is a simple slice of byte slices; `[][]byte`. 
 In the example above, the top slice must have a length of 13.
 
 ```Go
@@ -187,6 +194,17 @@ If you are only interested in the data shards (for reading purposes) you can cal
     err := enc.ReconstructData(data)
 ```
 
+If you don't need all data shards you can use `ReconstructSome()`:
+
+```Go
+    // Delete two data shards
+    data[3] = nil
+    data[7] = nil
+    
+    // Reconstruct just the shard 3
+    err := enc.ReconstructSome(data, []bool{false, false, false, true, false, false, false, false})
+```
+
 So to sum up reconstruction:
 * The number of data/parity shards must match the numbers used for encoding.
 * The order of shards must be the same as used when encoding.
@@ -333,6 +351,8 @@ There is no buffering or timeouts/retry specified. If you want to add that, you
 For complete examples of a streaming encoder and decoder see the 
 [examples folder](https://github.com/klauspost/reedsolomon/tree/master/examples).
 
+GF16 (more than 256 shards) is not supported by the streaming interface. 
+
 # Advanced Options
 
 You can modify internal options which affects how jobs are split between and processed by goroutines.
@@ -346,8 +366,83 @@ Example of how to supply options:
      enc, err := reedsolomon.New(10, 3, WithMaxGoroutines(25))
  ```
 
+# Leopard Compatible GF16
+
+When you encode more than 256 shards the library will switch to a [Leopard-RS](https://github.com/catid/leopard) implementation.
+
+This allows encoding up to 65536 shards (data+parity) with the following limitations, similar to leopard:
+
+* The original and recovery data must not exceed 65536 pieces.
+* The shard size *must*  each be a multiple of 64 bytes.
+* Each buffer should have the same number of bytes.
+* Even the last shard must be rounded up to the block size.
+
+|                 | Regular | Leopard |
+|-----------------|---------|---------|
+| Encode          | ✓       | ✓       |
+| EncodeIdx       | ✓       | -       |
+| Verify          | ✓       | ✓       |
+| Reconstruct     | ✓       | ✓       |
+| ReconstructData | ✓       | ✓       |
+| ReconstructSome | ✓       | ✓ (+)   |
+| Update          | ✓       | -       |
+| Split           | ✓       | ✓       |
+| Join            | ✓       | ✓       |
+
+* (+) Same as calling `ReconstructData`.
+
+The Split/Join functions will help to split an input to the proper sizes.
+
+Speed can be expected to be `O(N*log(N))`, compared to the `O(N*N)`. 
+Reconstruction matrix calculation is more time-consuming, 
+so be sure to include that as part of any benchmark you run.  
+
+For now SSSE3, AVX2 and AVX512 assembly are available on AMD64 platforms.
+
+Leopard mode currently always runs as a single goroutine, since multiple gorouties doesn't provide any worthwhile speedup.
+
+## Forcing Leopard GF16
+
+The `WithLeopardGF16(true)` can be used to use Leopard GF16 for all operations. 
+This is *not* compatible with the Leopard library that has a separate GF8 implementation.
+
+Benchmark Encoding and Reconstructing *1KB* shards with variable number of shards.
+For Cauchy matrix the inversion cache is disabled for a more "fair" test.
+Speed is total shard size for each operation. Data shard throughput is speed/2.
+AVX2 is used.
+
+| Encoder      | Shards      | Encode        | Recover All  | Recover One  |
+|--------------|-------------|---------------|--------------|--------------|
+| Cauchy       | 4+4         | 23076.83 MB/s | 3048.86 MB/s | 5620.84 MB/s |
+| Cauchy       | 8+8         | 15206.87 MB/s | 3041.99 MB/s | 7173.71 MB/s |
+| Cauchy       | 16+16       | 7427.47 MB/s  | 1384.58 MB/s | 6343.85 MB/s |
+| Cauchy       | 32+32       | 3785.64 MB/s  | 557.60 MB/s  | 4660.27 MB/s |
+| Cauchy       | 64+64       | 1911.93 MB/s  | 160.54 MB/s  | 2864.63 MB/s |
+| Cauchy       | 128+128     | 963.83 MB/s   | 42.81 MB/s   | 1597.93 MB/s |
+| Leopard GF16 | 4+4         | 18468.32 MB/s | 10.45 MB/s   | 10.30 MB/s   |
+| Leopard GF16 | 8+8         | 10293.79 MB/s | 20.83 MB/s   | 20.51 MB/s   |
+| Leopard GF16 | 16+16       | 12386.04 MB/s | 40.80 MB/s   | 40.47 MB/s   |
+| Leopard GF16 | 32+32       | 7347.35 MB/s  | 81.15 MB/s   | 79.80 MB/s   |
+| Leopard GF16 | 64+64       | 8299.63 MB/s  | 150.47 MB/s  | 154.15 MB/s  |
+| Leopard GF16 | 128+128     | 5629.04 MB/s  | 278.84 MB/s  | 289.15 MB/s  |
+| Leopard GF16 | 256+256     | 6158.66 MB/s  | 454.14 MB/s  | 506.70 MB/s  |
+| Leopard GF16 | 512+512     | 4418.58 MB/s  | 685.75 MB/s  | 801.63 MB/s  |
+| Leopard GF16 | 1024+1024   | 4778.05 MB/s  | 814.51 MB/s  | 1080.19 MB/s |
+| Leopard GF16 | 2048+2048   | 3417.05 MB/s  | 911.64 MB/s  | 1179.48 MB/s |
+| Leopard GF16 | 4096+4096   | 3209.41 MB/s  | 729.13 MB/s  | 1135.06 MB/s |
+| Leopard GF16 | 8192+8192   | 2034.11 MB/s  | 604.52 MB/s  | 842.13 MB/s  |
+| Leopard GF16 | 16384+16384 | 1525.88 MB/s  | 486.74 MB/s  | 750.01 MB/s  |
+| Leopard GF16 | 32768+32768 | 1138.67 MB/s  | 482.81 MB/s  | 712.73 MB/s  |
+
+"Traditional" encoding is faster until somewhere between 16 and 32 shards.
+Leopard provides fast encoding in all cases, but shows a significant overhead for reconstruction.
+
+Calculating the reconstruction matrix takes a significant amount of computation. 
+With bigger shards that will be smaller. Arguably, fewer shards typically also means bigger shards.
+Due to the high shard count caching reconstruction matrices generally isn't feasible for Leopard. 
 
 # Performance
+
 Performance depends mainly on the number of parity shards. 
 In rough terms, doubling the number of parity shards will double the encoding time.
 
@@ -356,27 +451,16 @@ For reference each shard is 1MB random data, and 16 CPU cores are used for encod
 
 | Data | Parity | Go MB/s | SSSE3 MB/s | AVX2 MB/s |
 |------|--------|---------|------------|-----------|
-| 5    | 2      | 14287   | 66355      | 108755    |
+| 5    | 2      | 20,772  | 66,355     | 108,755   |
-| 8    | 8      | 5569    | 34298      | 70516     |
+| 8    | 8      | 6,815   | 38,338     | 70,516    |
-| 10   | 4      | 6766    | 48237      | 93875     |
+| 10   | 4      | 9,245   | 48,237     | 93,875    |
-| 50   | 20     | 1540    | 12130      | 22090     |
+| 50   | 20     | 2,063   | 12,130     | 22,828    |
 
 The throughput numbers here is the size of the encoded data and parity shards.
 
 If `runtime.GOMAXPROCS()` is set to a value higher than 1, 
 the encoder will use multiple goroutines to perform the calculations in `Verify`, `Encode` and `Reconstruct`.
 
-Example of performance scaling on AMD Ryzen 3950X - 16 physical cores, 32 logical cores, AVX 2.
-The example uses 10 blocks with 1MB data each and 4 parity blocks.
-
-| Threads | Speed      |
-|---------|------------|
-| 1       | 9979 MB/s  |
-| 2       | 18870 MB/s |
-| 4       | 33697 MB/s |
-| 8       | 51531 MB/s |
-| 16      | 59204 MB/s |
-
 
 Benchmarking `Reconstruct()` followed by a `Verify()` (=`all`) versus just calling `ReconstructData()` (=`data`) gives the following result:
 ```
@@ -390,22 +474,9 @@ BenchmarkReconstruct50x20x1M-8       1364.35      4189.79      3.07x
 BenchmarkReconstruct10x4x16M-8       1484.35      5779.53      3.89x
 ```
 
-# Performance on AVX512
+The performance on AVX512 has been accelerated for CPUs when available.
 
-The performance on AVX512 has been accelerated for Intel CPUs. 
+## ARM64 NEON
-This gives speedups on a per-core basis typically up to 2x compared to 
-AVX2 as can be seen in the following table:
-
-```
-[...]
-```
-
-This speedup has been achieved by computing multiple parity blocks in parallel as opposed to one after the other. 
-In doing so it is possible to minimize the memory bandwidth required for loading all data shards. 
-At the same time the calculations are performed in the 512-bit wide ZMM registers and the surplus of ZMM 
-registers (32 in total) is used to keep more data around (most notably the matrix coefficients).
-
-# Performance on ARM64 NEON
 
 By exploiting NEON instructions the performance for ARM has been accelerated. 
 Below are the performance numbers for a single core on an EC2 m6g.16xlarge (Graviton2) instance (Amazon Linux 2):
@@ -420,7 +491,7 @@ BenchmarkGaloisXor1M-64        10000    100322 ns/op        10452.13 MB/s
 # Performance on ppc64le
 
 The performance for ppc64le has been accelerated. 
-This gives roughly a 10x performance improvement on this architecture as can been seen below:
+This gives roughly a 10x performance improvement on this architecture as can be seen below:
 
 ```
 benchmark                      old MB/s     new MB/s     speedup
@@ -430,9 +501,6 @@ BenchmarkGaloisXor128K-160     862.02       7905.00      9.17x
 BenchmarkGaloisXor1M-160       784.60       6296.65      8.03x
 ```
 
-# asm2plan9s
-
-[asm2plan9s](https://github.com/fwessels/asm2plan9s) is used for assembling the AVX2 instructions into their BYTE/WORD/LONG equivalents.
 
 # Links
 * [Backblaze Open Sources Reed-Solomon Erasure Coding Source Code](https://www.backblaze.com/blog/reed-solomon/).
@@ -443,6 +511,7 @@ BenchmarkGaloisXor1M-160       784.60       6296.65      8.03x
 * [reed-solomon-erasure](https://github.com/darrenldl/reed-solomon-erasure). Compatible Rust implementation.
 * [go-erasure](https://github.com/somethingnew2-0/go-erasure). A similar library using cgo, slower in my tests.
 * [Screaming Fast Galois Field Arithmetic](http://www.snia.org/sites/default/files2/SDC2013/presentations/NewThinking/EthanMiller_Screaming_Fast_Galois_Field%20Arithmetic_SIMD%20Instructions.pdf). Basis for SSE3 optimizations.
+* [Leopard-RS](https://github.com/catid/leopard) C library used as basis for GF16 implementation.
 
 # License
 

vendor/github.com/klauspost/reedsolomon/appveyor.yml

@@ -1,20 +0,0 @@
-os: Visual Studio 2015
-
-platform: x64
-
-clone_folder: c:\gopath\src\github.com\klauspost\reedsolomon
-
-# environment variables
-environment:
-  GOPATH: c:\gopath
-
-install:
-  - echo %PATH%
-  - echo %GOPATH%
-  - go version
-  - go env
-  - go get -d ./...
-
-build_script:
-  - go test -v -cpu=2 ./...
-  - go test -cpu=1,2,4 -short -race ./...

vendor/github.com/klauspost/reedsolomon/galois.go

@@ -6,6 +6,8 @@
 
 package reedsolomon
 
+import "encoding/binary"
+
 const (
 	// The number of elements in the field.
 	fieldSize = 256
@@ -929,3 +931,24 @@ func genAvx2Matrix(matrixRows [][]byte, inputs, inIdx, outputs int, dst []byte)
 	}
 	return dst
 }
+
+// xor slices writing to out.
+func sliceXorGo(in, out []byte, _ *options) {
+	for len(out) >= 32 {
+		inS := in[:32]
+		v0 := binary.LittleEndian.Uint64(out[:8]) ^ binary.LittleEndian.Uint64(inS[:8])
+		v1 := binary.LittleEndian.Uint64(out[8:16]) ^ binary.LittleEndian.Uint64(inS[8:16])
+		v2 := binary.LittleEndian.Uint64(out[16:24]) ^ binary.LittleEndian.Uint64(inS[16:24])
+		v3 := binary.LittleEndian.Uint64(out[24:32]) ^ binary.LittleEndian.Uint64(inS[24:32])
+		binary.LittleEndian.PutUint64(out[:8], v0)
+		binary.LittleEndian.PutUint64(out[8:16], v1)
+		binary.LittleEndian.PutUint64(out[16:24], v2)
+		binary.LittleEndian.PutUint64(out[24:32], v3)
+		out = out[32:]
+		in = in[32:]
+	}
+	out = out[:len(in)]
+	for n, input := range in {
+		out[n] ^= input
+	}
+}

vendor/github.com/klauspost/reedsolomon/galoisAvx512_amd64.go

@@ -104,7 +104,7 @@ func setupMatrix84(matrixRows [][]byte, inputOffset, outputOffset int, matrix *[
 // Invoke AVX512 routine for single output row in parallel
 func galMulAVX512Parallel81(in, out [][]byte, matrixRows [][]byte, inputOffset, outputOffset, start, stop int, matrix81 *[matrixSize81]byte) {
 	done := stop - start
-	if done <= 0 {
+	if done <= 0 || len(in) == 0 || len(out) == 0 {
 		return
 	}
 
@@ -139,7 +139,7 @@ func galMulAVX512Parallel81(in, out [][]byte, matrixRows [][]byte, inputOffset,
 // Invoke AVX512 routine for 2 output rows in parallel
 func galMulAVX512Parallel82(in, out [][]byte, matrixRows [][]byte, inputOffset, outputOffset, start, stop int, matrix82 *[matrixSize82]byte) {
 	done := stop - start
-	if done <= 0 {
+	if done <= 0 || len(in) == 0 || len(out) == 0 {
 		return
 	}
 
@@ -174,7 +174,7 @@ func galMulAVX512Parallel82(in, out [][]byte, matrixRows [][]byte, inputOffset,
 // Invoke AVX512 routine for 4 output rows in parallel
 func galMulAVX512Parallel84(in, out [][]byte, matrixRows [][]byte, inputOffset, outputOffset, start, stop int, matrix84 *[matrixSize84]byte) {
 	done := stop - start
-	if done <= 0 {
+	if done <= 0 || len(in) == 0 || len(out) == 0 {
 		return
 	}
 

vendor/github.com/klauspost/reedsolomon/galois_amd64.go

@@ -132,9 +132,215 @@ func sliceXor(in, out []byte, o *options) {
 			in = in[done:]
 			out = out[done:]
 		}
+	} else {
+		sliceXorGo(in, out, o)
+		return
 	}
 	out = out[:len(in)]
 	for i := range in {
 		out[i] ^= in[i]
 	}
 }
+
+// 4-way butterfly
+func ifftDIT4(work [][]byte, dist int, log_m01, log_m23, log_m02 ffe, o *options) {
+	if len(work[0]) == 0 {
+		return
+	}
+
+	t01 := &multiply256LUT[log_m01]
+	t23 := &multiply256LUT[log_m23]
+	t02 := &multiply256LUT[log_m02]
+	if o.useAVX512 {
+		if log_m01 == modulus {
+			if log_m23 == modulus {
+				if log_m02 == modulus {
+					ifftDIT4_avx512_7(work, dist*24, t01, t23, t02)
+				} else {
+					ifftDIT4_avx512_3(work, dist*24, t01, t23, t02)
+				}
+			} else {
+				if log_m02 == modulus {
+					ifftDIT4_avx512_5(work, dist*24, t01, t23, t02)
+				} else {
+					ifftDIT4_avx512_1(work, dist*24, t01, t23, t02)
+				}
+			}
+		} else {
+			if log_m23 == modulus {
+				if log_m02 == modulus {
+					ifftDIT4_avx512_6(work, dist*24, t01, t23, t02)
+				} else {
+					ifftDIT4_avx512_2(work, dist*24, t01, t23, t02)
+				}
+			} else {
+				if log_m02 == modulus {
+					ifftDIT4_avx512_4(work, dist*24, t01, t23, t02)
+				} else {
+					ifftDIT4_avx512_0(work, dist*24, t01, t23, t02)
+				}
+			}
+		}
+		return
+	} else if o.useAVX2 {
+		if log_m01 == modulus {
+			if log_m23 == modulus {
+				if log_m02 == modulus {
+					ifftDIT4_avx2_7(work, dist*24, t01, t23, t02)
+				} else {
+					ifftDIT4_avx2_3(work, dist*24, t01, t23, t02)
+				}
+			} else {
+				if log_m02 == modulus {
+					ifftDIT4_avx2_5(work, dist*24, t01, t23, t02)
+				} else {
+					ifftDIT4_avx2_1(work, dist*24, t01, t23, t02)
+				}
+			}
+		} else {
+			if log_m23 == modulus {
+				if log_m02 == modulus {
+					ifftDIT4_avx2_6(work, dist*24, t01, t23, t02)
+				} else {
+					ifftDIT4_avx2_2(work, dist*24, t01, t23, t02)
+				}
+			} else {
+				if log_m02 == modulus {
+					ifftDIT4_avx2_4(work, dist*24, t01, t23, t02)
+				} else {
+					ifftDIT4_avx2_0(work, dist*24, t01, t23, t02)
+				}
+			}
+		}
+		return
+	}
+	ifftDIT4Ref(work, dist, log_m01, log_m23, log_m02, o)
+}
+
+func fftDIT4(work [][]byte, dist int, log_m01, log_m23, log_m02 ffe, o *options) {
+	if len(work[0]) == 0 {
+		return
+	}
+
+	t01 := &multiply256LUT[log_m01]
+	t23 := &multiply256LUT[log_m23]
+	t02 := &multiply256LUT[log_m02]
+	if o.useAVX512 {
+		if log_m02 == modulus {
+			if log_m01 == modulus {
+				if log_m23 == modulus {
+					fftDIT4_avx512_7(work, dist*24, t01, t23, t02)
+				} else {
+					fftDIT4_avx512_3(work, dist*24, t01, t23, t02)
+				}
+			} else {
+				if log_m23 == modulus {
+					fftDIT4_avx512_5(work, dist*24, t01, t23, t02)
+				} else {
+					fftDIT4_avx512_1(work, dist*24, t01, t23, t02)
+				}
+			}
+		} else {
+			if log_m01 == modulus {
+				if log_m23 == modulus {
+					fftDIT4_avx512_6(work, dist*24, t01, t23, t02)
+				} else {
+					fftDIT4_avx512_2(work, dist*24, t01, t23, t02)
+				}
+			} else {
+				if log_m23 == modulus {
+					fftDIT4_avx512_4(work, dist*24, t01, t23, t02)
+				} else {
+					fftDIT4_avx512_0(work, dist*24, t01, t23, t02)
+				}
+			}
+		}
+		return
+	} else if o.useAVX2 {
+		if log_m02 == modulus {
+			if log_m01 == modulus {
+				if log_m23 == modulus {
+					fftDIT4_avx2_7(work, dist*24, t01, t23, t02)
+				} else {
+					fftDIT4_avx2_3(work, dist*24, t01, t23, t02)
+				}
+			} else {
+				if log_m23 == modulus {
+					fftDIT4_avx2_5(work, dist*24, t01, t23, t02)
+				} else {
+					fftDIT4_avx2_1(work, dist*24, t01, t23, t02)
+				}
+			}
+		} else {
+			if log_m01 == modulus {
+				if log_m23 == modulus {
+					fftDIT4_avx2_6(work, dist*24, t01, t23, t02)
+				} else {
+					fftDIT4_avx2_2(work, dist*24, t01, t23, t02)
+				}
+			} else {
+				if log_m23 == modulus {
+					fftDIT4_avx2_4(work, dist*24, t01, t23, t02)
+				} else {
+					fftDIT4_avx2_0(work, dist*24, t01, t23, t02)
+				}
+			}
+		}
+		return
+	}
+	fftDIT4Ref(work, dist, log_m01, log_m23, log_m02, o)
+}
+
+// 2-way butterfly forward
+func fftDIT2(x, y []byte, log_m ffe, o *options) {
+	if o.useAVX2 {
+		if len(x) > 0 {
+			tmp := &multiply256LUT[log_m]
+			fftDIT2_avx2(x, y, tmp)
+		}
+	} else if o.useSSSE3 {
+		if len(x) > 0 {
+			tmp := &multiply256LUT[log_m]
+			fftDIT2_ssse3(x, y, tmp)
+		}
+	} else {
+		// Reference version:
+		refMulAdd(x, y, log_m)
+		sliceXor(x, y, o)
+	}
+}
+
+// 2-way butterfly
+func ifftDIT2(x, y []byte, log_m ffe, o *options) {
+	if o.useAVX2 {
+		if len(x) > 0 {
+			tmp := &multiply256LUT[log_m]
+			ifftDIT2_avx2(x, y, tmp)
+		}
+	} else if o.useSSSE3 {
+		if len(x) > 0 {
+			tmp := &multiply256LUT[log_m]
+			ifftDIT2_ssse3(x, y, tmp)
+		}
+	} else {
+		// Reference version:
+		sliceXor(x, y, o)
+		refMulAdd(x, y, log_m)
+	}
+}
+
+func mulgf16(x, y []byte, log_m ffe, o *options) {
+	if o.useAVX2 {
+		if len(x) > 0 {
+			tmp := &multiply256LUT[log_m]
+			mulgf16_avx2(x, y, tmp)
+		}
+	} else if o.useSSSE3 {
+		if len(x) > 0 {
+			tmp := &multiply256LUT[log_m]
+			mulgf16_ssse3(x, y, tmp)
+		}
+	} else {
+		refMul(x, y, log_m)
+	}
+}

vendor/github.com/klauspost/reedsolomon/galois_arm64.go

@@ -64,3 +64,33 @@ func sliceXor(in, out []byte, o *options) {
 		}
 	}
 }
+
+// 4-way butterfly
+func ifftDIT4(work [][]byte, dist int, log_m01, log_m23, log_m02 ffe, o *options) {
+	ifftDIT4Ref(work, dist, log_m01, log_m23, log_m02, o)
+}
+
+// 4-way butterfly
+func fftDIT4(work [][]byte, dist int, log_m01, log_m23, log_m02 ffe, o *options) {
+	fftDIT4Ref(work, dist, log_m01, log_m23, log_m02, o)
+}
+
+// 2-way butterfly forward
+func fftDIT2(x, y []byte, log_m ffe, o *options) {
+	// Reference version:
+	refMulAdd(x, y, log_m)
+	// 64 byte aligned, always full.
+	galXorNEON(x, y)
+}
+
+// 2-way butterfly
+func ifftDIT2(x, y []byte, log_m ffe, o *options) {
+	// 64 byte aligned, always full.
+	galXorNEON(x, y)
+	// Reference version:
+	refMulAdd(x, y, log_m)
+}
+
+func mulgf16(x, y []byte, log_m ffe, o *options) {
+	refMul(x, y, log_m)
+}

vendor/github.com/klauspost/reedsolomon/galois_noasm.go

@@ -7,8 +7,6 @@
 
 package reedsolomon
 
-import "encoding/binary"
-
 func galMulSlice(c byte, in, out []byte, o *options) {
 	out = out[:len(in)]
 	if c == 1 {
@@ -34,25 +32,38 @@ func galMulSliceXor(c byte, in, out []byte, o *options) {
 }
 
 // simple slice xor
-func sliceXor(in, out []byte, _ *options) {
+func sliceXor(in, out []byte, o *options) {
-	for len(out) >= 32 {
+	sliceXorGo(in, out, o)
-		inS := in[:32]
-		v0 := binary.LittleEndian.Uint64(out[:]) ^ binary.LittleEndian.Uint64(inS[:])
-		v1 := binary.LittleEndian.Uint64(out[8:]) ^ binary.LittleEndian.Uint64(inS[8:])
-		v2 := binary.LittleEndian.Uint64(out[16:]) ^ binary.LittleEndian.Uint64(inS[16:])
-		v3 := binary.LittleEndian.Uint64(out[24:]) ^ binary.LittleEndian.Uint64(inS[24:])
-		binary.LittleEndian.PutUint64(out[:], v0)
-		binary.LittleEndian.PutUint64(out[8:], v1)
-		binary.LittleEndian.PutUint64(out[16:], v2)
-		binary.LittleEndian.PutUint64(out[24:], v3)
-		out = out[32:]
-		in = in[32:]
-	}
-	for n, input := range in {
-		out[n] ^= input
-	}
 }
 
 func init() {
 	defaultOptions.useAVX512 = false
 }
+
+// 4-way butterfly
+func ifftDIT4(work [][]byte, dist int, log_m01, log_m23, log_m02 ffe, o *options) {
+	ifftDIT4Ref(work, dist, log_m01, log_m23, log_m02, o)
+}
+
+// 4-way butterfly
+func fftDIT4(work [][]byte, dist int, log_m01, log_m23, log_m02 ffe, o *options) {
+	fftDIT4Ref(work, dist, log_m01, log_m23, log_m02, o)
+}
+
+// 2-way butterfly forward
+func fftDIT2(x, y []byte, log_m ffe, o *options) {
+	// Reference version:
+	refMulAdd(x, y, log_m)
+	sliceXorGo(x, y, o)
+}
+
+// 2-way butterfly inverse
+func ifftDIT2(x, y []byte, log_m ffe, o *options) {
+	// Reference version:
+	sliceXorGo(x, y, o)
+	refMulAdd(x, y, log_m)
+}
+
+func mulgf16(x, y []byte, log_m ffe, o *options) {
+	refMul(x, y, log_m)
+}

vendor/github.com/klauspost/reedsolomon/galois_ppc64le.go

@@ -72,3 +72,31 @@ func sliceXor(in, out []byte, o *options) {
 		out[n] ^= input
 	}
 }
+
+// 4-way butterfly
+func ifftDIT4(work [][]byte, dist int, log_m01, log_m23, log_m02 ffe, o *options) {
+	ifftDIT4Ref(work, dist, log_m01, log_m23, log_m02, o)
+}
+
+// 4-way butterfly
+func fftDIT4(work [][]byte, dist int, log_m01, log_m23, log_m02 ffe, o *options) {
+	fftDIT4Ref(work, dist, log_m01, log_m23, log_m02, o)
+}
+
+// 2-way butterfly forward
+func fftDIT2(x, y []byte, log_m ffe, o *options) {
+	// Reference version:
+	refMulAdd(x, y, log_m)
+	sliceXor(x, y, o)
+}
+
+// 2-way butterfly inverse
+func ifftDIT2(x, y []byte, log_m ffe, o *options) {
+	// Reference version:
+	sliceXor(x, y, o)
+	refMulAdd(x, y, log_m)
+}
+
+func mulgf16(x, y []byte, log_m ffe, o *options) {
+	refMul(x, y, log_m)
+}

vendor/github.com/klauspost/reedsolomon/options.go

@@ -16,10 +16,13 @@ type options struct {
 	perRound      int
 
 	useAVX512, useAVX2, useSSSE3, useSSE2 bool
+	useJerasureMatrix                     bool
 	usePAR1Matrix                         bool
 	useCauchy                             bool
 	fastOneParity                         bool
 	inversionCache                        bool
+	customMatrix                          [][]byte
+	withLeopard                           *bool
 
 	// stream options
 	concReads  bool
@@ -130,36 +133,57 @@ func WithStreamBlockSize(n int) Option {
 	}
 }
 
-func withSSSE3(enabled bool) Option {
+// WithSSSE3 allows to enable/disable SSSE3 instructions.
+// If not set, SSSE3 will be turned on or off automatically based on CPU ID information.
+func WithSSSE3(enabled bool) Option {
 	return func(o *options) {
 		o.useSSSE3 = enabled
 	}
 }
 
-func withAVX2(enabled bool) Option {
+// WithAVX2 allows to enable/disable AVX2 instructions.
+// If not set, AVX2 will be turned on or off automatically based on CPU ID information.
+func WithAVX2(enabled bool) Option {
 	return func(o *options) {
 		o.useAVX2 = enabled
 	}
 }
 
-func withSSE2(enabled bool) Option {
+// WithSSE2 allows to enable/disable SSE2 instructions.
+// If not set, SSE2 will be turned on or off automatically based on CPU ID information.
+func WithSSE2(enabled bool) Option {
 	return func(o *options) {
 		o.useSSE2 = enabled
 	}
 }
 
-func withAVX512(enabled bool) Option {
+// WithAVX512 allows to enable/disable AVX512 instructions.
+// If not set, AVX512 will be turned on or off automatically based on CPU ID information.
+func WithAVX512(enabled bool) Option {
 	return func(o *options) {
 		o.useAVX512 = enabled
 	}
 }
 
+// WithJerasureMatrix causes the encoder to build the Reed-Solomon-Vandermonde
+// matrix in the same way as done by the Jerasure library.
+// The first row and column of the coding matrix only contains 1's in this method
+// so the first parity chunk is always equal to XOR of all data chunks.
+func WithJerasureMatrix() Option {
+	return func(o *options) {
+		o.useJerasureMatrix = true
+		o.usePAR1Matrix = false
+		o.useCauchy = false
+	}
+}
+
 // WithPAR1Matrix causes the encoder to build the matrix how PARv1
 // does. Note that the method they use is buggy, and may lead to cases
 // where recovery is impossible, even if there are enough parity
 // shards.
 func WithPAR1Matrix() Option {
 	return func(o *options) {
+		o.useJerasureMatrix = false
 		o.usePAR1Matrix = true
 		o.useCauchy = false
 	}
@@ -171,8 +195,9 @@ func WithPAR1Matrix() Option {
 // but will result in slightly faster start-up time.
 func WithCauchyMatrix() Option {
 	return func(o *options) {
-		o.useCauchy = true
+		o.useJerasureMatrix = false
 		o.usePAR1Matrix = false
+		o.useCauchy = true
 	}
 }
 
@@ -184,3 +209,26 @@ func WithFastOneParityMatrix() Option {
 		o.fastOneParity = true
 	}
 }
+
+// WithCustomMatrix causes the encoder to use the manually specified matrix.
+// customMatrix represents only the parity chunks.
+// customMatrix must have at least ParityShards rows and DataShards columns.
+// It can be used for interoperability with libraries which generate
+// the matrix differently or to implement more complex coding schemes like LRC
+// (locally reconstructible codes).
+func WithCustomMatrix(customMatrix [][]byte) Option {
+	return func(o *options) {
+		o.customMatrix = customMatrix
+	}
+}
+
+// WithLeopardGF16 will always use leopard GF16 for encoding,
+// even when there is less than 256 shards.
+// This will likely improve reconstruction time for some setups.
+// This is not compatible with Leopard output for <= 256 shards.
+// Note that Leopard places certain restrictions on use see other documentation.
+func WithLeopardGF16(enabled bool) Option {
+	return func(o *options) {
+		o.withLeopard = &enabled
+	}
+}

vendor/github.com/klauspost/reedsolomon/reedsolomon.go

@@ -8,7 +8,6 @@
 // Package reedsolomon enables Erasure Coding in Go
 //
 // For usage and examples, see https://github.com/klauspost/reedsolomon
-//
 package reedsolomon
 
 import (
@@ -77,6 +76,24 @@ type Encoder interface {
 	// calling the Verify function is likely to fail.
 	ReconstructData(shards [][]byte) error
 
+	// ReconstructSome will recreate only requested data shards, if possible.
+	//
+	// Given a list of shards, some of which contain data, fills in the
+	// data shards indicated by true values in the "required" parameter.
+	// The length of "required" array must be equal to DataShards.
+	//
+	// The length of "shards" array must be equal to Shards.
+	// You indicate that a shard is missing by setting it to nil or zero-length.
+	// If a shard is zero-length but has sufficient capacity, that memory will
+	// be used, otherwise a new []byte will be allocated.
+	//
+	// If there are too few shards to reconstruct the missing
+	// ones, ErrTooFewShards will be returned.
+	//
+	// As the reconstructed shard set may contain missing parity shards,
+	// calling the Verify function is likely to fail.
+	ReconstructSome(shards [][]byte, required []bool) error
+
 	// Update parity is use for change a few data shards and update it's parity.
 	// Input 'newDatashards' containing data shards changed.
 	// Input 'shards' containing old data shards (if data shard not changed, it can be nil) and old parity shards.
@@ -108,6 +125,22 @@ type Encoder interface {
 	Join(dst io.Writer, shards [][]byte, outSize int) error
 }
 
+// Extensions is an optional interface.
+// All returned instances will support this interface.
+type Extensions interface {
+	// ShardSizeMultiple will return the size the shard sizes must be a multiple of.
+	ShardSizeMultiple() int
+
+	// DataShards will return the number of data shards.
+	DataShards() int
+
+	// ParityShards will return the number of parity shards.
+	ParityShards() int
+
+	// TotalShards will return the total number of shards.
+	TotalShards() int
+}
+
 const (
 	avx2CodeGenMinSize       = 64
 	avx2CodeGenMinShards     = 3
@@ -121,9 +154,9 @@ const (
 // distribution of datashards and parity shards.
 // Construct if using New()
 type reedSolomon struct {
-	DataShards   int // Number of data shards, should not be modified.
+	dataShards   int // Number of data shards, should not be modified.
-	ParityShards int // Number of parity shards, should not be modified.
+	parityShards int // Number of parity shards, should not be modified.
-	Shards       int // Total number of shards. Calculated, and should not be modified.
+	totalShards  int // Total number of shards. Calculated, and should not be modified.
 	m            matrix
 	tree         *inversionTree
 	parity       [][]byte
@@ -131,6 +164,24 @@ type reedSolomon struct {
 	mPool        sync.Pool
 }
 
+var _ = Extensions(&reedSolomon{})
+
+func (r *reedSolomon) ShardSizeMultiple() int {
+	return 1
+}
+
+func (r *reedSolomon) DataShards() int {
+	return r.dataShards
+}
+
+func (r *reedSolomon) ParityShards() int {
+	return r.parityShards
+}
+
+func (r *reedSolomon) TotalShards() int {
+	return r.parityShards
+}
+
 // ErrInvShardNum will be returned by New, if you attempt to create
 // an Encoder with less than one data shard or less than zero parity
 // shards.
@@ -141,6 +192,9 @@ var ErrInvShardNum = errors.New("cannot create Encoder with less than one data s
 // GF(2^8).
 var ErrMaxShardNum = errors.New("cannot create Encoder with more than 256 data+parity shards")
 
+// ErrNotSupported is returned when an operation is not supported.
+var ErrNotSupported = errors.New("operation not supported")
+
 // buildMatrix creates the matrix to use for encoding, given the
 // number of data shards and the number of total shards.
 //
@@ -173,6 +227,87 @@ func buildMatrix(dataShards, totalShards int) (matrix, error) {
 	return vm.Multiply(topInv)
 }
 
+// buildMatrixJerasure creates the same encoding matrix as Jerasure library
+//
+// The top square of the matrix is guaranteed to be an identity
+// matrix, which means that the data shards are unchanged after
+// encoding.
+func buildMatrixJerasure(dataShards, totalShards int) (matrix, error) {
+	// Start with a Vandermonde matrix.  This matrix would work,
+	// in theory, but doesn't have the property that the data
+	// shards are unchanged after encoding.
+	vm, err := vandermonde(totalShards, dataShards)
+	if err != nil {
+		return nil, err
+	}
+
+	// Jerasure does this:
+	// first row is always 100..00
+	vm[0][0] = 1
+	for i := 1; i < dataShards; i++ {
+		vm[0][i] = 0
+	}
+	// last row is always 000..01
+	for i := 0; i < dataShards-1; i++ {
+		vm[totalShards-1][i] = 0
+	}
+	vm[totalShards-1][dataShards-1] = 1
+
+	for i := 0; i < dataShards; i++ {
+		// Find the row where i'th col is not 0
+		r := i
+		for ; r < totalShards && vm[r][i] == 0; r++ {
+		}
+		if r != i {
+			// Swap it with i'th row if not already
+			t := vm[r]
+			vm[r] = vm[i]
+			vm[i] = t
+		}
+		// Multiply by the inverted matrix (same as vm.Multiply(vm[0:dataShards].Invert()))
+		if vm[i][i] != 1 {
+			// Make vm[i][i] = 1 by dividing the column by vm[i][i]
+			tmp := galDivide(1, vm[i][i])
+			for j := 0; j < totalShards; j++ {
+				vm[j][i] = galMultiply(vm[j][i], tmp)
+			}
+		}
+		for j := 0; j < dataShards; j++ {
+			// Make vm[i][j] = 0 where j != i by adding vm[i][j]*vm[.][i] to each column
+			tmp := vm[i][j]
+			if j != i && tmp != 0 {
+				for r := 0; r < totalShards; r++ {
+					vm[r][j] = galAdd(vm[r][j], galMultiply(tmp, vm[r][i]))
+				}
+			}
+		}
+	}
+
+	// Make vm[dataShards] row all ones - divide each column j by vm[dataShards][j]
+	for j := 0; j < dataShards; j++ {
+		tmp := vm[dataShards][j]
+		if tmp != 1 {
+			tmp = galDivide(1, tmp)
+			for i := dataShards; i < totalShards; i++ {
+				vm[i][j] = galMultiply(vm[i][j], tmp)
+			}
+		}
+	}
+
+	// Make vm[dataShards...totalShards-1][0] column all ones - divide each row
+	for i := dataShards + 1; i < totalShards; i++ {
+		tmp := vm[i][0]
+		if tmp != 1 {
+			tmp = galDivide(1, tmp)
+			for j := 0; j < dataShards; j++ {
+				vm[i][j] = galMultiply(vm[i][j], tmp)
+			}
+		}
+	}
+
+	return vm, nil
+}
+
 // buildMatrixPAR1 creates the matrix to use for encoding according to
 // the PARv1 spec, given the number of data shards and the number of
 // total shards. Note that the method they use is buggy, and may lead
@@ -252,41 +387,70 @@ func buildXorMatrix(dataShards, totalShards int) (matrix, error) {
 // New creates a new encoder and initializes it to
 // the number of data shards and parity shards that
 // you want to use. You can reuse this encoder.
-// Note that the maximum number of total shards is 256.
+// Note that the maximum number of total shards is 65536, with some
+// restrictions for a total larger than 256:
+//
+//   - Shard sizes must be multiple of 64
+//   - The methods Join/Split/Update/EncodeIdx are not supported
+//
 // If no options are supplied, default options are used.
 func New(dataShards, parityShards int, opts ...Option) (Encoder, error) {
-	r := reedSolomon{
+	o := defaultOptions
-		DataShards:   dataShards,
-		ParityShards: parityShards,
-		Shards:       dataShards + parityShards,
-		o:            defaultOptions,
-	}
-
 	for _, opt := range opts {
-		opt(&r.o)
+		opt(&o)
-	}
-	if dataShards <= 0 || parityShards < 0 {
-		return nil, ErrInvShardNum
 	}
 
+	if (dataShards+parityShards > 256 && o.withLeopard == nil) ||
+		(o.withLeopard != nil && *o.withLeopard == true && parityShards > 0) {
+		return newFF16(dataShards, parityShards, o)
+	}
 	if dataShards+parityShards > 256 {
 		return nil, ErrMaxShardNum
 	}
 
+	r := reedSolomon{
+		dataShards:   dataShards,
+		parityShards: parityShards,
+		totalShards:  dataShards + parityShards,
+		o:            o,
+	}
+
+	if dataShards <= 0 || parityShards < 0 {
+		return nil, ErrInvShardNum
+	}
+
 	if parityShards == 0 {
 		return &r, nil
 	}
 
 	var err error
 	switch {
+	case r.o.customMatrix != nil:
+		if len(r.o.customMatrix) < parityShards {
+			return nil, errors.New("coding matrix must contain at least parityShards rows")
+		}
+		r.m = make([][]byte, r.totalShards)
+		for i := 0; i < dataShards; i++ {
+			r.m[i] = make([]byte, dataShards)
+			r.m[i][i] = 1
+		}
+		for k, row := range r.o.customMatrix {
+			if len(row) < dataShards {
+				return nil, errors.New("coding matrix must contain at least dataShards columns")
+			}
+			r.m[dataShards+k] = make([]byte, dataShards)
+			copy(r.m[dataShards+k], row)
+		}
 	case r.o.fastOneParity && parityShards == 1:
-		r.m, err = buildXorMatrix(dataShards, r.Shards)
+		r.m, err = buildXorMatrix(dataShards, r.totalShards)
 	case r.o.useCauchy:
-		r.m, err = buildMatrixCauchy(dataShards, r.Shards)
+		r.m, err = buildMatrixCauchy(dataShards, r.totalShards)
 	case r.o.usePAR1Matrix:
-		r.m, err = buildMatrixPAR1(dataShards, r.Shards)
+		r.m, err = buildMatrixPAR1(dataShards, r.totalShards)
+	case r.o.useJerasureMatrix:
+		r.m, err = buildMatrixJerasure(dataShards, r.totalShards)
 	default:
-		r.m, err = buildMatrix(dataShards, r.Shards)
+		r.m, err = buildMatrix(dataShards, r.totalShards)
 	}
 	if err != nil {
 		return nil, err
@@ -384,7 +548,7 @@ func New(dataShards, parityShards int, opts ...Option) (Encoder, error) {
 	}
 
 	if avx2CodeGen && r.o.useAVX2 {
-		sz := r.DataShards * r.ParityShards * 2 * 32
+		sz := r.dataShards * r.parityShards * 2 * 32
 		r.mPool.New = func() interface{} {
 			return make([]byte, sz)
 		}
@@ -404,7 +568,7 @@ var ErrTooFewShards = errors.New("too few shards given")
 // The parity shards will always be overwritten and the data shards
 // will remain the same.
 func (r *reedSolomon) Encode(shards [][]byte) error {
-	if len(shards) != r.Shards {
+	if len(shards) != r.totalShards {
 		return ErrTooFewShards
 	}
 
@@ -414,10 +578,10 @@ func (r *reedSolomon) Encode(shards [][]byte) error {
 	}
 
 	// Get the slice of output buffers.
-	output := shards[r.DataShards:]
+	output := shards[r.dataShards:]
 
 	// Do the coding.
-	r.codeSomeShards(r.parity, shards[0:r.DataShards], output[:r.ParityShards], len(shards[0]))
+	r.codeSomeShards(r.parity, shards[0:r.dataShards], output[:r.parityShards], len(shards[0]))
 	return nil
 }
 
@@ -426,13 +590,13 @@ func (r *reedSolomon) Encode(shards [][]byte) error {
 // Data shards should only be delivered once. There is no check for this.
 // The parity shards will always be updated and the data shards will remain the unchanged.
 func (r *reedSolomon) EncodeIdx(dataShard []byte, idx int, parity [][]byte) error {
-	if len(parity) != r.ParityShards {
+	if len(parity) != r.parityShards {
 		return ErrTooFewShards
 	}
 	if len(parity) == 0 {
 		return nil
 	}
-	if idx < 0 || idx >= r.DataShards {
+	if idx < 0 || idx >= r.dataShards {
 		return ErrInvShardNum
 	}
 	err := checkShards(parity, false)
@@ -451,7 +615,7 @@ func (r *reedSolomon) EncodeIdx(dataShard []byte, idx int, parity [][]byte) erro
 
 	for start < len(dataShard) {
 		in := dataShard[start:end]
-		for iRow := 0; iRow < r.ParityShards; iRow++ {
+		for iRow := 0; iRow < r.parityShards; iRow++ {
 			galMulSliceXor(r.parity[iRow][idx], in, parity[iRow][start:end], &r.o)
 		}
 		start = end
@@ -467,11 +631,11 @@ func (r *reedSolomon) EncodeIdx(dataShard []byte, idx int, parity [][]byte) erro
 var ErrInvalidInput = errors.New("invalid input")
 
 func (r *reedSolomon) Update(shards [][]byte, newDatashards [][]byte) error {
-	if len(shards) != r.Shards {
+	if len(shards) != r.totalShards {
 		return ErrTooFewShards
 	}
 
-	if len(newDatashards) != r.DataShards {
+	if len(newDatashards) != r.dataShards {
 		return ErrTooFewShards
 	}
 
@@ -490,7 +654,7 @@ func (r *reedSolomon) Update(shards [][]byte, newDatashards [][]byte) error {
 			return ErrInvalidInput
 		}
 	}
-	for _, p := range shards[r.DataShards:] {
+	for _, p := range shards[r.dataShards:] {
 		if p == nil {
 			return ErrInvalidInput
 		}
@@ -499,10 +663,10 @@ func (r *reedSolomon) Update(shards [][]byte, newDatashards [][]byte) error {
 	shardSize := shardSize(shards)
 
 	// Get the slice of output buffers.
-	output := shards[r.DataShards:]
+	output := shards[r.dataShards:]
 
 	// Do the coding.
-	r.updateParityShards(r.parity, shards[0:r.DataShards], newDatashards[0:r.DataShards], output, r.ParityShards, shardSize)
+	r.updateParityShards(r.parity, shards[0:r.dataShards], newDatashards[0:r.dataShards], output, r.parityShards, shardSize)
 	return nil
 }
 
@@ -516,7 +680,7 @@ func (r *reedSolomon) updateParityShards(matrixRows, oldinputs, newinputs, outpu
 		return
 	}
 
-	for c := 0; c < r.DataShards; c++ {
+	for c := 0; c < r.dataShards; c++ {
 		in := newinputs[c]
 		if in == nil {
 			continue
@@ -543,7 +707,7 @@ func (r *reedSolomon) updateParityShardsP(matrixRows, oldinputs, newinputs, outp
 		}
 		wg.Add(1)
 		go func(start, stop int) {
-			for c := 0; c < r.DataShards; c++ {
+			for c := 0; c < r.dataShards; c++ {
 				in := newinputs[c]
 				if in == nil {
 					continue
@@ -565,7 +729,7 @@ func (r *reedSolomon) updateParityShardsP(matrixRows, oldinputs, newinputs, outp
 // Verify returns true if the parity shards contain the right data.
 // The data is the same format as Encode. No data is modified.
 func (r *reedSolomon) Verify(shards [][]byte) (bool, error) {
-	if len(shards) != r.Shards {
+	if len(shards) != r.totalShards {
 		return false, ErrTooFewShards
 	}
 	err := checkShards(shards, false)
@@ -574,10 +738,10 @@ func (r *reedSolomon) Verify(shards [][]byte) (bool, error) {
 	}
 
 	// Slice of buffers being checked.
-	toCheck := shards[r.DataShards:]
+	toCheck := shards[r.dataShards:]
 
 	// Do the checking.
-	return r.checkSomeShards(r.parity, shards[:r.DataShards], toCheck[:r.ParityShards], len(shards[0])), nil
+	return r.checkSomeShards(r.parity, shards[:r.dataShards], toCheck[:r.parityShards], len(shards[0])), nil
 }
 
 func (r *reedSolomon) canAVX2C(byteCount int, inputs, outputs int) bool {
@@ -587,11 +751,11 @@ func (r *reedSolomon) canAVX2C(byteCount int, inputs, outputs int) bool {
 }
 
 // Multiplies a subset of rows from a coding matrix by a full set of
-// input shards to produce some output shards.
+// input totalShards to produce some output totalShards.
 // 'matrixRows' is The rows from the matrix to use.
 // 'inputs' An array of byte arrays, each of which is one input shard.
 // The number of inputs used is determined by the length of each matrix row.
-// outputs Byte arrays where the computed shards are stored.
+// outputs Byte arrays where the computed totalShards are stored.
 // The number of outputs computed, and the
 // number of matrix rows used, is determined by
 // outputCount, which is the number of outputs to compute.
@@ -968,7 +1132,7 @@ func shardSize(shards [][]byte) int {
 // Given a list of shards, some of which contain data, fills in the
 // ones that don't have data.
 //
-// The length of the array must be equal to Shards.
+// The length of the array must be equal to shards.
 // You indicate that a shard is missing by setting it to nil or zero-length.
 // If a shard is zero-length but has sufficient capacity, that memory will
 // be used, otherwise a new []byte will be allocated.
@@ -979,7 +1143,7 @@ func shardSize(shards [][]byte) int {
 // The reconstructed shard set is complete, but integrity is not verified.
 // Use the Verify function to check if data set is ok.
 func (r *reedSolomon) Reconstruct(shards [][]byte) error {
-	return r.reconstruct(shards, false)
+	return r.reconstruct(shards, false, nil)
 }
 
 // ReconstructData will recreate any missing data shards, if possible.
@@ -987,7 +1151,7 @@ func (r *reedSolomon) Reconstruct(shards [][]byte) error {
 // Given a list of shards, some of which contain data, fills in the
 // data shards that don't have data.
 //
-// The length of the array must be equal to Shards.
+// The length of the array must be equal to shards.
 // You indicate that a shard is missing by setting it to nil or zero-length.
 // If a shard is zero-length but has sufficient capacity, that memory will
 // be used, otherwise a new []byte will be allocated.
@@ -998,19 +1162,39 @@ func (r *reedSolomon) Reconstruct(shards [][]byte) error {
 // As the reconstructed shard set may contain missing parity shards,
 // calling the Verify function is likely to fail.
 func (r *reedSolomon) ReconstructData(shards [][]byte) error {
-	return r.reconstruct(shards, true)
+	return r.reconstruct(shards, true, nil)
 }
 
-// reconstruct will recreate the missing data shards, and unless
+// ReconstructSome will recreate only requested data shards, if possible.
-// dataOnly is true, also the missing parity shards
 //
-// The length of the array must be equal to Shards.
+// Given a list of shards, some of which contain data, fills in the
-// You indicate that a shard is missing by setting it to nil.
+// data shards indicated by true values in the "required" parameter.
+// The length of "required" array must be equal to dataShards.
+//
+// The length of "shards" array must be equal to shards.
+// You indicate that a shard is missing by setting it to nil or zero-length.
+// If a shard is zero-length but has sufficient capacity, that memory will
+// be used, otherwise a new []byte will be allocated.
 //
 // If there are too few shards to reconstruct the missing
 // ones, ErrTooFewShards will be returned.
-func (r *reedSolomon) reconstruct(shards [][]byte, dataOnly bool) error {
+//
-	if len(shards) != r.Shards {
+// As the reconstructed shard set may contain missing parity shards,
+// calling the Verify function is likely to fail.
+func (r *reedSolomon) ReconstructSome(shards [][]byte, required []bool) error {
+	return r.reconstruct(shards, true, required)
+}
+
+// reconstruct will recreate the missing data totalShards, and unless
+// dataOnly is true, also the missing parity totalShards
+//
+// The length of "shards" array must be equal to totalShards.
+// You indicate that a shard is missing by setting it to nil.
+//
+// If there are too few totalShards to reconstruct the missing
+// ones, ErrTooFewShards will be returned.
+func (r *reedSolomon) reconstruct(shards [][]byte, dataOnly bool, required []bool) error {
+	if len(shards) != r.totalShards || required != nil && len(required) < r.dataShards {
 		return ErrTooFewShards
 	}
 	// Check arguments.
@@ -1025,22 +1209,26 @@ func (r *reedSolomon) reconstruct(shards [][]byte, dataOnly bool) error {
 	// nothing to do.
 	numberPresent := 0
 	dataPresent := 0
-	for i := 0; i < r.Shards; i++ {
+	missingRequired := 0
+	for i := 0; i < r.totalShards; i++ {
 		if len(shards[i]) != 0 {
 			numberPresent++
-			if i < r.DataShards {
+			if i < r.dataShards {
 				dataPresent++
 			}
+		} else if required != nil && required[i] {
+			missingRequired++
 		}
 	}
-	if numberPresent == r.Shards || dataOnly && dataPresent == r.DataShards {
+	if numberPresent == r.totalShards || dataOnly && dataPresent == r.dataShards ||
-		// Cool.  All of the shards data data.  We don't
+		required != nil && missingRequired == 0 {
+		// Cool. All of the shards have data. We don't
 		// need to do anything.
 		return nil
 	}
 
 	// More complete sanity check
-	if numberPresent < r.DataShards {
+	if numberPresent < r.dataShards {
 		return ErrTooFewShards
 	}
 
@@ -1051,11 +1239,11 @@ func (r *reedSolomon) reconstruct(shards [][]byte, dataOnly bool) error {
 	//
 	// Also, create an array of indices of the valid rows we do have
 	// and the invalid rows we don't have up until we have enough valid rows.
-	subShards := make([][]byte, r.DataShards)
+	subShards := make([][]byte, r.dataShards)
-	validIndices := make([]int, r.DataShards)
+	validIndices := make([]int, r.dataShards)
 	invalidIndices := make([]int, 0)
 	subMatrixRow := 0
-	for matrixRow := 0; matrixRow < r.Shards && subMatrixRow < r.DataShards; matrixRow++ {
+	for matrixRow := 0; matrixRow < r.totalShards && subMatrixRow < r.dataShards; matrixRow++ {
 		if len(shards[matrixRow]) != 0 {
 			subShards[subMatrixRow] = shards[matrixRow]
 			validIndices[subMatrixRow] = matrixRow
@@ -1077,9 +1265,9 @@ func (r *reedSolomon) reconstruct(shards [][]byte, dataOnly bool) error {
 		// shards that we have and build a square matrix.  This
 		// matrix could be used to generate the shards that we have
 		// from the original data.
-		subMatrix, _ := newMatrix(r.DataShards, r.DataShards)
+		subMatrix, _ := newMatrix(r.dataShards, r.dataShards)
 		for subMatrixRow, validIndex := range validIndices {
-			for c := 0; c < r.DataShards; c++ {
+			for c := 0; c < r.dataShards; c++ {
 				subMatrix[subMatrixRow][c] = r.m[validIndex][c]
 			}
 		}
@@ -1095,7 +1283,7 @@ func (r *reedSolomon) reconstruct(shards [][]byte, dataOnly bool) error {
 
 		// Cache the inverted matrix in the tree for future use keyed on the
 		// indices of the invalid rows.
-		err = r.tree.InsertInvertedMatrix(invalidIndices, dataDecodeMatrix, r.Shards)
+		err = r.tree.InsertInvertedMatrix(invalidIndices, dataDecodeMatrix, r.totalShards)
 		if err != nil {
 			return err
 		}
@@ -1106,12 +1294,12 @@ func (r *reedSolomon) reconstruct(shards [][]byte, dataOnly bool) error {
 	// The input to the coding is all of the shards we actually
 	// have, and the output is the missing data shards.  The computation
 	// is done using the special decode matrix we just built.
-	outputs := make([][]byte, r.ParityShards)
+	outputs := make([][]byte, r.parityShards)
-	matrixRows := make([][]byte, r.ParityShards)
+	matrixRows := make([][]byte, r.parityShards)
 	outputCount := 0
 
-	for iShard := 0; iShard < r.DataShards; iShard++ {
+	for iShard := 0; iShard < r.dataShards; iShard++ {
-		if len(shards[iShard]) == 0 {
+		if len(shards[iShard]) == 0 && (required == nil || required[iShard]) {
 			if cap(shards[iShard]) >= shardSize {
 				shards[iShard] = shards[iShard][0:shardSize]
 			} else {
@@ -1136,19 +1324,19 @@ func (r *reedSolomon) reconstruct(shards [][]byte, dataOnly bool) error {
 	// any that we just calculated.  The output is whichever of the
 	// data shards were missing.
 	outputCount = 0
-	for iShard := r.DataShards; iShard < r.Shards; iShard++ {
+	for iShard := r.dataShards; iShard < r.totalShards; iShard++ {
-		if len(shards[iShard]) == 0 {
+		if len(shards[iShard]) == 0 && (required == nil || required[iShard]) {
 			if cap(shards[iShard]) >= shardSize {
 				shards[iShard] = shards[iShard][0:shardSize]
 			} else {
 				shards[iShard] = make([]byte, shardSize)
 			}
 			outputs[outputCount] = shards[iShard]
-			matrixRows[outputCount] = r.parity[iShard-r.DataShards]
+			matrixRows[outputCount] = r.parity[iShard-r.dataShards]
 			outputCount++
 		}
 	}
-	r.codeSomeShards(matrixRows, shards[:r.DataShards], outputs[:outputCount], shardSize)
+	r.codeSomeShards(matrixRows, shards[:r.dataShards], outputs[:outputCount], shardSize)
 	return nil
 }
 
@@ -1174,7 +1362,7 @@ func (r *reedSolomon) Split(data []byte) ([][]byte, error) {
 	}
 	dataLen := len(data)
 	// Calculate number of bytes per data shard.
-	perShard := (len(data) + r.DataShards - 1) / r.DataShards
+	perShard := (len(data) + r.dataShards - 1) / r.dataShards
 
 	if cap(data) > len(data) {
 		data = data[:cap(data)]
@@ -1182,20 +1370,20 @@ func (r *reedSolomon) Split(data []byte) ([][]byte, error) {
 
 	// Only allocate memory if necessary
 	var padding []byte
-	if len(data) < (r.Shards * perShard) {
+	if len(data) < (r.totalShards * perShard) {
 		// calculate maximum number of full shards in `data` slice
 		fullShards := len(data) / perShard
-		padding = make([]byte, r.Shards*perShard-perShard*fullShards)
+		padding = make([]byte, r.totalShards*perShard-perShard*fullShards)
 		copy(padding, data[perShard*fullShards:])
 		data = data[0 : perShard*fullShards]
 	} else {
-		for i := dataLen; i < dataLen+r.DataShards; i++ {
+		for i := dataLen; i < dataLen+r.dataShards; i++ {
 			data[i] = 0
 		}
 	}
 
 	// Split into equal-length shards.
-	dst := make([][]byte, r.Shards)
+	dst := make([][]byte, r.totalShards)
 	i := 0
 	for ; i < len(dst) && len(data) >= perShard; i++ {
 		dst[i] = data[:perShard:perShard]
@@ -1224,10 +1412,10 @@ var ErrReconstructRequired = errors.New("reconstruction required as one or more
 // If one or more required data shards are nil, ErrReconstructRequired will be returned.
 func (r *reedSolomon) Join(dst io.Writer, shards [][]byte, outSize int) error {
 	// Do we have enough shards?
-	if len(shards) < r.DataShards {
+	if len(shards) < r.dataShards {
 		return ErrTooFewShards
 	}
-	shards = shards[:r.DataShards]
+	shards = shards[:r.dataShards]
 
 	// Do we have enough data?
 	size := 0

vendor/github.com/klauspost/reedsolomon/streaming.go

@@ -147,6 +147,10 @@ type rsStream struct {
 // you want to use. You can reuse this encoder.
 // Note that the maximum number of data shards is 256.
 func NewStream(dataShards, parityShards int, o ...Option) (StreamEncoder, error) {
+	if dataShards+parityShards > 256 {
+		return nil, ErrMaxShardNum
+	}
+
 	r := rsStream{o: defaultOptions}
 	for _, opt := range o {
 		opt(&r.o)
@@ -219,18 +223,18 @@ func (r *rsStream) createSlice() [][]byte {
 // will be returned. If a parity writer returns an error, a
 // StreamWriteError will be returned.
 func (r *rsStream) Encode(data []io.Reader, parity []io.Writer) error {
-	if len(data) != r.r.DataShards {
+	if len(data) != r.r.dataShards {
 		return ErrTooFewShards
 	}
 
-	if len(parity) != r.r.ParityShards {
+	if len(parity) != r.r.parityShards {
 		return ErrTooFewShards
 	}
 
 	all := r.createSlice()
 	defer r.blockPool.Put(all)
-	in := all[:r.r.DataShards]
+	in := all[:r.r.dataShards]
-	out := all[r.r.DataShards:]
+	out := all[r.r.dataShards:]
 	read := 0
 
 	for {
@@ -425,7 +429,7 @@ func cWriteShards(out []io.Writer, in [][]byte) error {
 // If a shard stream returns an error, a StreamReadError type error
 // will be returned.
 func (r *rsStream) Verify(shards []io.Reader) (bool, error) {
-	if len(shards) != r.r.Shards {
+	if len(shards) != r.r.totalShards {
 		return false, ErrTooFewShards
 	}
 
@@ -472,10 +476,10 @@ var ErrReconstructMismatch = errors.New("valid shards and fill shards are mutual
 // However its integrity is not automatically verified.
 // Use the Verify function to check in case the data set is complete.
 func (r *rsStream) Reconstruct(valid []io.Reader, fill []io.Writer) error {
-	if len(valid) != r.r.Shards {
+	if len(valid) != r.r.totalShards {
 		return ErrTooFewShards
 	}
-	if len(fill) != r.r.Shards {
+	if len(fill) != r.r.totalShards {
 		return ErrTooFewShards
 	}
 
@@ -486,7 +490,7 @@ func (r *rsStream) Reconstruct(valid []io.Reader, fill []io.Writer) error {
 		if valid[i] != nil && fill[i] != nil {
 			return ErrReconstructMismatch
 		}
-		if i >= r.r.DataShards && fill[i] != nil {
+		if i >= r.r.dataShards && fill[i] != nil {
 			reconDataOnly = false
 		}
 	}
@@ -530,12 +534,12 @@ func (r *rsStream) Reconstruct(valid []io.Reader, fill []io.Writer) error {
 // If the total data size is less than outSize, ErrShortData will be returned.
 func (r *rsStream) Join(dst io.Writer, shards []io.Reader, outSize int64) error {
 	// Do we have enough shards?
-	if len(shards) < r.r.DataShards {
+	if len(shards) < r.r.dataShards {
 		return ErrTooFewShards
 	}
 
 	// Trim off parity shards if any
-	shards = shards[:r.r.DataShards]
+	shards = shards[:r.r.dataShards]
 	for i := range shards {
 		if shards[i] == nil {
 			return StreamReadError{Err: ErrShardNoData, Stream: i}
@@ -571,7 +575,7 @@ func (r *rsStream) Split(data io.Reader, dst []io.Writer, size int64) error {
 	if size == 0 {
 		return ErrShortData
 	}
-	if len(dst) != r.r.DataShards {
+	if len(dst) != r.r.dataShards {
 		return ErrInvShardNum
 	}
 
@@ -582,10 +586,10 @@ func (r *rsStream) Split(data io.Reader, dst []io.Writer, size int64) error {
 	}
 
 	// Calculate number of bytes per shard.
-	perShard := (size + int64(r.r.DataShards) - 1) / int64(r.r.DataShards)
+	perShard := (size + int64(r.r.dataShards) - 1) / int64(r.r.dataShards)
 
 	// Pad data to r.Shards*perShard.
-	padding := make([]byte, (int64(r.r.Shards)*perShard)-size)
+	padding := make([]byte, (int64(r.r.totalShards)*perShard)-size)
 	data = io.MultiReader(data, bytes.NewBuffer(padding))
 
 	// Split into equal-length shards and copy.

vendor/golang.org/x/crypto/AUTHORS

@@ -1,3 +0,0 @@
-# This source code refers to The Go Authors for copyright purposes.
-# The master list of authors is in the main Go distribution,
-# visible at https://tip.golang.org/AUTHORS.

vendor/golang.org/x/crypto/CONTRIBUTORS

@@ -1,3 +0,0 @@
-# This source code was written by the Go contributors.
-# The master list of contributors is in the main Go distribution,
-# visible at https://tip.golang.org/CONTRIBUTORS.

vendor/golang.org/x/crypto/argon2/argon2.go

@@ -11,8 +11,7 @@
 // If you aren't sure which function you need, use Argon2id (IDKey) and
 // the parameter recommendations for your scenario.
 //
-//
+// # Argon2i
-// Argon2i
 //
 // Argon2i (implemented by Key) is the side-channel resistant version of Argon2.
 // It uses data-independent memory access, which is preferred for password
@@ -21,8 +20,7 @@
 // parameters (taken from [2]) for non-interactive operations are time=3 and to
 // use the maximum available memory.
 //
-//
+// # Argon2id
-// Argon2id
 //
 // Argon2id (implemented by IDKey) is a hybrid version of Argon2 combining
 // Argon2i and Argon2d. It uses data-independent memory access for the first
@@ -59,7 +57,7 @@ const (
 // For example, you can get a derived key for e.g. AES-256 (which needs a
 // 32-byte key) by doing:
 //
-//      key := argon2.Key([]byte("some password"), salt, 3, 32*1024, 4, 32)
+//	key := argon2.Key([]byte("some password"), salt, 3, 32*1024, 4, 32)
 //
 // The draft RFC recommends[2] time=3, and memory=32*1024 is a sensible number.
 // If using that amount of memory (32 MB) is not possible in some contexts then
@@ -83,7 +81,7 @@ func Key(password, salt []byte, time, memory uint32, threads uint8, keyLen uint3
 // For example, you can get a derived key for e.g. AES-256 (which needs a
 // 32-byte key) by doing:
 //
-//      key := argon2.IDKey([]byte("some password"), salt, 1, 64*1024, 4, 32)
+//	key := argon2.IDKey([]byte("some password"), salt, 1, 64*1024, 4, 32)
 //
 // The draft RFC recommends[2] time=1, and memory=64*1024 is a sensible number.
 // If using that amount of memory (64 MB) is not possible in some contexts then

vendor/golang.org/x/crypto/internal/subtle/aliasing.go

@@ -1,33 +0,0 @@
-// Copyright 2018 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-//go:build !purego
-// +build !purego
-
-// Package subtle implements functions that are often useful in cryptographic
-// code but require careful thought to use correctly.
-package subtle // import "golang.org/x/crypto/internal/subtle"
-
-import "unsafe"
-
-// AnyOverlap reports whether x and y share memory at any (not necessarily
-// corresponding) index. The memory beyond the slice length is ignored.
-func AnyOverlap(x, y []byte) bool {
-	return len(x) > 0 && len(y) > 0 &&
-		uintptr(unsafe.Pointer(&x[0])) <= uintptr(unsafe.Pointer(&y[len(y)-1])) &&
-		uintptr(unsafe.Pointer(&y[0])) <= uintptr(unsafe.Pointer(&x[len(x)-1]))
-}
-
-// InexactOverlap reports whether x and y share memory at any non-corresponding
-// index. The memory beyond the slice length is ignored. Note that x and y can
-// have different lengths and still not have any inexact overlap.
-//
-// InexactOverlap can be used to implement the requirements of the crypto/cipher
-// AEAD, Block, BlockMode and Stream interfaces.
-func InexactOverlap(x, y []byte) bool {
-	if len(x) == 0 || len(y) == 0 || &x[0] == &y[0] {
-		return false
-	}
-	return AnyOverlap(x, y)
-}

vendor/golang.org/x/crypto/internal/subtle/aliasing_purego.go

@@ -1,36 +0,0 @@
-// Copyright 2018 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-//go:build purego
-// +build purego
-
-// Package subtle implements functions that are often useful in cryptographic
-// code but require careful thought to use correctly.
-package subtle // import "golang.org/x/crypto/internal/subtle"
-
-// This is the Google App Engine standard variant based on reflect
-// because the unsafe package and cgo are disallowed.
-
-import "reflect"
-
-// AnyOverlap reports whether x and y share memory at any (not necessarily
-// corresponding) index. The memory beyond the slice length is ignored.
-func AnyOverlap(x, y []byte) bool {
-	return len(x) > 0 && len(y) > 0 &&
-		reflect.ValueOf(&x[0]).Pointer() <= reflect.ValueOf(&y[len(y)-1]).Pointer() &&
-		reflect.ValueOf(&y[0]).Pointer() <= reflect.ValueOf(&x[len(x)-1]).Pointer()
-}
-
-// InexactOverlap reports whether x and y share memory at any non-corresponding
-// index. The memory beyond the slice length is ignored. Note that x and y can
-// have different lengths and still not have any inexact overlap.
-//
-// InexactOverlap can be used to implement the requirements of the crypto/cipher
-// AEAD, Block, BlockMode and Stream interfaces.
-func InexactOverlap(x, y []byte) bool {
-	if len(x) == 0 || len(y) == 0 || &x[0] == &y[0] {
-		return false
-	}
-	return AnyOverlap(x, y)
-}

vendor/golang.org/x/crypto/pbkdf2/pbkdf2.go

@@ -32,7 +32,7 @@ import (
 // can get a derived key for e.g. AES-256 (which needs a 32-byte key) by
 // doing:
 //
-// 	dk := pbkdf2.Key([]byte("some password"), salt, 4096, 32, sha1.New)
+//	dk := pbkdf2.Key([]byte("some password"), salt, 4096, 32, sha1.New)
 //
 // Remember to get a good random salt. At least 8 bytes is recommended by the
 // RFC.

vendor/golang.org/x/crypto/salsa20/salsa20.go

@@ -24,7 +24,7 @@ package salsa20 // import "golang.org/x/crypto/salsa20"
 // TODO(agl): implement XORKeyStream12 and XORKeyStream8 - the reduced round variants of Salsa20.
 
 import (
-	"golang.org/x/crypto/internal/subtle"
+	"golang.org/x/crypto/internal/alias"
 	"golang.org/x/crypto/salsa20/salsa"
 )
 
@@ -35,7 +35,7 @@ func XORKeyStream(out, in []byte, nonce []byte, key *[32]byte) {
 	if len(out) < len(in) {
 		panic("salsa20: output smaller than input")
 	}
-	if subtle.InexactOverlap(out[:len(in)], in) {
+	if alias.InexactOverlap(out[:len(in)], in) {
 		panic("salsa20: invalid buffer overlap")
 	}
 

vendor/golang.org/x/crypto/scrypt/scrypt.go

@@ -186,7 +186,7 @@ func smix(b []byte, r, N int, v, xy []uint32) {
 // For example, you can get a derived key for e.g. AES-256 (which needs a
 // 32-byte key) by doing:
 //
-//      dk, err := scrypt.Key([]byte("some password"), salt, 32768, 8, 1, 32)
+//	dk, err := scrypt.Key([]byte("some password"), salt, 32768, 8, 1, 32)
 //
 // The recommended parameters for interactive logins as of 2017 are N=32768, r=8
 // and p=1. The parameters N, r, and p should be increased as memory latency and

vendor/golang.org/x/crypto/sha3/doc.go

@@ -8,8 +8,7 @@
 // Both types of hash function use the "sponge" construction and the Keccak
 // permutation. For a detailed specification see http://keccak.noekeon.org/
 //
-//
+// # Guidance
-// Guidance
 //
 // If you aren't sure what function you need, use SHAKE256 with at least 64
 // bytes of output. The SHAKE instances are faster than the SHA3 instances;
@@ -19,8 +18,7 @@
 // secret key to the input, hash with SHAKE256 and read at least 32 bytes of
 // output.
 //
-//
+// # Security strengths
-// Security strengths
 //
 // The SHA3-x (x equals 224, 256, 384, or 512) functions have a security
 // strength against preimage attacks of x bits. Since they only produce "x"
@@ -31,8 +29,7 @@
 // is used.  Requesting more than 64 or 32 bytes of output, respectively, does
 // not increase the collision-resistance of the SHAKE functions.
 //
-//
+// # The sponge construction
-// The sponge construction
 //
 // A sponge builds a pseudo-random function from a public pseudo-random
 // permutation, by applying the permutation to a state of "rate + capacity"
@@ -50,8 +47,7 @@
 // Since the KeccakF-1600 permutation is 1600 bits (200 bytes) wide, this means
 // that the security strength of a sponge instance is equal to (1600 - bitrate) / 2.
 //
-//
+// # Recommendations
-// Recommendations
 //
 // The SHAKE functions are recommended for most new uses. They can produce
 // output of arbitrary length. SHAKE256, with an output length of at least

vendor/golang.org/x/crypto/sha3/sha3_s390x.go

@@ -34,11 +34,13 @@ const (
 
 // kimd is a wrapper for the 'compute intermediate message digest' instruction.
 // src must be a multiple of the rate for the given function code.
+//
 //go:noescape
 func kimd(function code, chain *[200]byte, src []byte)
 
 // klmd is a wrapper for the 'compute last message digest' instruction.
 // src padding is handled by the instruction.
+//
 //go:noescape
 func klmd(function code, chain *[200]byte, dst, src []byte)
 

vendor/golang.org/x/sys/AUTHORS

@@ -1,3 +0,0 @@
-# This source code refers to The Go Authors for copyright purposes.
-# The master list of authors is in the main Go distribution,
-# visible at http://tip.golang.org/AUTHORS.

vendor/golang.org/x/sys/CONTRIBUTORS

@@ -1,3 +0,0 @@
-# This source code was written by the Go contributors.
-# The master list of contributors is in the main Go distribution,
-# visible at http://tip.golang.org/CONTRIBUTORS.

vendor/golang.org/x/sys/cpu/byteorder.go

@@ -46,6 +46,7 @@ func hostByteOrder() byteOrder {
 	case "386", "amd64", "amd64p32",
 		"alpha",
 		"arm", "arm64",
+		"loong64",
 		"mipsle", "mips64le", "mips64p32le",
 		"nios2",
 		"ppc64le",

vendor/golang.org/x/sys/cpu/cpu.go

@@ -106,8 +106,8 @@ var ARM64 struct {
 
 // ARM contains the supported CPU features of the current ARM (32-bit) platform.
 // All feature flags are false if:
-//   1. the current platform is not arm, or
+//  1. the current platform is not arm, or
-//   2. the current operating system is not Linux.
+//  2. the current operating system is not Linux.
 var ARM struct {
 	_           CacheLinePad
 	HasSWP      bool // SWP instruction support

vendor/golang.org/x/sys/cpu/cpu_arm64.go

@@ -6,7 +6,10 @@ package cpu
 
 import "runtime"
 
-const cacheLineSize = 64
+// cacheLineSize is used to prevent false sharing of cache lines.
+// We choose 128 because Apple Silicon, a.k.a. M1, has 128-byte cache line size.
+// It doesn't cost much and is much more future-proof.
+const cacheLineSize = 128
 
 func initOptions() {
 	options = []option{
@@ -41,13 +44,10 @@ func archInit() {
 	switch runtime.GOOS {
 	case "freebsd":
 		readARM64Registers()
-	case "linux", "netbsd":
+	case "linux", "netbsd", "openbsd":
 		doinit()
 	default:
-		// Most platforms don't seem to allow reading these registers.
+		// Many platforms don't seem to allow reading these registers.
-		//
-		// OpenBSD:
-		// See https://golang.org/issue/31746
 		setMinimalFeatures()
 	}
 }

vendor/golang.org/x/sys/cpu/cpu_gccgo_x86.c

@@ -7,6 +7,7 @@
 
 #include <cpuid.h>
 #include <stdint.h>
+#include <x86intrin.h>
 
 // Need to wrap __get_cpuid_count because it's declared as static.
 int
@@ -17,27 +18,21 @@ gccgoGetCpuidCount(uint32_t leaf, uint32_t subleaf,
 	return __get_cpuid_count(leaf, subleaf, eax, ebx, ecx, edx);
 }
 
+#pragma GCC diagnostic ignored "-Wunknown-pragmas"
+#pragma GCC push_options
+#pragma GCC target("xsave")
+#pragma clang attribute push (__attribute__((target("xsave"))), apply_to=function)
+
 // xgetbv reads the contents of an XCR (Extended Control Register)
 // specified in the ECX register into registers EDX:EAX.
 // Currently, the only supported value for XCR is 0.
-//
-// TODO: Replace with a better alternative:
-//
-//     #include <xsaveintrin.h>
-//
-//     #pragma GCC target("xsave")
-//
-//     void gccgoXgetbv(uint32_t *eax, uint32_t *edx) {
-//       unsigned long long x = _xgetbv(0);
-//       *eax = x & 0xffffffff;
-//       *edx = (x >> 32) & 0xffffffff;
-//     }
-//
-// Note that _xgetbv is defined starting with GCC 8.
 void
 gccgoXgetbv(uint32_t *eax, uint32_t *edx)
 {
-	__asm("  xorl %%ecx, %%ecx\n"
+	uint64_t v = _xgetbv(0);
-	      "  xgetbv"
+	*eax = v & 0xffffffff;
-	    : "=a"(*eax), "=d"(*edx));
+	*edx = v >> 32;
 }
+
+#pragma clang attribute pop
+#pragma GCC pop_options

vendor/golang.org/x/sys/cpu/cpu_other_arm64.go

@@ -2,8 +2,8 @@
 // Use of this source code is governed by a BSD-style
 // license that can be found in the LICENSE file.
 
-//go:build !linux && !netbsd && arm64
+//go:build !linux && !netbsd && !openbsd && arm64
-// +build !linux,!netbsd,arm64
+// +build !linux,!netbsd,!openbsd,arm64
 
 package cpu
 

vendor/golang.org/x/sys/unix/endian_little.go

@@ -2,8 +2,8 @@
 // Use of this source code is governed by a BSD-style
 // license that can be found in the LICENSE file.
 //
-//go:build 386 || amd64 || amd64p32 || alpha || arm || arm64 || mipsle || mips64le || mips64p32le || nios2 || ppc64le || riscv || riscv64 || sh
+//go:build 386 || amd64 || amd64p32 || alpha || arm || arm64 || loong64 || mipsle || mips64le || mips64p32le || nios2 || ppc64le || riscv || riscv64 || sh
-// +build 386 amd64 amd64p32 alpha arm arm64 mipsle mips64le mips64p32le nios2 ppc64le riscv riscv64 sh
+// +build 386 amd64 amd64p32 alpha arm arm64 loong64 mipsle mips64le mips64p32le nios2 ppc64le riscv riscv64 sh
 
 package unix
 

vendor/golang.org/x/sys/unix/errors_freebsd_386.go

@@ -1,233 +0,0 @@
-// Copyright 2017 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-// Constants that were deprecated or moved to enums in the FreeBSD headers. Keep
-// them here for backwards compatibility.
-
-package unix
-
-const (
-	DLT_HHDLC                         = 0x79
-	IFF_SMART                         = 0x20
-	IFT_1822                          = 0x2
-	IFT_A12MPPSWITCH                  = 0x82
-	IFT_AAL2                          = 0xbb
-	IFT_AAL5                          = 0x31
-	IFT_ADSL                          = 0x5e
-	IFT_AFLANE8023                    = 0x3b
-	IFT_AFLANE8025                    = 0x3c
-	IFT_ARAP                          = 0x58
-	IFT_ARCNET                        = 0x23
-	IFT_ARCNETPLUS                    = 0x24
-	IFT_ASYNC                         = 0x54
-	IFT_ATM                           = 0x25
-	IFT_ATMDXI                        = 0x69
-	IFT_ATMFUNI                       = 0x6a
-	IFT_ATMIMA                        = 0x6b
-	IFT_ATMLOGICAL                    = 0x50
-	IFT_ATMRADIO                      = 0xbd
-	IFT_ATMSUBINTERFACE               = 0x86
-	IFT_ATMVCIENDPT                   = 0xc2
-	IFT_ATMVIRTUAL                    = 0x95
-	IFT_BGPPOLICYACCOUNTING           = 0xa2
-	IFT_BSC                           = 0x53
-	IFT_CCTEMUL                       = 0x3d
-	IFT_CEPT                          = 0x13
-	IFT_CES                           = 0x85
-	IFT_CHANNEL                       = 0x46
-	IFT_CNR                           = 0x55
-	IFT_COFFEE                        = 0x84
-	IFT_COMPOSITELINK                 = 0x9b
-	IFT_DCN                           = 0x8d
-	IFT_DIGITALPOWERLINE              = 0x8a
-	IFT_DIGITALWRAPPEROVERHEADCHANNEL = 0xba
-	IFT_DLSW                          = 0x4a
-	IFT_DOCSCABLEDOWNSTREAM           = 0x80
-	IFT_DOCSCABLEMACLAYER             = 0x7f
-	IFT_DOCSCABLEUPSTREAM             = 0x81
-	IFT_DS0                           = 0x51
-	IFT_DS0BUNDLE                     = 0x52
-	IFT_DS1FDL                        = 0xaa
-	IFT_DS3                           = 0x1e
-	IFT_DTM                           = 0x8c
-	IFT_DVBASILN                      = 0xac
-	IFT_DVBASIOUT                     = 0xad
-	IFT_DVBRCCDOWNSTREAM              = 0x93
-	IFT_DVBRCCMACLAYER                = 0x92
-	IFT_DVBRCCUPSTREAM                = 0x94
-	IFT_ENC                           = 0xf4
-	IFT_EON                           = 0x19
-	IFT_EPLRS                         = 0x57
-	IFT_ESCON                         = 0x49
-	IFT_ETHER                         = 0x6
-	IFT_FAITH                         = 0xf2
-	IFT_FAST                          = 0x7d
-	IFT_FASTETHER                     = 0x3e
-	IFT_FASTETHERFX                   = 0x45
-	IFT_FDDI                          = 0xf
-	IFT_FIBRECHANNEL                  = 0x38
-	IFT_FRAMERELAYINTERCONNECT        = 0x3a
-	IFT_FRAMERELAYMPI                 = 0x5c
-	IFT_FRDLCIENDPT                   = 0xc1
-	IFT_FRELAY                        = 0x20
-	IFT_FRELAYDCE                     = 0x2c
-	IFT_FRF16MFRBUNDLE                = 0xa3
-	IFT_FRFORWARD                     = 0x9e
-	IFT_G703AT2MB                     = 0x43
-	IFT_G703AT64K                     = 0x42
-	IFT_GIF                           = 0xf0
-	IFT_GIGABITETHERNET               = 0x75
-	IFT_GR303IDT                      = 0xb2
-	IFT_GR303RDT                      = 0xb1
-	IFT_H323GATEKEEPER                = 0xa4
-	IFT_H323PROXY                     = 0xa5
-	IFT_HDH1822                       = 0x3
-	IFT_HDLC                          = 0x76
-	IFT_HDSL2                         = 0xa8
-	IFT_HIPERLAN2                     = 0xb7
-	IFT_HIPPI                         = 0x2f
-	IFT_HIPPIINTERFACE                = 0x39
-	IFT_HOSTPAD                       = 0x5a
-	IFT_HSSI                          = 0x2e
-	IFT_HY                            = 0xe
-	IFT_IBM370PARCHAN                 = 0x48
-	IFT_IDSL                          = 0x9a
-	IFT_IEEE80211                     = 0x47
-	IFT_IEEE80212                     = 0x37
-	IFT_IEEE8023ADLAG                 = 0xa1
-	IFT_IFGSN                         = 0x91
-	IFT_IMT                           = 0xbe
-	IFT_INTERLEAVE                    = 0x7c
-	IFT_IP                            = 0x7e
-	IFT_IPFORWARD                     = 0x8e
-	IFT_IPOVERATM                     = 0x72
-	IFT_IPOVERCDLC                    = 0x6d
-	IFT_IPOVERCLAW                    = 0x6e
-	IFT_IPSWITCH                      = 0x4e
-	IFT_IPXIP                         = 0xf9
-	IFT_ISDN                          = 0x3f
-	IFT_ISDNBASIC                     = 0x14
-	IFT_ISDNPRIMARY                   = 0x15
-	IFT_ISDNS                         = 0x4b
-	IFT_ISDNU                         = 0x4c
-	IFT_ISO88022LLC                   = 0x29
-	IFT_ISO88023                      = 0x7
-	IFT_ISO88024                      = 0x8
-	IFT_ISO88025                      = 0x9
-	IFT_ISO88025CRFPINT               = 0x62
-	IFT_ISO88025DTR                   = 0x56
-	IFT_ISO88025FIBER                 = 0x73
-	IFT_ISO88026                      = 0xa
-	IFT_ISUP                          = 0xb3
-	IFT_L3IPXVLAN                     = 0x89
-	IFT_LAPB                          = 0x10
-	IFT_LAPD                          = 0x4d
-	IFT_LAPF                          = 0x77
-	IFT_LOCALTALK                     = 0x2a
-	IFT_LOOP                          = 0x18
-	IFT_MEDIAMAILOVERIP               = 0x8b
-	IFT_MFSIGLINK                     = 0xa7
-	IFT_MIOX25                        = 0x26
-	IFT_MODEM                         = 0x30
-	IFT_MPC                           = 0x71
-	IFT_MPLS                          = 0xa6
-	IFT_MPLSTUNNEL                    = 0x96
-	IFT_MSDSL                         = 0x8f
-	IFT_MVL                           = 0xbf
-	IFT_MYRINET                       = 0x63
-	IFT_NFAS                          = 0xaf
-	IFT_NSIP                          = 0x1b
-	IFT_OPTICALCHANNEL                = 0xc3
-	IFT_OPTICALTRANSPORT              = 0xc4
-	IFT_OTHER                         = 0x1
-	IFT_P10                           = 0xc
-	IFT_P80                           = 0xd
-	IFT_PARA                          = 0x22
-	IFT_PFLOG                         = 0xf6
-	IFT_PFSYNC                        = 0xf7
-	IFT_PLC                           = 0xae
-	IFT_POS                           = 0xab
-	IFT_PPPMULTILINKBUNDLE            = 0x6c
-	IFT_PROPBWAP2MP                   = 0xb8
-	IFT_PROPCNLS                      = 0x59
-	IFT_PROPDOCSWIRELESSDOWNSTREAM    = 0xb5
-	IFT_PROPDOCSWIRELESSMACLAYER      = 0xb4
-	IFT_PROPDOCSWIRELESSUPSTREAM      = 0xb6
-	IFT_PROPMUX                       = 0x36
-	IFT_PROPWIRELESSP2P               = 0x9d
-	IFT_PTPSERIAL                     = 0x16
-	IFT_PVC                           = 0xf1
-	IFT_QLLC                          = 0x44
-	IFT_RADIOMAC                      = 0xbc
-	IFT_RADSL                         = 0x5f
-	IFT_REACHDSL                      = 0xc0
-	IFT_RFC1483                       = 0x9f
-	IFT_RS232                         = 0x21
-	IFT_RSRB                          = 0x4f
-	IFT_SDLC                          = 0x11
-	IFT_SDSL                          = 0x60
-	IFT_SHDSL                         = 0xa9
-	IFT_SIP                           = 0x1f
-	IFT_SLIP                          = 0x1c
-	IFT_SMDSDXI                       = 0x2b
-	IFT_SMDSICIP                      = 0x34
-	IFT_SONET                         = 0x27
-	IFT_SONETOVERHEADCHANNEL          = 0xb9
-	IFT_SONETPATH                     = 0x32
-	IFT_SONETVT                       = 0x33
-	IFT_SRP                           = 0x97
-	IFT_SS7SIGLINK                    = 0x9c
-	IFT_STACKTOSTACK                  = 0x6f
-	IFT_STARLAN                       = 0xb
-	IFT_STF                           = 0xd7
-	IFT_T1                            = 0x12
-	IFT_TDLC                          = 0x74
-	IFT_TERMPAD                       = 0x5b
-	IFT_TR008                         = 0xb0
-	IFT_TRANSPHDLC                    = 0x7b
-	IFT_TUNNEL                        = 0x83
-	IFT_ULTRA                         = 0x1d
-	IFT_USB                           = 0xa0
-	IFT_V11                           = 0x40
-	IFT_V35                           = 0x2d
-	IFT_V36                           = 0x41
-	IFT_V37                           = 0x78
-	IFT_VDSL                          = 0x61
-	IFT_VIRTUALIPADDRESS              = 0x70
-	IFT_VOICEEM                       = 0x64
-	IFT_VOICEENCAP                    = 0x67
-	IFT_VOICEFXO                      = 0x65
-	IFT_VOICEFXS                      = 0x66
-	IFT_VOICEOVERATM                  = 0x98
-	IFT_VOICEOVERFRAMERELAY           = 0x99
-	IFT_VOICEOVERIP                   = 0x68
-	IFT_X213                          = 0x5d
-	IFT_X25                           = 0x5
-	IFT_X25DDN                        = 0x4
-	IFT_X25HUNTGROUP                  = 0x7a
-	IFT_X25MLP                        = 0x79
-	IFT_X25PLE                        = 0x28
-	IFT_XETHER                        = 0x1a
-	IPPROTO_MAXID                     = 0x34
-	IPV6_FAITH                        = 0x1d
-	IPV6_MIN_MEMBERSHIPS              = 0x1f
-	IP_FAITH                          = 0x16
-	IP_MAX_SOURCE_FILTER              = 0x400
-	IP_MIN_MEMBERSHIPS                = 0x1f
-	MAP_NORESERVE                     = 0x40
-	MAP_RENAME                        = 0x20
-	NET_RT_MAXID                      = 0x6
-	RTF_PRCLONING                     = 0x10000
-	RTM_OLDADD                        = 0x9
-	RTM_OLDDEL                        = 0xa
-	RT_CACHING_CONTEXT                = 0x1
-	RT_NORTREF                        = 0x2
-	SIOCADDRT                         = 0x8030720a
-	SIOCALIFADDR                      = 0x8118691b
-	SIOCDELRT                         = 0x8030720b
-	SIOCDLIFADDR                      = 0x8118691d
-	SIOCGLIFADDR                      = 0xc118691c
-	SIOCGLIFPHYADDR                   = 0xc118694b
-	SIOCSLIFPHYADDR                   = 0x8118694a
-)

vendor/golang.org/x/sys/unix/errors_freebsd_amd64.go

@@ -1,233 +0,0 @@
-// Copyright 2017 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-// Constants that were deprecated or moved to enums in the FreeBSD headers. Keep
-// them here for backwards compatibility.
-
-package unix
-
-const (
-	DLT_HHDLC                         = 0x79
-	IFF_SMART                         = 0x20
-	IFT_1822                          = 0x2
-	IFT_A12MPPSWITCH                  = 0x82
-	IFT_AAL2                          = 0xbb
-	IFT_AAL5                          = 0x31
-	IFT_ADSL                          = 0x5e
-	IFT_AFLANE8023                    = 0x3b
-	IFT_AFLANE8025                    = 0x3c
-	IFT_ARAP                          = 0x58
-	IFT_ARCNET                        = 0x23
-	IFT_ARCNETPLUS                    = 0x24
-	IFT_ASYNC                         = 0x54
-	IFT_ATM                           = 0x25
-	IFT_ATMDXI                        = 0x69
-	IFT_ATMFUNI                       = 0x6a
-	IFT_ATMIMA                        = 0x6b
-	IFT_ATMLOGICAL                    = 0x50
-	IFT_ATMRADIO                      = 0xbd
-	IFT_ATMSUBINTERFACE               = 0x86
-	IFT_ATMVCIENDPT                   = 0xc2
-	IFT_ATMVIRTUAL                    = 0x95
-	IFT_BGPPOLICYACCOUNTING           = 0xa2
-	IFT_BSC                           = 0x53
-	IFT_CCTEMUL                       = 0x3d
-	IFT_CEPT                          = 0x13
-	IFT_CES                           = 0x85
-	IFT_CHANNEL                       = 0x46
-	IFT_CNR                           = 0x55
-	IFT_COFFEE                        = 0x84
-	IFT_COMPOSITELINK                 = 0x9b
-	IFT_DCN                           = 0x8d
-	IFT_DIGITALPOWERLINE              = 0x8a
-	IFT_DIGITALWRAPPEROVERHEADCHANNEL = 0xba
-	IFT_DLSW                          = 0x4a
-	IFT_DOCSCABLEDOWNSTREAM           = 0x80
-	IFT_DOCSCABLEMACLAYER             = 0x7f
-	IFT_DOCSCABLEUPSTREAM             = 0x81
-	IFT_DS0                           = 0x51
-	IFT_DS0BUNDLE                     = 0x52
-	IFT_DS1FDL                        = 0xaa
-	IFT_DS3                           = 0x1e
-	IFT_DTM                           = 0x8c
-	IFT_DVBASILN                      = 0xac
-	IFT_DVBASIOUT                     = 0xad
-	IFT_DVBRCCDOWNSTREAM              = 0x93
-	IFT_DVBRCCMACLAYER                = 0x92
-	IFT_DVBRCCUPSTREAM                = 0x94
-	IFT_ENC                           = 0xf4
-	IFT_EON                           = 0x19
-	IFT_EPLRS                         = 0x57
-	IFT_ESCON                         = 0x49
-	IFT_ETHER                         = 0x6
-	IFT_FAITH                         = 0xf2
-	IFT_FAST                          = 0x7d
-	IFT_FASTETHER                     = 0x3e
-	IFT_FASTETHERFX                   = 0x45
-	IFT_FDDI                          = 0xf
-	IFT_FIBRECHANNEL                  = 0x38
-	IFT_FRAMERELAYINTERCONNECT        = 0x3a
-	IFT_FRAMERELAYMPI                 = 0x5c
-	IFT_FRDLCIENDPT                   = 0xc1
-	IFT_FRELAY                        = 0x20
-	IFT_FRELAYDCE                     = 0x2c
-	IFT_FRF16MFRBUNDLE                = 0xa3
-	IFT_FRFORWARD                     = 0x9e
-	IFT_G703AT2MB                     = 0x43
-	IFT_G703AT64K                     = 0x42
-	IFT_GIF                           = 0xf0
-	IFT_GIGABITETHERNET               = 0x75
-	IFT_GR303IDT                      = 0xb2
-	IFT_GR303RDT                      = 0xb1
-	IFT_H323GATEKEEPER                = 0xa4
-	IFT_H323PROXY                     = 0xa5
-	IFT_HDH1822                       = 0x3
-	IFT_HDLC                          = 0x76
-	IFT_HDSL2                         = 0xa8
-	IFT_HIPERLAN2                     = 0xb7
-	IFT_HIPPI                         = 0x2f
-	IFT_HIPPIINTERFACE                = 0x39
-	IFT_HOSTPAD                       = 0x5a
-	IFT_HSSI                          = 0x2e
-	IFT_HY                            = 0xe
-	IFT_IBM370PARCHAN                 = 0x48
-	IFT_IDSL                          = 0x9a
-	IFT_IEEE80211                     = 0x47
-	IFT_IEEE80212                     = 0x37
-	IFT_IEEE8023ADLAG                 = 0xa1
-	IFT_IFGSN                         = 0x91
-	IFT_IMT                           = 0xbe
-	IFT_INTERLEAVE                    = 0x7c
-	IFT_IP                            = 0x7e
-	IFT_IPFORWARD                     = 0x8e
-	IFT_IPOVERATM                     = 0x72
-	IFT_IPOVERCDLC                    = 0x6d
-	IFT_IPOVERCLAW                    = 0x6e
-	IFT_IPSWITCH                      = 0x4e
-	IFT_IPXIP                         = 0xf9
-	IFT_ISDN                          = 0x3f
-	IFT_ISDNBASIC                     = 0x14
-	IFT_ISDNPRIMARY                   = 0x15
-	IFT_ISDNS                         = 0x4b
-	IFT_ISDNU                         = 0x4c
-	IFT_ISO88022LLC                   = 0x29
-	IFT_ISO88023                      = 0x7
-	IFT_ISO88024                      = 0x8
-	IFT_ISO88025                      = 0x9
-	IFT_ISO88025CRFPINT               = 0x62
-	IFT_ISO88025DTR                   = 0x56
-	IFT_ISO88025FIBER                 = 0x73
-	IFT_ISO88026                      = 0xa
-	IFT_ISUP                          = 0xb3
-	IFT_L3IPXVLAN                     = 0x89
-	IFT_LAPB                          = 0x10
-	IFT_LAPD                          = 0x4d
-	IFT_LAPF                          = 0x77
-	IFT_LOCALTALK                     = 0x2a
-	IFT_LOOP                          = 0x18
-	IFT_MEDIAMAILOVERIP               = 0x8b
-	IFT_MFSIGLINK                     = 0xa7
-	IFT_MIOX25                        = 0x26
-	IFT_MODEM                         = 0x30
-	IFT_MPC                           = 0x71
-	IFT_MPLS                          = 0xa6
-	IFT_MPLSTUNNEL                    = 0x96
-	IFT_MSDSL                         = 0x8f
-	IFT_MVL                           = 0xbf
-	IFT_MYRINET                       = 0x63
-	IFT_NFAS                          = 0xaf
-	IFT_NSIP                          = 0x1b
-	IFT_OPTICALCHANNEL                = 0xc3
-	IFT_OPTICALTRANSPORT              = 0xc4
-	IFT_OTHER                         = 0x1
-	IFT_P10                           = 0xc
-	IFT_P80                           = 0xd
-	IFT_PARA                          = 0x22
-	IFT_PFLOG                         = 0xf6
-	IFT_PFSYNC                        = 0xf7
-	IFT_PLC                           = 0xae
-	IFT_POS                           = 0xab
-	IFT_PPPMULTILINKBUNDLE            = 0x6c
-	IFT_PROPBWAP2MP                   = 0xb8
-	IFT_PROPCNLS                      = 0x59
-	IFT_PROPDOCSWIRELESSDOWNSTREAM    = 0xb5
-	IFT_PROPDOCSWIRELESSMACLAYER      = 0xb4
-	IFT_PROPDOCSWIRELESSUPSTREAM      = 0xb6
-	IFT_PROPMUX                       = 0x36
-	IFT_PROPWIRELESSP2P               = 0x9d
-	IFT_PTPSERIAL                     = 0x16
-	IFT_PVC                           = 0xf1
-	IFT_QLLC                          = 0x44
-	IFT_RADIOMAC                      = 0xbc
-	IFT_RADSL                         = 0x5f
-	IFT_REACHDSL                      = 0xc0
-	IFT_RFC1483                       = 0x9f
-	IFT_RS232                         = 0x21
-	IFT_RSRB                          = 0x4f
-	IFT_SDLC                          = 0x11
-	IFT_SDSL                          = 0x60
-	IFT_SHDSL                         = 0xa9
-	IFT_SIP                           = 0x1f
-	IFT_SLIP                          = 0x1c
-	IFT_SMDSDXI                       = 0x2b
-	IFT_SMDSICIP                      = 0x34
-	IFT_SONET                         = 0x27
-	IFT_SONETOVERHEADCHANNEL          = 0xb9
-	IFT_SONETPATH                     = 0x32
-	IFT_SONETVT                       = 0x33
-	IFT_SRP                           = 0x97
-	IFT_SS7SIGLINK                    = 0x9c
-	IFT_STACKTOSTACK                  = 0x6f
-	IFT_STARLAN                       = 0xb
-	IFT_STF                           = 0xd7
-	IFT_T1                            = 0x12
-	IFT_TDLC                          = 0x74
-	IFT_TERMPAD                       = 0x5b
-	IFT_TR008                         = 0xb0
-	IFT_TRANSPHDLC                    = 0x7b
-	IFT_TUNNEL                        = 0x83
-	IFT_ULTRA                         = 0x1d
-	IFT_USB                           = 0xa0
-	IFT_V11                           = 0x40
-	IFT_V35                           = 0x2d
-	IFT_V36                           = 0x41
-	IFT_V37                           = 0x78
-	IFT_VDSL                          = 0x61
-	IFT_VIRTUALIPADDRESS              = 0x70
-	IFT_VOICEEM                       = 0x64
-	IFT_VOICEENCAP                    = 0x67
-	IFT_VOICEFXO                      = 0x65
-	IFT_VOICEFXS                      = 0x66
-	IFT_VOICEOVERATM                  = 0x98
-	IFT_VOICEOVERFRAMERELAY           = 0x99
-	IFT_VOICEOVERIP                   = 0x68
-	IFT_X213                          = 0x5d
-	IFT_X25                           = 0x5
-	IFT_X25DDN                        = 0x4
-	IFT_X25HUNTGROUP                  = 0x7a
-	IFT_X25MLP                        = 0x79
-	IFT_X25PLE                        = 0x28
-	IFT_XETHER                        = 0x1a
-	IPPROTO_MAXID                     = 0x34
-	IPV6_FAITH                        = 0x1d
-	IPV6_MIN_MEMBERSHIPS              = 0x1f
-	IP_FAITH                          = 0x16
-	IP_MAX_SOURCE_FILTER              = 0x400
-	IP_MIN_MEMBERSHIPS                = 0x1f
-	MAP_NORESERVE                     = 0x40
-	MAP_RENAME                        = 0x20
-	NET_RT_MAXID                      = 0x6
-	RTF_PRCLONING                     = 0x10000
-	RTM_OLDADD                        = 0x9
-	RTM_OLDDEL                        = 0xa
-	RT_CACHING_CONTEXT                = 0x1
-	RT_NORTREF                        = 0x2
-	SIOCADDRT                         = 0x8040720a
-	SIOCALIFADDR                      = 0x8118691b
-	SIOCDELRT                         = 0x8040720b
-	SIOCDLIFADDR                      = 0x8118691d
-	SIOCGLIFADDR                      = 0xc118691c
-	SIOCGLIFPHYADDR                   = 0xc118694b
-	SIOCSLIFPHYADDR                   = 0x8118694a
-)

vendor/golang.org/x/sys/unix/errors_freebsd_arm.go

@@ -1,226 +0,0 @@
-// Copyright 2017 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-package unix
-
-const (
-	IFT_1822                          = 0x2
-	IFT_A12MPPSWITCH                  = 0x82
-	IFT_AAL2                          = 0xbb
-	IFT_AAL5                          = 0x31
-	IFT_ADSL                          = 0x5e
-	IFT_AFLANE8023                    = 0x3b
-	IFT_AFLANE8025                    = 0x3c
-	IFT_ARAP                          = 0x58
-	IFT_ARCNET                        = 0x23
-	IFT_ARCNETPLUS                    = 0x24
-	IFT_ASYNC                         = 0x54
-	IFT_ATM                           = 0x25
-	IFT_ATMDXI                        = 0x69
-	IFT_ATMFUNI                       = 0x6a
-	IFT_ATMIMA                        = 0x6b
-	IFT_ATMLOGICAL                    = 0x50
-	IFT_ATMRADIO                      = 0xbd
-	IFT_ATMSUBINTERFACE               = 0x86
-	IFT_ATMVCIENDPT                   = 0xc2
-	IFT_ATMVIRTUAL                    = 0x95
-	IFT_BGPPOLICYACCOUNTING           = 0xa2
-	IFT_BSC                           = 0x53
-	IFT_CCTEMUL                       = 0x3d
-	IFT_CEPT                          = 0x13
-	IFT_CES                           = 0x85
-	IFT_CHANNEL                       = 0x46
-	IFT_CNR                           = 0x55
-	IFT_COFFEE                        = 0x84
-	IFT_COMPOSITELINK                 = 0x9b
-	IFT_DCN                           = 0x8d
-	IFT_DIGITALPOWERLINE              = 0x8a
-	IFT_DIGITALWRAPPEROVERHEADCHANNEL = 0xba
-	IFT_DLSW                          = 0x4a
-	IFT_DOCSCABLEDOWNSTREAM           = 0x80
-	IFT_DOCSCABLEMACLAYER             = 0x7f
-	IFT_DOCSCABLEUPSTREAM             = 0x81
-	IFT_DS0                           = 0x51
-	IFT_DS0BUNDLE                     = 0x52
-	IFT_DS1FDL                        = 0xaa
-	IFT_DS3                           = 0x1e
-	IFT_DTM                           = 0x8c
-	IFT_DVBASILN                      = 0xac
-	IFT_DVBASIOUT                     = 0xad
-	IFT_DVBRCCDOWNSTREAM              = 0x93
-	IFT_DVBRCCMACLAYER                = 0x92
-	IFT_DVBRCCUPSTREAM                = 0x94
-	IFT_ENC                           = 0xf4
-	IFT_EON                           = 0x19
-	IFT_EPLRS                         = 0x57
-	IFT_ESCON                         = 0x49
-	IFT_ETHER                         = 0x6
-	IFT_FAST                          = 0x7d
-	IFT_FASTETHER                     = 0x3e
-	IFT_FASTETHERFX                   = 0x45
-	IFT_FDDI                          = 0xf
-	IFT_FIBRECHANNEL                  = 0x38
-	IFT_FRAMERELAYINTERCONNECT        = 0x3a
-	IFT_FRAMERELAYMPI                 = 0x5c
-	IFT_FRDLCIENDPT                   = 0xc1
-	IFT_FRELAY                        = 0x20
-	IFT_FRELAYDCE                     = 0x2c
-	IFT_FRF16MFRBUNDLE                = 0xa3
-	IFT_FRFORWARD                     = 0x9e
-	IFT_G703AT2MB                     = 0x43
-	IFT_G703AT64K                     = 0x42
-	IFT_GIF                           = 0xf0
-	IFT_GIGABITETHERNET               = 0x75
-	IFT_GR303IDT                      = 0xb2
-	IFT_GR303RDT                      = 0xb1
-	IFT_H323GATEKEEPER                = 0xa4
-	IFT_H323PROXY                     = 0xa5
-	IFT_HDH1822                       = 0x3
-	IFT_HDLC                          = 0x76
-	IFT_HDSL2                         = 0xa8
-	IFT_HIPERLAN2                     = 0xb7
-	IFT_HIPPI                         = 0x2f
-	IFT_HIPPIINTERFACE                = 0x39
-	IFT_HOSTPAD                       = 0x5a
-	IFT_HSSI                          = 0x2e
-	IFT_HY                            = 0xe
-	IFT_IBM370PARCHAN                 = 0x48
-	IFT_IDSL                          = 0x9a
-	IFT_IEEE80211                     = 0x47
-	IFT_IEEE80212                     = 0x37
-	IFT_IEEE8023ADLAG                 = 0xa1
-	IFT_IFGSN                         = 0x91
-	IFT_IMT                           = 0xbe
-	IFT_INTERLEAVE                    = 0x7c
-	IFT_IP                            = 0x7e
-	IFT_IPFORWARD                     = 0x8e
-	IFT_IPOVERATM                     = 0x72
-	IFT_IPOVERCDLC                    = 0x6d
-	IFT_IPOVERCLAW                    = 0x6e
-	IFT_IPSWITCH                      = 0x4e
-	IFT_ISDN                          = 0x3f
-	IFT_ISDNBASIC                     = 0x14
-	IFT_ISDNPRIMARY                   = 0x15
-	IFT_ISDNS                         = 0x4b
-	IFT_ISDNU                         = 0x4c
-	IFT_ISO88022LLC                   = 0x29
-	IFT_ISO88023                      = 0x7
-	IFT_ISO88024                      = 0x8
-	IFT_ISO88025                      = 0x9
-	IFT_ISO88025CRFPINT               = 0x62
-	IFT_ISO88025DTR                   = 0x56
-	IFT_ISO88025FIBER                 = 0x73
-	IFT_ISO88026                      = 0xa
-	IFT_ISUP                          = 0xb3
-	IFT_L3IPXVLAN                     = 0x89
-	IFT_LAPB                          = 0x10
-	IFT_LAPD                          = 0x4d
-	IFT_LAPF                          = 0x77
-	IFT_LOCALTALK                     = 0x2a
-	IFT_LOOP                          = 0x18
-	IFT_MEDIAMAILOVERIP               = 0x8b
-	IFT_MFSIGLINK                     = 0xa7
-	IFT_MIOX25                        = 0x26
-	IFT_MODEM                         = 0x30
-	IFT_MPC                           = 0x71
-	IFT_MPLS                          = 0xa6
-	IFT_MPLSTUNNEL                    = 0x96
-	IFT_MSDSL                         = 0x8f
-	IFT_MVL                           = 0xbf
-	IFT_MYRINET                       = 0x63
-	IFT_NFAS                          = 0xaf
-	IFT_NSIP                          = 0x1b
-	IFT_OPTICALCHANNEL                = 0xc3
-	IFT_OPTICALTRANSPORT              = 0xc4
-	IFT_OTHER                         = 0x1
-	IFT_P10                           = 0xc
-	IFT_P80                           = 0xd
-	IFT_PARA                          = 0x22
-	IFT_PFLOG                         = 0xf6
-	IFT_PFSYNC                        = 0xf7
-	IFT_PLC                           = 0xae
-	IFT_POS                           = 0xab
-	IFT_PPPMULTILINKBUNDLE            = 0x6c
-	IFT_PROPBWAP2MP                   = 0xb8
-	IFT_PROPCNLS                      = 0x59
-	IFT_PROPDOCSWIRELESSDOWNSTREAM    = 0xb5
-	IFT_PROPDOCSWIRELESSMACLAYER      = 0xb4
-	IFT_PROPDOCSWIRELESSUPSTREAM      = 0xb6
-	IFT_PROPMUX                       = 0x36
-	IFT_PROPWIRELESSP2P               = 0x9d
-	IFT_PTPSERIAL                     = 0x16
-	IFT_PVC                           = 0xf1
-	IFT_QLLC                          = 0x44
-	IFT_RADIOMAC                      = 0xbc
-	IFT_RADSL                         = 0x5f
-	IFT_REACHDSL                      = 0xc0
-	IFT_RFC1483                       = 0x9f
-	IFT_RS232                         = 0x21
-	IFT_RSRB                          = 0x4f
-	IFT_SDLC                          = 0x11
-	IFT_SDSL                          = 0x60
-	IFT_SHDSL                         = 0xa9
-	IFT_SIP                           = 0x1f
-	IFT_SLIP                          = 0x1c
-	IFT_SMDSDXI                       = 0x2b
-	IFT_SMDSICIP                      = 0x34
-	IFT_SONET                         = 0x27
-	IFT_SONETOVERHEADCHANNEL          = 0xb9
-	IFT_SONETPATH                     = 0x32
-	IFT_SONETVT                       = 0x33
-	IFT_SRP                           = 0x97
-	IFT_SS7SIGLINK                    = 0x9c
-	IFT_STACKTOSTACK                  = 0x6f
-	IFT_STARLAN                       = 0xb
-	IFT_STF                           = 0xd7
-	IFT_T1                            = 0x12
-	IFT_TDLC                          = 0x74
-	IFT_TERMPAD                       = 0x5b
-	IFT_TR008                         = 0xb0
-	IFT_TRANSPHDLC                    = 0x7b
-	IFT_TUNNEL                        = 0x83
-	IFT_ULTRA                         = 0x1d
-	IFT_USB                           = 0xa0
-	IFT_V11                           = 0x40
-	IFT_V35                           = 0x2d
-	IFT_V36                           = 0x41
-	IFT_V37                           = 0x78
-	IFT_VDSL                          = 0x61
-	IFT_VIRTUALIPADDRESS              = 0x70
-	IFT_VOICEEM                       = 0x64
-	IFT_VOICEENCAP                    = 0x67
-	IFT_VOICEFXO                      = 0x65
-	IFT_VOICEFXS                      = 0x66
-	IFT_VOICEOVERATM                  = 0x98
-	IFT_VOICEOVERFRAMERELAY           = 0x99
-	IFT_VOICEOVERIP                   = 0x68
-	IFT_X213                          = 0x5d
-	IFT_X25                           = 0x5
-	IFT_X25DDN                        = 0x4
-	IFT_X25HUNTGROUP                  = 0x7a
-	IFT_X25MLP                        = 0x79
-	IFT_X25PLE                        = 0x28
-	IFT_XETHER                        = 0x1a
-
-	// missing constants on FreeBSD-11.1-RELEASE, copied from old values in ztypes_freebsd_arm.go
-	IFF_SMART       = 0x20
-	IFT_FAITH       = 0xf2
-	IFT_IPXIP       = 0xf9
-	IPPROTO_MAXID   = 0x34
-	IPV6_FAITH      = 0x1d
-	IP_FAITH        = 0x16
-	MAP_NORESERVE   = 0x40
-	MAP_RENAME      = 0x20
-	NET_RT_MAXID    = 0x6
-	RTF_PRCLONING   = 0x10000
-	RTM_OLDADD      = 0x9
-	RTM_OLDDEL      = 0xa
-	SIOCADDRT       = 0x8030720a
-	SIOCALIFADDR    = 0x8118691b
-	SIOCDELRT       = 0x8030720b
-	SIOCDLIFADDR    = 0x8118691d
-	SIOCGLIFADDR    = 0xc118691c
-	SIOCGLIFPHYADDR = 0xc118694b
-	SIOCSLIFPHYADDR = 0x8118694a
-)

vendor/golang.org/x/sys/unix/errors_freebsd_arm64.go

@@ -1,17 +0,0 @@
-// Copyright 2020 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-// Constants that were deprecated or moved to enums in the FreeBSD headers. Keep
-// them here for backwards compatibility.
-
-package unix
-
-const (
-	DLT_HHDLC            = 0x79
-	IPV6_MIN_MEMBERSHIPS = 0x1f
-	IP_MAX_SOURCE_FILTER = 0x400
-	IP_MIN_MEMBERSHIPS   = 0x1f
-	RT_CACHING_CONTEXT   = 0x1
-	RT_NORTREF           = 0x2
-)

vendor/golang.org/x/sys/unix/ifreq_linux.go

@@ -8,7 +8,6 @@
 package unix
 
 import (
-	"bytes"
 	"unsafe"
 )
 
@@ -45,13 +44,7 @@ func NewIfreq(name string) (*Ifreq, error) {
 
 // Name returns the interface name associated with the Ifreq.
 func (ifr *Ifreq) Name() string {
-	// BytePtrToString requires a NULL terminator or the program may crash. If
+	return ByteSliceToString(ifr.raw.Ifrn[:])
-	// one is not present, just return the empty string.
-	if !bytes.Contains(ifr.raw.Ifrn[:], []byte{0x00}) {
-		return ""
-	}
-
-	return BytePtrToString(&ifr.raw.Ifrn[0])
 }
 
 // According to netdevice(7), only AF_INET addresses are returned for numerous

vendor/golang.org/x/sys/unix/ioctl_linux.go

@@ -4,9 +4,7 @@
 
 package unix
 
-import (
+import "unsafe"
-	"unsafe"
-)
 
 // IoctlRetInt performs an ioctl operation specified by req on a device
 // associated with opened file descriptor fd, and returns a non-negative
@@ -217,3 +215,19 @@ func IoctlKCMAttach(fd int, info KCMAttach) error {
 func IoctlKCMUnattach(fd int, info KCMUnattach) error {
 	return ioctlPtr(fd, SIOCKCMUNATTACH, unsafe.Pointer(&info))
 }
+
+// IoctlLoopGetStatus64 gets the status of the loop device associated with the
+// file descriptor fd using the LOOP_GET_STATUS64 operation.
+func IoctlLoopGetStatus64(fd int) (*LoopInfo64, error) {
+	var value LoopInfo64
+	if err := ioctlPtr(fd, LOOP_GET_STATUS64, unsafe.Pointer(&value)); err != nil {
+		return nil, err
+	}
+	return &value, nil
+}
+
+// IoctlLoopSetStatus64 sets the status of the loop device associated with the
+// file descriptor fd using the LOOP_SET_STATUS64 operation.
+func IoctlLoopSetStatus64(fd int, value *LoopInfo64) error {
+	return ioctlPtr(fd, LOOP_SET_STATUS64, unsafe.Pointer(value))
+}

vendor/golang.org/x/sys/unix/mkall.sh

@@ -73,12 +73,12 @@ aix_ppc64)
 darwin_amd64)
 	mkerrors="$mkerrors -m64"
 	mktypes="GOARCH=$GOARCH go tool cgo -godefs"
-	mkasm="go run mkasm_darwin.go"
+	mkasm="go run mkasm.go"
 	;;
 darwin_arm64)
 	mkerrors="$mkerrors -m64"
 	mktypes="GOARCH=$GOARCH go tool cgo -godefs"
-	mkasm="go run mkasm_darwin.go"
+	mkasm="go run mkasm.go"
 	;;
 dragonfly_amd64)
 	mkerrors="$mkerrors -m64"
@@ -89,25 +89,30 @@ dragonfly_amd64)
 freebsd_386)
 	mkerrors="$mkerrors -m32"
 	mksyscall="go run mksyscall.go -l32"
-	mksysnum="go run mksysnum.go 'https://svn.freebsd.org/base/stable/11/sys/kern/syscalls.master'"
+	mksysnum="go run mksysnum.go 'https://cgit.freebsd.org/src/plain/sys/kern/syscalls.master?h=stable/12'"
 	mktypes="GOARCH=$GOARCH go tool cgo -godefs"
 	;;
 freebsd_amd64)
 	mkerrors="$mkerrors -m64"
-	mksysnum="go run mksysnum.go 'https://svn.freebsd.org/base/stable/11/sys/kern/syscalls.master'"
+	mksysnum="go run mksysnum.go 'https://cgit.freebsd.org/src/plain/sys/kern/syscalls.master?h=stable/12'"
 	mktypes="GOARCH=$GOARCH go tool cgo -godefs"
 	;;
 freebsd_arm)
 	mkerrors="$mkerrors"
 	mksyscall="go run mksyscall.go -l32 -arm"
-	mksysnum="go run mksysnum.go 'https://svn.freebsd.org/base/stable/11/sys/kern/syscalls.master'"
+	mksysnum="go run mksysnum.go 'https://cgit.freebsd.org/src/plain/sys/kern/syscalls.master?h=stable/12'"
 	# Let the type of C char be signed for making the bare syscall
 	# API consistent across platforms.
 	mktypes="GOARCH=$GOARCH go tool cgo -godefs -- -fsigned-char"
 	;;
 freebsd_arm64)
 	mkerrors="$mkerrors -m64"
-	mksysnum="go run mksysnum.go 'https://svn.freebsd.org/base/stable/11/sys/kern/syscalls.master'"
+	mksysnum="go run mksysnum.go 'https://cgit.freebsd.org/src/plain/sys/kern/syscalls.master?h=stable/12'"
+	mktypes="GOARCH=$GOARCH go tool cgo -godefs -- -fsigned-char"
+	;;
+freebsd_riscv64)
+	mkerrors="$mkerrors -m64"
+	mksysnum="go run mksysnum.go 'https://cgit.freebsd.org/src/plain/sys/kern/syscalls.master?h=stable/12'"
 	mktypes="GOARCH=$GOARCH go tool cgo -godefs -- -fsigned-char"
 	;;
 netbsd_386)
@@ -137,33 +142,33 @@ netbsd_arm64)
 	mktypes="GOARCH=$GOARCH go tool cgo -godefs"
 	;;
 openbsd_386)
+	mkasm="go run mkasm.go"
 	mkerrors="$mkerrors -m32"
-	mksyscall="go run mksyscall.go -l32 -openbsd"
+	mksyscall="go run mksyscall.go -l32 -openbsd -libc"
 	mksysctl="go run mksysctl_openbsd.go"
-	mksysnum="go run mksysnum.go 'https://cvsweb.openbsd.org/cgi-bin/cvsweb/~checkout~/src/sys/kern/syscalls.master'"
 	mktypes="GOARCH=$GOARCH go tool cgo -godefs"
 	;;
 openbsd_amd64)
+	mkasm="go run mkasm.go"
 	mkerrors="$mkerrors -m64"
-	mksyscall="go run mksyscall.go -openbsd"
+	mksyscall="go run mksyscall.go -openbsd -libc"
 	mksysctl="go run mksysctl_openbsd.go"
-	mksysnum="go run mksysnum.go 'https://cvsweb.openbsd.org/cgi-bin/cvsweb/~checkout~/src/sys/kern/syscalls.master'"
 	mktypes="GOARCH=$GOARCH go tool cgo -godefs"
 	;;
 openbsd_arm)
+	mkasm="go run mkasm.go"
 	mkerrors="$mkerrors"
-	mksyscall="go run mksyscall.go -l32 -openbsd -arm"
+	mksyscall="go run mksyscall.go -l32 -openbsd -arm -libc"
 	mksysctl="go run mksysctl_openbsd.go"
-	mksysnum="go run mksysnum.go 'https://cvsweb.openbsd.org/cgi-bin/cvsweb/~checkout~/src/sys/kern/syscalls.master'"
 	# Let the type of C char be signed for making the bare syscall
 	# API consistent across platforms.
 	mktypes="GOARCH=$GOARCH go tool cgo -godefs -- -fsigned-char"
 	;;
 openbsd_arm64)
+	mkasm="go run mkasm.go"
 	mkerrors="$mkerrors -m64"
-	mksyscall="go run mksyscall.go -openbsd"
+	mksyscall="go run mksyscall.go -openbsd -libc"
 	mksysctl="go run mksysctl_openbsd.go"
-	mksysnum="go run mksysnum.go 'https://cvsweb.openbsd.org/cgi-bin/cvsweb/~checkout~/src/sys/kern/syscalls.master'"
 	# Let the type of C char be signed for making the bare syscall
 	# API consistent across platforms.
 	mktypes="GOARCH=$GOARCH go tool cgo -godefs -- -fsigned-char"
@@ -227,5 +232,5 @@ esac
 	if [ -n "$mksysctl" ]; then echo "$mksysctl |gofmt >$zsysctl"; fi
 	if [ -n "$mksysnum" ]; then echo "$mksysnum |gofmt >zsysnum_$GOOSARCH.go"; fi
 	if [ -n "$mktypes" ]; then echo "$mktypes types_$GOOS.go | go run mkpost.go > ztypes_$GOOSARCH.go"; fi
-	if [ -n "$mkasm" ]; then echo "$mkasm $GOARCH"; fi
+	if [ -n "$mkasm" ]; then echo "$mkasm $GOOS $GOARCH"; fi
 ) | $run

vendor/golang.org/x/sys/unix/mkerrors.sh

@@ -128,6 +128,7 @@ includes_FreeBSD='
 #include <sys/mount.h>
 #include <sys/wait.h>
 #include <sys/ioctl.h>
+#include <sys/ptrace.h>
 #include <net/bpf.h>
 #include <net/if.h>
 #include <net/if_types.h>
@@ -202,6 +203,7 @@ struct ltchars {
 #include <sys/timerfd.h>
 #include <sys/uio.h>
 #include <sys/xattr.h>
+#include <linux/audit.h>
 #include <linux/bpf.h>
 #include <linux/can.h>
 #include <linux/can/error.h>
@@ -295,6 +297,10 @@ struct ltchars {
 #define SOL_NETLINK	270
 #endif
 
+#ifndef SOL_SMC
+#define SOL_SMC 286
+#endif
+
 #ifdef SOL_BLUETOOTH
 // SPARC includes this in /usr/include/sparc64-linux-gnu/bits/socket.h
 // but it is already in bluetooth_linux.go
@@ -529,7 +535,7 @@ ccflags="$@"
 		$2 ~ /^(MS|MNT|MOUNT|UMOUNT)_/ ||
 		$2 ~ /^NS_GET_/ ||
 		$2 ~ /^TUN(SET|GET|ATTACH|DETACH)/ ||
-		$2 ~ /^(O|F|[ES]?FD|NAME|S|PTRACE|PT|TFD)_/ ||
+		$2 ~ /^(O|F|[ES]?FD|NAME|S|PTRACE|PT|PIOD|TFD)_/ ||
 		$2 ~ /^KEXEC_/ ||
 		$2 ~ /^LINUX_REBOOT_CMD_/ ||
 		$2 ~ /^LINUX_REBOOT_MAGIC[12]$/ ||
@@ -553,6 +559,7 @@ ccflags="$@"
 		$2 ~ /^CLONE_[A-Z_]+/ ||
 		$2 !~ /^(BPF_TIMEVAL|BPF_FIB_LOOKUP_[A-Z]+)$/ &&
 		$2 ~ /^(BPF|DLT)_/ ||
+		$2 ~ /^AUDIT_/ ||
 		$2 ~ /^(CLOCK|TIMER)_/ ||
 		$2 ~ /^CAN_/ ||
 		$2 ~ /^CAP_/ ||
@@ -575,7 +582,6 @@ ccflags="$@"
 		$2 ~ /^SEEK_/ ||
 		$2 ~ /^SPLICE_/ ||
 		$2 ~ /^SYNC_FILE_RANGE_/ ||
-		$2 !~ /^AUDIT_RECORD_MAGIC/ &&
 		$2 !~ /IOC_MAGIC/ &&
 		$2 ~ /^[A-Z][A-Z0-9_]+_MAGIC2?$/ ||
 		$2 ~ /^(VM|VMADDR)_/ ||

vendor/golang.org/x/sys/unix/str.go

@@ -1,27 +0,0 @@
-// Copyright 2009 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-//go:build aix || darwin || dragonfly || freebsd || linux || netbsd || openbsd || solaris
-// +build aix darwin dragonfly freebsd linux netbsd openbsd solaris
-
-package unix
-
-func itoa(val int) string { // do it here rather than with fmt to avoid dependency
-	if val < 0 {
-		return "-" + uitoa(uint(-val))
-	}
-	return uitoa(uint(val))
-}
-
-func uitoa(val uint) string {
-	var buf [32]byte // big enough for int64
-	i := len(buf) - 1
-	for val >= 10 {
-		buf[i] = byte(val%10 + '0')
-		i--
-		val /= 10
-	}
-	buf[i] = byte(val + '0')
-	return string(buf[i:])
-}

vendor/golang.org/x/sys/unix/syscall.go

@@ -29,8 +29,6 @@ import (
 	"bytes"
 	"strings"
 	"unsafe"
-
-	"golang.org/x/sys/internal/unsafeheader"
 )
 
 // ByteSliceFromString returns a NUL-terminated slice of bytes
@@ -82,12 +80,7 @@ func BytePtrToString(p *byte) string {
 		ptr = unsafe.Pointer(uintptr(ptr) + 1)
 	}
 
-	var s []byte
+	s := unsafe.Slice((*byte)(unsafe.Pointer(p)), n)
-	h := (*unsafeheader.Slice)(unsafe.Pointer(&s))
-	h.Data = unsafe.Pointer(p)
-	h.Len = n
-	h.Cap = n
-
 	return string(s)
 }
 

vendor/golang.org/x/sys/unix/syscall_aix.go

@@ -37,6 +37,7 @@ func Creat(path string, mode uint32) (fd int, err error) {
 }
 
 //sys	utimes(path string, times *[2]Timeval) (err error)
+
 func Utimes(path string, tv []Timeval) error {
 	if len(tv) != 2 {
 		return EINVAL
@@ -45,6 +46,7 @@ func Utimes(path string, tv []Timeval) error {
 }
 
 //sys	utimensat(dirfd int, path string, times *[2]Timespec, flag int) (err error)
+
 func UtimesNano(path string, ts []Timespec) error {
 	if len(ts) != 2 {
 		return EINVAL
@@ -215,14 +217,63 @@ func Accept(fd int) (nfd int, sa Sockaddr, err error) {
 	return
 }
 
-func recvmsgRaw(fd int, p, oob []byte, flags int, rsa *RawSockaddrAny) (n, oobn int, recvflags int, err error) {
+func recvmsgRaw(fd int, iov []Iovec, oob []byte, flags int, rsa *RawSockaddrAny) (n, oobn int, recvflags int, err error) {
-	// Recvmsg not implemented on AIX
+	var msg Msghdr
-	return -1, -1, -1, ENOSYS
+	msg.Name = (*byte)(unsafe.Pointer(rsa))
+	msg.Namelen = uint32(SizeofSockaddrAny)
+	var dummy byte
+	if len(oob) > 0 {
+		// receive at least one normal byte
+		if emptyIovecs(iov) {
+			var iova [1]Iovec
+			iova[0].Base = &dummy
+			iova[0].SetLen(1)
+			iov = iova[:]
+		}
+		msg.Control = (*byte)(unsafe.Pointer(&oob[0]))
+		msg.SetControllen(len(oob))
+	}
+	if len(iov) > 0 {
+		msg.Iov = &iov[0]
+		msg.SetIovlen(len(iov))
+	}
+	if n, err = recvmsg(fd, &msg, flags); n == -1 {
+		return
+	}
+	oobn = int(msg.Controllen)
+	recvflags = int(msg.Flags)
+	return
 }
 
-func sendmsgN(fd int, p, oob []byte, ptr unsafe.Pointer, salen _Socklen, flags int) (n int, err error) {
+func sendmsgN(fd int, iov []Iovec, oob []byte, ptr unsafe.Pointer, salen _Socklen, flags int) (n int, err error) {
-	// SendmsgN not implemented on AIX
+	var msg Msghdr
-	return -1, ENOSYS
+	msg.Name = (*byte)(unsafe.Pointer(ptr))
+	msg.Namelen = uint32(salen)
+	var dummy byte
+	var empty bool
+	if len(oob) > 0 {
+		// send at least one normal byte
+		empty = emptyIovecs(iov)
+		if empty {
+			var iova [1]Iovec
+			iova[0].Base = &dummy
+			iova[0].SetLen(1)
+			iov = iova[:]
+		}
+		msg.Control = (*byte)(unsafe.Pointer(&oob[0]))
+		msg.SetControllen(len(oob))
+	}
+	if len(iov) > 0 {
+		msg.Iov = &iov[0]
+		msg.SetIovlen(len(iov))
+	}
+	if n, err = sendmsg(fd, &msg, flags); err != nil {
+		return 0, err
+	}
+	if len(oob) > 0 && empty {
+		n = 0
+	}
+	return n, nil
 }
 
 func anyToSockaddr(fd int, rsa *RawSockaddrAny) (Sockaddr, error) {
@@ -300,11 +351,13 @@ func direntNamlen(buf []byte) (uint64, bool) {
 }
 
 //sys	getdirent(fd int, buf []byte) (n int, err error)
+
 func Getdents(fd int, buf []byte) (n int, err error) {
 	return getdirent(fd, buf)
 }
 
 //sys	wait4(pid Pid_t, status *_C_int, options int, rusage *Rusage) (wpid Pid_t, err error)
+
 func Wait4(pid int, wstatus *WaitStatus, options int, rusage *Rusage) (wpid int, err error) {
 	var status _C_int
 	var r Pid_t
@@ -372,6 +425,7 @@ func (w WaitStatus) TrapCause() int { return -1 }
 //sys	fcntl(fd int, cmd int, arg int) (val int, err error)
 
 //sys	fsyncRange(fd int, how int, start int64, length int64) (err error) = fsync_range
+
 func Fsync(fd int) error {
 	return fsyncRange(fd, O_SYNC, 0, 0)
 }
@@ -536,6 +590,7 @@ func Poll(fds []PollFd, timeout int) (n int, err error) {
 //sys	Getsystemcfg(label int) (n uint64)
 
 //sys	umount(target string) (err error)
+
 func Unmount(target string, flags int) (err error) {
 	if flags != 0 {
 		// AIX doesn't have any flags for umount.

vendor/golang.org/x/sys/unix/syscall_bsd.go

@@ -325,27 +325,26 @@ func GetsockoptString(fd, level, opt int) (string, error) {
 //sys	sendto(s int, buf []byte, flags int, to unsafe.Pointer, addrlen _Socklen) (err error)
 //sys	recvmsg(s int, msg *Msghdr, flags int) (n int, err error)
 
-func recvmsgRaw(fd int, p, oob []byte, flags int, rsa *RawSockaddrAny) (n, oobn int, recvflags int, err error) {
+func recvmsgRaw(fd int, iov []Iovec, oob []byte, flags int, rsa *RawSockaddrAny) (n, oobn int, recvflags int, err error) {
 	var msg Msghdr
 	msg.Name = (*byte)(unsafe.Pointer(rsa))
 	msg.Namelen = uint32(SizeofSockaddrAny)
-	var iov Iovec
-	if len(p) > 0 {
-		iov.Base = (*byte)(unsafe.Pointer(&p[0]))
-		iov.SetLen(len(p))
-	}
 	var dummy byte
 	if len(oob) > 0 {
 		// receive at least one normal byte
-		if len(p) == 0 {
+		if emptyIovecs(iov) {
-			iov.Base = &dummy
+			var iova [1]Iovec
-			iov.SetLen(1)
+			iova[0].Base = &dummy
+			iova[0].SetLen(1)
+			iov = iova[:]
 		}
 		msg.Control = (*byte)(unsafe.Pointer(&oob[0]))
 		msg.SetControllen(len(oob))
 	}
-	msg.Iov = &iov
+	if len(iov) > 0 {
-	msg.Iovlen = 1
+		msg.Iov = &iov[0]
+		msg.SetIovlen(len(iov))
+	}
 	if n, err = recvmsg(fd, &msg, flags); err != nil {
 		return
 	}
@@ -356,31 +355,32 @@ func recvmsgRaw(fd int, p, oob []byte, flags int, rsa *RawSockaddrAny) (n, oobn
 
 //sys	sendmsg(s int, msg *Msghdr, flags int) (n int, err error)
 
-func sendmsgN(fd int, p, oob []byte, ptr unsafe.Pointer, salen _Socklen, flags int) (n int, err error) {
+func sendmsgN(fd int, iov []Iovec, oob []byte, ptr unsafe.Pointer, salen _Socklen, flags int) (n int, err error) {
 	var msg Msghdr
 	msg.Name = (*byte)(unsafe.Pointer(ptr))
 	msg.Namelen = uint32(salen)
-	var iov Iovec
-	if len(p) > 0 {
-		iov.Base = (*byte)(unsafe.Pointer(&p[0]))
-		iov.SetLen(len(p))
-	}
 	var dummy byte
+	var empty bool
 	if len(oob) > 0 {
 		// send at least one normal byte
-		if len(p) == 0 {
+		empty = emptyIovecs(iov)
-			iov.Base = &dummy
+		if empty {
-			iov.SetLen(1)
+			var iova [1]Iovec
+			iova[0].Base = &dummy
+			iova[0].SetLen(1)
+			iov = iova[:]
 		}
 		msg.Control = (*byte)(unsafe.Pointer(&oob[0]))
 		msg.SetControllen(len(oob))
 	}
-	msg.Iov = &iov
+	if len(iov) > 0 {
-	msg.Iovlen = 1
+		msg.Iov = &iov[0]
+		msg.SetIovlen(len(iov))
+	}
 	if n, err = sendmsg(fd, &msg, flags); err != nil {
 		return 0, err
 	}
-	if len(oob) > 0 && len(p) == 0 {
+	if len(oob) > 0 && empty {
 		n = 0
 	}
 	return n, nil

vendor/golang.org/x/sys/unix/syscall_darwin.1_13.go

@@ -7,11 +7,7 @@
 
 package unix
 
-import (
+import "unsafe"
-	"unsafe"
-
-	"golang.org/x/sys/internal/unsafeheader"
-)
 
 //sys	closedir(dir uintptr) (err error)
 //sys	readdir_r(dir uintptr, entry *Dirent, result **Dirent) (res Errno)
@@ -86,11 +82,7 @@ func Getdirentries(fd int, buf []byte, basep *uintptr) (n int, err error) {
 		}
 
 		// Copy entry into return buffer.
-		var s []byte
+		s := unsafe.Slice((*byte)(unsafe.Pointer(&entry)), reclen)
-		hdr := (*unsafeheader.Slice)(unsafe.Pointer(&s))
-		hdr.Data = unsafe.Pointer(&entry)
-		hdr.Cap = reclen
-		hdr.Len = reclen
 		copy(buf, s)
 
 		buf = buf[reclen:]

vendor/golang.org/x/sys/unix/syscall_darwin.go

@@ -393,6 +393,13 @@ func GetsockoptXucred(fd, level, opt int) (*Xucred, error) {
 	return x, err
 }
 
+func GetsockoptTCPConnectionInfo(fd, level, opt int) (*TCPConnectionInfo, error) {
+	var value TCPConnectionInfo
+	vallen := _Socklen(SizeofTCPConnectionInfo)
+	err := getsockopt(fd, level, opt, unsafe.Pointer(&value), &vallen)
+	return &value, err
+}
+
 func SysctlKinfoProc(name string, args ...int) (*KinfoProc, error) {
 	mib, err := sysctlmib(name, args...)
 	if err != nil {
@@ -504,6 +511,7 @@ func SysctlKinfoProcSlice(name string, args ...int) ([]KinfoProc, error) {
 //sys	Mkdirat(dirfd int, path string, mode uint32) (err error)
 //sys	Mkfifo(path string, mode uint32) (err error)
 //sys	Mknod(path string, mode uint32, dev int) (err error)
+//sys	Mount(fsType string, dir string, flags int, data unsafe.Pointer) (err error)
 //sys	Open(path string, mode int, perm uint32) (fd int, err error)
 //sys	Openat(dirfd int, path string, mode int, perm uint32) (fd int, err error)
 //sys	Pathconf(path string, name int) (val int, err error)
@@ -572,7 +580,6 @@ func SysctlKinfoProcSlice(name string, args ...int) ([]KinfoProc, error) {
 // Nfssvc
 // Getfh
 // Quotactl
-// Mount
 // Csops
 // Waitid
 // Add_profil

vendor/golang.org/x/sys/unix/syscall_dragonfly.go

@@ -125,11 +125,13 @@ func Pipe2(p []int, flags int) (err error) {
 }
 
 //sys	extpread(fd int, p []byte, flags int, offset int64) (n int, err error)
+
 func pread(fd int, p []byte, offset int64) (n int, err error) {
 	return extpread(fd, p, 0, offset)
 }
 
 //sys	extpwrite(fd int, p []byte, flags int, offset int64) (n int, err error)
+
 func pwrite(fd int, p []byte, offset int64) (n int, err error) {
 	return extpwrite(fd, p, 0, offset)
 }

vendor/golang.org/x/sys/unix/syscall_freebsd.go

@@ -17,25 +17,12 @@ import (
 	"unsafe"
 )
 
-const (
-	SYS_FSTAT_FREEBSD12         = 551 // { int fstat(int fd, _Out_ struct stat *sb); }
-	SYS_FSTATAT_FREEBSD12       = 552 // { int fstatat(int fd, _In_z_ char *path, \
-	SYS_GETDIRENTRIES_FREEBSD12 = 554 // { ssize_t getdirentries(int fd, \
-	SYS_STATFS_FREEBSD12        = 555 // { int statfs(_In_z_ char *path, \
-	SYS_FSTATFS_FREEBSD12       = 556 // { int fstatfs(int fd, \
-	SYS_GETFSSTAT_FREEBSD12     = 557 // { int getfsstat( \
-	SYS_MKNODAT_FREEBSD12       = 559 // { int mknodat(int fd, _In_z_ char *path, \
-)
-
 // See https://www.freebsd.org/doc/en_US.ISO8859-1/books/porters-handbook/versions.html.
 var (
 	osreldateOnce sync.Once
 	osreldate     uint32
 )
 
-// INO64_FIRST from /usr/src/lib/libc/sys/compat-ino64.h
-const _ino64First = 1200031
-
 func supportsABI(ver uint32) bool {
 	osreldateOnce.Do(func() { osreldate, _ = SysctlUint32("kern.osreldate") })
 	return osreldate >= ver
@@ -159,38 +146,18 @@ func Accept4(fd, flags int) (nfd int, sa Sockaddr, err error) {
 
 func Getfsstat(buf []Statfs_t, flags int) (n int, err error) {
 	var (
-		_p0          unsafe.Pointer
+		_p0     unsafe.Pointer
-		bufsize      uintptr
+		bufsize uintptr
-		oldBuf       []statfs_freebsd11_t
-		needsConvert bool
 	)
-
 	if len(buf) > 0 {
-		if supportsABI(_ino64First) {
+		_p0 = unsafe.Pointer(&buf[0])
-			_p0 = unsafe.Pointer(&buf[0])
+		bufsize = unsafe.Sizeof(Statfs_t{}) * uintptr(len(buf))
-			bufsize = unsafe.Sizeof(Statfs_t{}) * uintptr(len(buf))
-		} else {
-			n := len(buf)
-			oldBuf = make([]statfs_freebsd11_t, n)
-			_p0 = unsafe.Pointer(&oldBuf[0])
-			bufsize = unsafe.Sizeof(statfs_freebsd11_t{}) * uintptr(n)
-			needsConvert = true
-		}
 	}
-	var sysno uintptr = SYS_GETFSSTAT
+	r0, _, e1 := Syscall(SYS_GETFSSTAT, uintptr(_p0), bufsize, uintptr(flags))
-	if supportsABI(_ino64First) {
-		sysno = SYS_GETFSSTAT_FREEBSD12
-	}
-	r0, _, e1 := Syscall(sysno, uintptr(_p0), bufsize, uintptr(flags))
 	n = int(r0)
 	if e1 != 0 {
 		err = e1
 	}
-	if e1 == 0 && needsConvert {
-		for i := range oldBuf {
-			buf[i].convertFrom(&oldBuf[i])
-		}
-	}
 	return
 }
 
@@ -245,87 +212,11 @@ func Uname(uname *Utsname) error {
 }
 
 func Stat(path string, st *Stat_t) (err error) {
-	var oldStat stat_freebsd11_t
+	return Fstatat(AT_FDCWD, path, st, 0)
-	if supportsABI(_ino64First) {
-		return fstatat_freebsd12(AT_FDCWD, path, st, 0)
-	}
-	err = stat(path, &oldStat)
-	if err != nil {
-		return err
-	}
-
-	st.convertFrom(&oldStat)
-	return nil
 }
 
 func Lstat(path string, st *Stat_t) (err error) {
-	var oldStat stat_freebsd11_t
+	return Fstatat(AT_FDCWD, path, st, AT_SYMLINK_NOFOLLOW)
-	if supportsABI(_ino64First) {
-		return fstatat_freebsd12(AT_FDCWD, path, st, AT_SYMLINK_NOFOLLOW)
-	}
-	err = lstat(path, &oldStat)
-	if err != nil {
-		return err
-	}
-
-	st.convertFrom(&oldStat)
-	return nil
-}
-
-func Fstat(fd int, st *Stat_t) (err error) {
-	var oldStat stat_freebsd11_t
-	if supportsABI(_ino64First) {
-		return fstat_freebsd12(fd, st)
-	}
-	err = fstat(fd, &oldStat)
-	if err != nil {
-		return err
-	}
-
-	st.convertFrom(&oldStat)
-	return nil
-}
-
-func Fstatat(fd int, path string, st *Stat_t, flags int) (err error) {
-	var oldStat stat_freebsd11_t
-	if supportsABI(_ino64First) {
-		return fstatat_freebsd12(fd, path, st, flags)
-	}
-	err = fstatat(fd, path, &oldStat, flags)
-	if err != nil {
-		return err
-	}
-
-	st.convertFrom(&oldStat)
-	return nil
-}
-
-func Statfs(path string, st *Statfs_t) (err error) {
-	var oldStatfs statfs_freebsd11_t
-	if supportsABI(_ino64First) {
-		return statfs_freebsd12(path, st)
-	}
-	err = statfs(path, &oldStatfs)
-	if err != nil {
-		return err
-	}
-
-	st.convertFrom(&oldStatfs)
-	return nil
-}
-
-func Fstatfs(fd int, st *Statfs_t) (err error) {
-	var oldStatfs statfs_freebsd11_t
-	if supportsABI(_ino64First) {
-		return fstatfs_freebsd12(fd, st)
-	}
-	err = fstatfs(fd, &oldStatfs)
-	if err != nil {
-		return err
-	}
-
-	st.convertFrom(&oldStatfs)
-	return nil
 }
 
 func Getdents(fd int, buf []byte) (n int, err error) {
@@ -333,162 +224,25 @@ func Getdents(fd int, buf []byte) (n int, err error) {
 }
 
 func Getdirentries(fd int, buf []byte, basep *uintptr) (n int, err error) {
-	if supportsABI(_ino64First) {
+	if basep == nil || unsafe.Sizeof(*basep) == 8 {
-		if basep == nil || unsafe.Sizeof(*basep) == 8 {
+		return getdirentries(fd, buf, (*uint64)(unsafe.Pointer(basep)))
-			return getdirentries_freebsd12(fd, buf, (*uint64)(unsafe.Pointer(basep)))
-		}
-		// The freebsd12 syscall needs a 64-bit base. On 32-bit machines
-		// we can't just use the basep passed in. See #32498.
-		var base uint64 = uint64(*basep)
-		n, err = getdirentries_freebsd12(fd, buf, &base)
-		*basep = uintptr(base)
-		if base>>32 != 0 {
-			// We can't stuff the base back into a uintptr, so any
-			// future calls would be suspect. Generate an error.
-			// EIO is allowed by getdirentries.
-			err = EIO
-		}
-		return
 	}
-
+	// The syscall needs a 64-bit base. On 32-bit machines
-	// The old syscall entries are smaller than the new. Use 1/4 of the original
+	// we can't just use the basep passed in. See #32498.
-	// buffer size rounded up to DIRBLKSIZ (see /usr/src/lib/libc/sys/getdirentries.c).
+	var base uint64 = uint64(*basep)
-	oldBufLen := roundup(len(buf)/4, _dirblksiz)
+	n, err = getdirentries(fd, buf, &base)
-	oldBuf := make([]byte, oldBufLen)
+	*basep = uintptr(base)
-	n, err = getdirentries(fd, oldBuf, basep)
+	if base>>32 != 0 {
-	if err == nil && n > 0 {
+		// We can't stuff the base back into a uintptr, so any
-		n = convertFromDirents11(buf, oldBuf[:n])
+		// future calls would be suspect. Generate an error.
+		// EIO is allowed by getdirentries.
+		err = EIO
 	}
 	return
 }
 
 func Mknod(path string, mode uint32, dev uint64) (err error) {
-	var oldDev int
+	return Mknodat(AT_FDCWD, path, mode, dev)
-	if supportsABI(_ino64First) {
-		return mknodat_freebsd12(AT_FDCWD, path, mode, dev)
-	}
-	oldDev = int(dev)
-	return mknod(path, mode, oldDev)
-}
-
-func Mknodat(fd int, path string, mode uint32, dev uint64) (err error) {
-	var oldDev int
-	if supportsABI(_ino64First) {
-		return mknodat_freebsd12(fd, path, mode, dev)
-	}
-	oldDev = int(dev)
-	return mknodat(fd, path, mode, oldDev)
-}
-
-// round x to the nearest multiple of y, larger or equal to x.
-//
-// from /usr/include/sys/param.h Macros for counting and rounding.
-// #define roundup(x, y)   ((((x)+((y)-1))/(y))*(y))
-func roundup(x, y int) int {
-	return ((x + y - 1) / y) * y
-}
-
-func (s *Stat_t) convertFrom(old *stat_freebsd11_t) {
-	*s = Stat_t{
-		Dev:     uint64(old.Dev),
-		Ino:     uint64(old.Ino),
-		Nlink:   uint64(old.Nlink),
-		Mode:    old.Mode,
-		Uid:     old.Uid,
-		Gid:     old.Gid,
-		Rdev:    uint64(old.Rdev),
-		Atim:    old.Atim,
-		Mtim:    old.Mtim,
-		Ctim:    old.Ctim,
-		Btim:    old.Btim,
-		Size:    old.Size,
-		Blocks:  old.Blocks,
-		Blksize: old.Blksize,
-		Flags:   old.Flags,
-		Gen:     uint64(old.Gen),
-	}
-}
-
-func (s *Statfs_t) convertFrom(old *statfs_freebsd11_t) {
-	*s = Statfs_t{
-		Version:     _statfsVersion,
-		Type:        old.Type,
-		Flags:       old.Flags,
-		Bsize:       old.Bsize,
-		Iosize:      old.Iosize,
-		Blocks:      old.Blocks,
-		Bfree:       old.Bfree,
-		Bavail:      old.Bavail,
-		Files:       old.Files,
-		Ffree:       old.Ffree,
-		Syncwrites:  old.Syncwrites,
-		Asyncwrites: old.Asyncwrites,
-		Syncreads:   old.Syncreads,
-		Asyncreads:  old.Asyncreads,
-		// Spare
-		Namemax: old.Namemax,
-		Owner:   old.Owner,
-		Fsid:    old.Fsid,
-		// Charspare
-		// Fstypename
-		// Mntfromname
-		// Mntonname
-	}
-
-	sl := old.Fstypename[:]
-	n := clen(*(*[]byte)(unsafe.Pointer(&sl)))
-	copy(s.Fstypename[:], old.Fstypename[:n])
-
-	sl = old.Mntfromname[:]
-	n = clen(*(*[]byte)(unsafe.Pointer(&sl)))
-	copy(s.Mntfromname[:], old.Mntfromname[:n])
-
-	sl = old.Mntonname[:]
-	n = clen(*(*[]byte)(unsafe.Pointer(&sl)))
-	copy(s.Mntonname[:], old.Mntonname[:n])
-}
-
-func convertFromDirents11(buf []byte, old []byte) int {
-	const (
-		fixedSize    = int(unsafe.Offsetof(Dirent{}.Name))
-		oldFixedSize = int(unsafe.Offsetof(dirent_freebsd11{}.Name))
-	)
-
-	dstPos := 0
-	srcPos := 0
-	for dstPos+fixedSize < len(buf) && srcPos+oldFixedSize < len(old) {
-		var dstDirent Dirent
-		var srcDirent dirent_freebsd11
-
-		// If multiple direntries are written, sometimes when we reach the final one,
-		// we may have cap of old less than size of dirent_freebsd11.
-		copy((*[unsafe.Sizeof(srcDirent)]byte)(unsafe.Pointer(&srcDirent))[:], old[srcPos:])
-
-		reclen := roundup(fixedSize+int(srcDirent.Namlen)+1, 8)
-		if dstPos+reclen > len(buf) {
-			break
-		}
-
-		dstDirent.Fileno = uint64(srcDirent.Fileno)
-		dstDirent.Off = 0
-		dstDirent.Reclen = uint16(reclen)
-		dstDirent.Type = srcDirent.Type
-		dstDirent.Pad0 = 0
-		dstDirent.Namlen = uint16(srcDirent.Namlen)
-		dstDirent.Pad1 = 0
-
-		copy(dstDirent.Name[:], srcDirent.Name[:srcDirent.Namlen])
-		copy(buf[dstPos:], (*[unsafe.Sizeof(dstDirent)]byte)(unsafe.Pointer(&dstDirent))[:])
-		padding := buf[dstPos+fixedSize+int(dstDirent.Namlen) : dstPos+reclen]
-		for i := range padding {
-			padding[i] = 0
-		}
-
-		dstPos += int(dstDirent.Reclen)
-		srcPos += int(srcDirent.Reclen)
-	}
-
-	return dstPos
 }
 
 func Sendfile(outfd int, infd int, offset *int64, count int) (written int, err error) {
@@ -501,31 +255,31 @@ func Sendfile(outfd int, infd int, offset *int64, count int) (written int, err e
 //sys	ptrace(request int, pid int, addr uintptr, data int) (err error)
 
 func PtraceAttach(pid int) (err error) {
-	return ptrace(PTRACE_ATTACH, pid, 0, 0)
+	return ptrace(PT_ATTACH, pid, 0, 0)
 }
 
 func PtraceCont(pid int, signal int) (err error) {
-	return ptrace(PTRACE_CONT, pid, 1, signal)
+	return ptrace(PT_CONTINUE, pid, 1, signal)
 }
 
 func PtraceDetach(pid int) (err error) {
-	return ptrace(PTRACE_DETACH, pid, 1, 0)
+	return ptrace(PT_DETACH, pid, 1, 0)
 }
 
 func PtraceGetFpRegs(pid int, fpregsout *FpReg) (err error) {
-	return ptrace(PTRACE_GETFPREGS, pid, uintptr(unsafe.Pointer(fpregsout)), 0)
+	return ptrace(PT_GETFPREGS, pid, uintptr(unsafe.Pointer(fpregsout)), 0)
 }
 
 func PtraceGetRegs(pid int, regsout *Reg) (err error) {
-	return ptrace(PTRACE_GETREGS, pid, uintptr(unsafe.Pointer(regsout)), 0)
+	return ptrace(PT_GETREGS, pid, uintptr(unsafe.Pointer(regsout)), 0)
 }
 
 func PtraceLwpEvents(pid int, enable int) (err error) {
-	return ptrace(PTRACE_LWPEVENTS, pid, 0, enable)
+	return ptrace(PT_LWP_EVENTS, pid, 0, enable)
 }
 
 func PtraceLwpInfo(pid int, info uintptr) (err error) {
-	return ptrace(PTRACE_LWPINFO, pid, info, int(unsafe.Sizeof(PtraceLwpInfoStruct{})))
+	return ptrace(PT_LWPINFO, pid, info, int(unsafe.Sizeof(PtraceLwpInfoStruct{})))
 }
 
 func PtracePeekData(pid int, addr uintptr, out []byte) (count int, err error) {
@@ -545,11 +299,11 @@ func PtracePokeText(pid int, addr uintptr, data []byte) (count int, err error) {
 }
 
 func PtraceSetRegs(pid int, regs *Reg) (err error) {
-	return ptrace(PTRACE_SETREGS, pid, uintptr(unsafe.Pointer(regs)), 0)
+	return ptrace(PT_SETREGS, pid, uintptr(unsafe.Pointer(regs)), 0)
 }
 
 func PtraceSingleStep(pid int) (err error) {
-	return ptrace(PTRACE_SINGLESTEP, pid, 1, 0)
+	return ptrace(PT_STEP, pid, 1, 0)
 }
 
 /*
@@ -591,16 +345,12 @@ func PtraceSingleStep(pid int) (err error) {
 //sys	Fchownat(dirfd int, path string, uid int, gid int, flags int) (err error)
 //sys	Flock(fd int, how int) (err error)
 //sys	Fpathconf(fd int, name int) (val int, err error)
-//sys	fstat(fd int, stat *stat_freebsd11_t) (err error)
+//sys	Fstat(fd int, stat *Stat_t) (err error)
-//sys	fstat_freebsd12(fd int, stat *Stat_t) (err error)
+//sys	Fstatat(fd int, path string, stat *Stat_t, flags int) (err error)
-//sys	fstatat(fd int, path string, stat *stat_freebsd11_t, flags int) (err error)
+//sys	Fstatfs(fd int, stat *Statfs_t) (err error)
-//sys	fstatat_freebsd12(fd int, path string, stat *Stat_t, flags int) (err error)
-//sys	fstatfs(fd int, stat *statfs_freebsd11_t) (err error)
-//sys	fstatfs_freebsd12(fd int, stat *Statfs_t) (err error)
 //sys	Fsync(fd int) (err error)
 //sys	Ftruncate(fd int, length int64) (err error)
-//sys	getdirentries(fd int, buf []byte, basep *uintptr) (n int, err error)
+//sys	getdirentries(fd int, buf []byte, basep *uint64) (n int, err error)
-//sys	getdirentries_freebsd12(fd int, buf []byte, basep *uint64) (n int, err error)
 //sys	Getdtablesize() (size int)
 //sysnb	Getegid() (egid int)
 //sysnb	Geteuid() (uid int)
@@ -622,13 +372,10 @@ func PtraceSingleStep(pid int) (err error) {
 //sys	Link(path string, link string) (err error)
 //sys	Linkat(pathfd int, path string, linkfd int, link string, flags int) (err error)
 //sys	Listen(s int, backlog int) (err error)
-//sys	lstat(path string, stat *stat_freebsd11_t) (err error)
 //sys	Mkdir(path string, mode uint32) (err error)
 //sys	Mkdirat(dirfd int, path string, mode uint32) (err error)
 //sys	Mkfifo(path string, mode uint32) (err error)
-//sys	mknod(path string, mode uint32, dev int) (err error)
+//sys	Mknodat(fd int, path string, mode uint32, dev uint64) (err error)
-//sys	mknodat(fd int, path string, mode uint32, dev int) (err error)
-//sys	mknodat_freebsd12(fd int, path string, mode uint32, dev uint64) (err error)
 //sys	Nanosleep(time *Timespec, leftover *Timespec) (err error)
 //sys	Open(path string, mode int, perm uint32) (fd int, err error)
 //sys	Openat(fdat int, path string, mode int, perm uint32) (fd int, err error)
@@ -658,9 +405,7 @@ func PtraceSingleStep(pid int) (err error) {
 //sysnb	Setsid() (pid int, err error)
 //sysnb	Settimeofday(tp *Timeval) (err error)
 //sysnb	Setuid(uid int) (err error)
-//sys	stat(path string, stat *stat_freebsd11_t) (err error)
+//sys	Statfs(path string, stat *Statfs_t) (err error)
-//sys	statfs(path string, stat *statfs_freebsd11_t) (err error)
-//sys	statfs_freebsd12(path string, stat *Statfs_t) (err error)
 //sys	Symlink(path string, link string) (err error)
 //sys	Symlinkat(oldpath string, newdirfd int, newpath string) (err error)
 //sys	Sync() (err error)

vendor/golang.org/x/sys/unix/syscall_freebsd_386.go

@@ -57,11 +57,11 @@ func sendfile(outfd int, infd int, offset *int64, count int) (written int, err e
 func Syscall9(num, a1, a2, a3, a4, a5, a6, a7, a8, a9 uintptr) (r1, r2 uintptr, err syscall.Errno)
 
 func PtraceGetFsBase(pid int, fsbase *int64) (err error) {
-	return ptrace(PTRACE_GETFSBASE, pid, uintptr(unsafe.Pointer(fsbase)), 0)
+	return ptrace(PT_GETFSBASE, pid, uintptr(unsafe.Pointer(fsbase)), 0)
 }
 
 func PtraceIO(req int, pid int, addr uintptr, out []byte, countin int) (count int, err error) {
-	ioDesc := PtraceIoDesc{Op: int32(req), Offs: (*byte)(unsafe.Pointer(addr)), Addr: (*byte)(unsafe.Pointer(&out[0])), Len: uint32(countin)}
+	ioDesc := PtraceIoDesc{Op: int32(req), Offs: uintptr(unsafe.Pointer(addr)), Addr: uintptr(unsafe.Pointer(&out[0])), Len: uint32(countin)}
-	err = ptrace(PTRACE_IO, pid, uintptr(unsafe.Pointer(&ioDesc)), 0)
+	err = ptrace(PT_IO, pid, uintptr(unsafe.Pointer(&ioDesc)), 0)
 	return int(ioDesc.Len), err
 }

vendor/golang.org/x/sys/unix/syscall_freebsd_amd64.go

@@ -57,11 +57,11 @@ func sendfile(outfd int, infd int, offset *int64, count int) (written int, err e
 func Syscall9(num, a1, a2, a3, a4, a5, a6, a7, a8, a9 uintptr) (r1, r2 uintptr, err syscall.Errno)
 
 func PtraceGetFsBase(pid int, fsbase *int64) (err error) {
-	return ptrace(PTRACE_GETFSBASE, pid, uintptr(unsafe.Pointer(fsbase)), 0)
+	return ptrace(PT_GETFSBASE, pid, uintptr(unsafe.Pointer(fsbase)), 0)
 }
 
 func PtraceIO(req int, pid int, addr uintptr, out []byte, countin int) (count int, err error) {
-	ioDesc := PtraceIoDesc{Op: int32(req), Offs: (*byte)(unsafe.Pointer(addr)), Addr: (*byte)(unsafe.Pointer(&out[0])), Len: uint64(countin)}
+	ioDesc := PtraceIoDesc{Op: int32(req), Offs: uintptr(unsafe.Pointer(addr)), Addr: uintptr(unsafe.Pointer(&out[0])), Len: uint64(countin)}
-	err = ptrace(PTRACE_IO, pid, uintptr(unsafe.Pointer(&ioDesc)), 0)
+	err = ptrace(PT_IO, pid, uintptr(unsafe.Pointer(&ioDesc)), 0)
 	return int(ioDesc.Len), err
 }

vendor/golang.org/x/sys/unix/syscall_freebsd_arm.go

@@ -57,7 +57,7 @@ func sendfile(outfd int, infd int, offset *int64, count int) (written int, err e
 func Syscall9(num, a1, a2, a3, a4, a5, a6, a7, a8, a9 uintptr) (r1, r2 uintptr, err syscall.Errno)
 
 func PtraceIO(req int, pid int, addr uintptr, out []byte, countin int) (count int, err error) {
-	ioDesc := PtraceIoDesc{Op: int32(req), Offs: (*byte)(unsafe.Pointer(addr)), Addr: (*byte)(unsafe.Pointer(&out[0])), Len: uint32(countin)}
+	ioDesc := PtraceIoDesc{Op: int32(req), Offs: uintptr(unsafe.Pointer(addr)), Addr: uintptr(unsafe.Pointer(&out[0])), Len: uint32(countin)}
-	err = ptrace(PTRACE_IO, pid, uintptr(unsafe.Pointer(&ioDesc)), 0)
+	err = ptrace(PT_IO, pid, uintptr(unsafe.Pointer(&ioDesc)), 0)
 	return int(ioDesc.Len), err
 }

vendor/golang.org/x/sys/unix/syscall_freebsd_arm64.go

@@ -57,7 +57,7 @@ func sendfile(outfd int, infd int, offset *int64, count int) (written int, err e
 func Syscall9(num, a1, a2, a3, a4, a5, a6, a7, a8, a9 uintptr) (r1, r2 uintptr, err syscall.Errno)
 
 func PtraceIO(req int, pid int, addr uintptr, out []byte, countin int) (count int, err error) {
-	ioDesc := PtraceIoDesc{Op: int32(req), Offs: (*byte)(unsafe.Pointer(addr)), Addr: (*byte)(unsafe.Pointer(&out[0])), Len: uint64(countin)}
+	ioDesc := PtraceIoDesc{Op: int32(req), Offs: uintptr(unsafe.Pointer(addr)), Addr: uintptr(unsafe.Pointer(&out[0])), Len: uint64(countin)}
-	err = ptrace(PTRACE_IO, pid, uintptr(unsafe.Pointer(&ioDesc)), 0)
+	err = ptrace(PT_IO, pid, uintptr(unsafe.Pointer(&ioDesc)), 0)
 	return int(ioDesc.Len), err
 }

vendor/golang.org/x/sys/unix/syscall_illumos.go

@@ -20,10 +20,9 @@ func bytes2iovec(bs [][]byte) []Iovec {
 	for i, b := range bs {
 		iovecs[i].SetLen(len(b))
 		if len(b) > 0 {
-			// somehow Iovec.Base on illumos is (*int8), not (*byte)
+			iovecs[i].Base = &b[0]
-			iovecs[i].Base = (*int8)(unsafe.Pointer(&b[0]))
 		} else {
-			iovecs[i].Base = (*int8)(unsafe.Pointer(&_zero))
+			iovecs[i].Base = (*byte)(unsafe.Pointer(&_zero))
 		}
 	}
 	return iovecs

vendor/golang.org/x/sys/unix/syscall_linux.go

@@ -13,6 +13,7 @@ package unix
 
 import (
 	"encoding/binary"
+	"strconv"
 	"syscall"
 	"time"
 	"unsafe"
@@ -233,7 +234,7 @@ func Futimesat(dirfd int, path string, tv []Timeval) error {
 func Futimes(fd int, tv []Timeval) (err error) {
 	// Believe it or not, this is the best we can do on Linux
 	// (and is what glibc does).
-	return Utimes("/proc/self/fd/"+itoa(fd), tv)
+	return Utimes("/proc/self/fd/"+strconv.Itoa(fd), tv)
 }
 
 const ImplementsGetwd = true
@@ -512,24 +513,24 @@ func (sa *SockaddrL2) sockaddr() (unsafe.Pointer, _Socklen, error) {
 //
 // Server example:
 //
-//      fd, _ := Socket(AF_BLUETOOTH, SOCK_STREAM, BTPROTO_RFCOMM)
+//	fd, _ := Socket(AF_BLUETOOTH, SOCK_STREAM, BTPROTO_RFCOMM)
-//      _ = unix.Bind(fd, &unix.SockaddrRFCOMM{
+//	_ = unix.Bind(fd, &unix.SockaddrRFCOMM{
-//      	Channel: 1,
+//		Channel: 1,
-//      	Addr:    [6]uint8{0, 0, 0, 0, 0, 0}, // BDADDR_ANY or 00:00:00:00:00:00
+//		Addr:    [6]uint8{0, 0, 0, 0, 0, 0}, // BDADDR_ANY or 00:00:00:00:00:00
-//      })
+//	})
-//      _ = Listen(fd, 1)
+//	_ = Listen(fd, 1)
-//      nfd, sa, _ := Accept(fd)
+//	nfd, sa, _ := Accept(fd)
-//      fmt.Printf("conn addr=%v fd=%d", sa.(*unix.SockaddrRFCOMM).Addr, nfd)
+//	fmt.Printf("conn addr=%v fd=%d", sa.(*unix.SockaddrRFCOMM).Addr, nfd)
-//      Read(nfd, buf)
+//	Read(nfd, buf)
 //
 // Client example:
 //
-//      fd, _ := Socket(AF_BLUETOOTH, SOCK_STREAM, BTPROTO_RFCOMM)
+//	fd, _ := Socket(AF_BLUETOOTH, SOCK_STREAM, BTPROTO_RFCOMM)
-//      _ = Connect(fd, &SockaddrRFCOMM{
+//	_ = Connect(fd, &SockaddrRFCOMM{
-//      	Channel: 1,
+//		Channel: 1,
-//      	Addr:    [6]byte{0x11, 0x22, 0x33, 0xaa, 0xbb, 0xcc}, // CC:BB:AA:33:22:11
+//		Addr:    [6]byte{0x11, 0x22, 0x33, 0xaa, 0xbb, 0xcc}, // CC:BB:AA:33:22:11
-//      })
+//	})
-//      Write(fd, []byte(`hello`))
+//	Write(fd, []byte(`hello`))
 type SockaddrRFCOMM struct {
 	// Addr represents a bluetooth address, byte ordering is little-endian.
 	Addr [6]uint8
@@ -556,12 +557,12 @@ func (sa *SockaddrRFCOMM) sockaddr() (unsafe.Pointer, _Socklen, error) {
 // The SockaddrCAN struct must be bound to the socket file descriptor
 // using Bind before the CAN socket can be used.
 //
-//      // Read one raw CAN frame
+//	// Read one raw CAN frame
-//      fd, _ := Socket(AF_CAN, SOCK_RAW, CAN_RAW)
+//	fd, _ := Socket(AF_CAN, SOCK_RAW, CAN_RAW)
-//      addr := &SockaddrCAN{Ifindex: index}
+//	addr := &SockaddrCAN{Ifindex: index}
-//      Bind(fd, addr)
+//	Bind(fd, addr)
-//      frame := make([]byte, 16)
+//	frame := make([]byte, 16)
-//      Read(fd, frame)
+//	Read(fd, frame)
 //
 // The full SocketCAN documentation can be found in the linux kernel
 // archives at: https://www.kernel.org/doc/Documentation/networking/can.txt
@@ -632,13 +633,13 @@ func (sa *SockaddrCANJ1939) sockaddr() (unsafe.Pointer, _Socklen, error) {
 // Here is an example of using an AF_ALG socket with SHA1 hashing.
 // The initial socket setup process is as follows:
 //
-//      // Open a socket to perform SHA1 hashing.
+//	// Open a socket to perform SHA1 hashing.
-//      fd, _ := unix.Socket(unix.AF_ALG, unix.SOCK_SEQPACKET, 0)
+//	fd, _ := unix.Socket(unix.AF_ALG, unix.SOCK_SEQPACKET, 0)
-//      addr := &unix.SockaddrALG{Type: "hash", Name: "sha1"}
+//	addr := &unix.SockaddrALG{Type: "hash", Name: "sha1"}
-//      unix.Bind(fd, addr)
+//	unix.Bind(fd, addr)
-//      // Note: unix.Accept does not work at this time; must invoke accept()
+//	// Note: unix.Accept does not work at this time; must invoke accept()
-//      // manually using unix.Syscall.
+//	// manually using unix.Syscall.
-//      hashfd, _, _ := unix.Syscall(unix.SYS_ACCEPT, uintptr(fd), 0, 0)
+//	hashfd, _, _ := unix.Syscall(unix.SYS_ACCEPT, uintptr(fd), 0, 0)
 //
 // Once a file descriptor has been returned from Accept, it may be used to
 // perform SHA1 hashing. The descriptor is not safe for concurrent use, but
@@ -647,39 +648,39 @@ func (sa *SockaddrCANJ1939) sockaddr() (unsafe.Pointer, _Socklen, error) {
 // When hashing a small byte slice or string, a single Write and Read may
 // be used:
 //
-//      // Assume hashfd is already configured using the setup process.
+//	// Assume hashfd is already configured using the setup process.
-//      hash := os.NewFile(hashfd, "sha1")
+//	hash := os.NewFile(hashfd, "sha1")
-//      // Hash an input string and read the results. Each Write discards
+//	// Hash an input string and read the results. Each Write discards
-//      // previous hash state. Read always reads the current state.
+//	// previous hash state. Read always reads the current state.
-//      b := make([]byte, 20)
+//	b := make([]byte, 20)
-//      for i := 0; i < 2; i++ {
+//	for i := 0; i < 2; i++ {
-//          io.WriteString(hash, "Hello, world.")
+//	    io.WriteString(hash, "Hello, world.")
-//          hash.Read(b)
+//	    hash.Read(b)
-//          fmt.Println(hex.EncodeToString(b))
+//	    fmt.Println(hex.EncodeToString(b))
-//      }
+//	}
-//      // Output:
+//	// Output:
-//      // 2ae01472317d1935a84797ec1983ae243fc6aa28
+//	// 2ae01472317d1935a84797ec1983ae243fc6aa28
-//      // 2ae01472317d1935a84797ec1983ae243fc6aa28
+//	// 2ae01472317d1935a84797ec1983ae243fc6aa28
 //
 // For hashing larger byte slices, or byte streams such as those read from
 // a file or socket, use Sendto with MSG_MORE to instruct the kernel to update
 // the hash digest instead of creating a new one for a given chunk and finalizing it.
 //
-//      // Assume hashfd and addr are already configured using the setup process.
+//	// Assume hashfd and addr are already configured using the setup process.
-//      hash := os.NewFile(hashfd, "sha1")
+//	hash := os.NewFile(hashfd, "sha1")
-//      // Hash the contents of a file.
+//	// Hash the contents of a file.
-//      f, _ := os.Open("/tmp/linux-4.10-rc7.tar.xz")
+//	f, _ := os.Open("/tmp/linux-4.10-rc7.tar.xz")
-//      b := make([]byte, 4096)
+//	b := make([]byte, 4096)
-//      for {
+//	for {
-//          n, err := f.Read(b)
+//	    n, err := f.Read(b)
-//          if err == io.EOF {
+//	    if err == io.EOF {
-//              break
+//	        break
-//          }
+//	    }
-//          unix.Sendto(hashfd, b[:n], unix.MSG_MORE, addr)
+//	    unix.Sendto(hashfd, b[:n], unix.MSG_MORE, addr)
-//      }
+//	}
-//      hash.Read(b)
+//	hash.Read(b)
-//      fmt.Println(hex.EncodeToString(b))
+//	fmt.Println(hex.EncodeToString(b))
-//      // Output: 85cdcad0c06eef66f805ecce353bec9accbeecc5
+//	// Output: 85cdcad0c06eef66f805ecce353bec9accbeecc5
 //
 // For more information, see: http://www.chronox.de/crypto-API/crypto/userspace-if.html.
 type SockaddrALG struct {
@@ -1499,18 +1500,13 @@ func KeyctlRestrictKeyring(ringid int, keyType string, restriction string) error
 //sys	keyctlRestrictKeyringByType(cmd int, arg2 int, keyType string, restriction string) (err error) = SYS_KEYCTL
 //sys	keyctlRestrictKeyring(cmd int, arg2 int) (err error) = SYS_KEYCTL
 
-func recvmsgRaw(fd int, p, oob []byte, flags int, rsa *RawSockaddrAny) (n, oobn int, recvflags int, err error) {
+func recvmsgRaw(fd int, iov []Iovec, oob []byte, flags int, rsa *RawSockaddrAny) (n, oobn int, recvflags int, err error) {
 	var msg Msghdr
 	msg.Name = (*byte)(unsafe.Pointer(rsa))
 	msg.Namelen = uint32(SizeofSockaddrAny)
-	var iov Iovec
-	if len(p) > 0 {
-		iov.Base = &p[0]
-		iov.SetLen(len(p))
-	}
 	var dummy byte
 	if len(oob) > 0 {
-		if len(p) == 0 {
+		if emptyIovecs(iov) {
 			var sockType int
 			sockType, err = GetsockoptInt(fd, SOL_SOCKET, SO_TYPE)
 			if err != nil {
@@ -1518,15 +1514,19 @@ func recvmsgRaw(fd int, p, oob []byte, flags int, rsa *RawSockaddrAny) (n, oobn
 			}
 			// receive at least one normal byte
 			if sockType != SOCK_DGRAM {
-				iov.Base = &dummy
+				var iova [1]Iovec
-				iov.SetLen(1)
+				iova[0].Base = &dummy
+				iova[0].SetLen(1)
+				iov = iova[:]
 			}
 		}
 		msg.Control = &oob[0]
 		msg.SetControllen(len(oob))
 	}
-	msg.Iov = &iov
+	if len(iov) > 0 {
-	msg.Iovlen = 1
+		msg.Iov = &iov[0]
+		msg.SetIovlen(len(iov))
+	}
 	if n, err = recvmsg(fd, &msg, flags); err != nil {
 		return
 	}
@@ -1535,18 +1535,15 @@ func recvmsgRaw(fd int, p, oob []byte, flags int, rsa *RawSockaddrAny) (n, oobn
 	return
 }
 
-func sendmsgN(fd int, p, oob []byte, ptr unsafe.Pointer, salen _Socklen, flags int) (n int, err error) {
+func sendmsgN(fd int, iov []Iovec, oob []byte, ptr unsafe.Pointer, salen _Socklen, flags int) (n int, err error) {
 	var msg Msghdr
 	msg.Name = (*byte)(ptr)
 	msg.Namelen = uint32(salen)
-	var iov Iovec
-	if len(p) > 0 {
-		iov.Base = &p[0]
-		iov.SetLen(len(p))
-	}
 	var dummy byte
+	var empty bool
 	if len(oob) > 0 {
-		if len(p) == 0 {
+		empty = emptyIovecs(iov)
+		if empty {
 			var sockType int
 			sockType, err = GetsockoptInt(fd, SOL_SOCKET, SO_TYPE)
 			if err != nil {
@@ -1554,19 +1551,22 @@ func sendmsgN(fd int, p, oob []byte, ptr unsafe.Pointer, salen _Socklen, flags i
 			}
 			// send at least one normal byte
 			if sockType != SOCK_DGRAM {
-				iov.Base = &dummy
+				var iova [1]Iovec
-				iov.SetLen(1)
+				iova[0].Base = &dummy
+				iova[0].SetLen(1)
 			}
 		}
 		msg.Control = &oob[0]
 		msg.SetControllen(len(oob))
 	}
-	msg.Iov = &iov
+	if len(iov) > 0 {
-	msg.Iovlen = 1
+		msg.Iov = &iov[0]
+		msg.SetIovlen(len(iov))
+	}
 	if n, err = sendmsg(fd, &msg, flags); err != nil {
 		return 0, err
 	}
-	if len(oob) > 0 && len(p) == 0 {
+	if len(oob) > 0 && empty {
 		n = 0
 	}
 	return n, nil
@@ -1829,6 +1829,9 @@ func Dup2(oldfd, newfd int) error {
 //sys	Fremovexattr(fd int, attr string) (err error)
 //sys	Fsetxattr(fd int, attr string, dest []byte, flags int) (err error)
 //sys	Fsync(fd int) (err error)
+//sys	Fsmount(fd int, flags int, mountAttrs int) (fsfd int, err error)
+//sys	Fsopen(fsName string, flags int) (fd int, err error)
+//sys	Fspick(dirfd int, pathName string, flags int) (fd int, err error)
 //sys	Getdents(fd int, buf []byte) (n int, err error) = SYS_GETDENTS64
 //sysnb	Getpgid(pid int) (pgid int, err error)
 
@@ -1889,17 +1892,28 @@ func PrctlRetInt(option int, arg2 uintptr, arg3 uintptr, arg4 uintptr, arg5 uint
 	return int(ret), nil
 }
 
-// issue 1435.
-// On linux Setuid and Setgid only affects the current thread, not the process.
-// This does not match what most callers expect so we must return an error
-// here rather than letting the caller think that the call succeeded.
-
 func Setuid(uid int) (err error) {
-	return EOPNOTSUPP
+	return syscall.Setuid(uid)
 }
 
-func Setgid(uid int) (err error) {
+func Setgid(gid int) (err error) {
-	return EOPNOTSUPP
+	return syscall.Setgid(gid)
+}
+
+func Setreuid(ruid, euid int) (err error) {
+	return syscall.Setreuid(ruid, euid)
+}
+
+func Setregid(rgid, egid int) (err error) {
+	return syscall.Setregid(rgid, egid)
+}
+
+func Setresuid(ruid, euid, suid int) (err error) {
+	return syscall.Setresuid(ruid, euid, suid)
+}
+
+func Setresgid(rgid, egid, sgid int) (err error) {
+	return syscall.Setresgid(rgid, egid, sgid)
 }
 
 // SetfsgidRetGid sets fsgid for current thread and returns previous fsgid set.
@@ -2186,7 +2200,7 @@ func Faccessat(dirfd int, path string, mode uint32, flags int) (err error) {
 			gid = Getgid()
 		}
 
-		if uint32(gid) == st.Gid || isGroupMember(gid) {
+		if uint32(gid) == st.Gid || isGroupMember(int(st.Gid)) {
 			fmode = (st.Mode >> 3) & 7
 		} else {
 			fmode = st.Mode & 7

vendor/golang.org/x/sys/unix/syscall_linux_386.go

@@ -41,10 +41,6 @@ func setTimeval(sec, usec int64) Timeval {
 //sys	sendfile(outfd int, infd int, offset *int64, count int) (written int, err error) = SYS_SENDFILE64
 //sys	setfsgid(gid int) (prev int, err error) = SYS_SETFSGID32
 //sys	setfsuid(uid int) (prev int, err error) = SYS_SETFSUID32
-//sysnb	Setregid(rgid int, egid int) (err error) = SYS_SETREGID32
-//sysnb	Setresgid(rgid int, egid int, sgid int) (err error) = SYS_SETRESGID32
-//sysnb	Setresuid(ruid int, euid int, suid int) (err error) = SYS_SETRESUID32
-//sysnb	Setreuid(ruid int, euid int) (err error) = SYS_SETREUID32
 //sys	Splice(rfd int, roff *int64, wfd int, woff *int64, len int, flags int) (n int, err error)
 //sys	Stat(path string, stat *Stat_t) (err error) = SYS_STAT64
 //sys	SyncFileRange(fd int, off int64, n int64, flags int) (err error)

vendor/golang.org/x/sys/unix/syscall_linux_amd64.go

@@ -46,11 +46,7 @@ func Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err
 //sys	sendfile(outfd int, infd int, offset *int64, count int) (written int, err error)
 //sys	setfsgid(gid int) (prev int, err error)
 //sys	setfsuid(uid int) (prev int, err error)
-//sysnb	Setregid(rgid int, egid int) (err error)
-//sysnb	Setresgid(rgid int, egid int, sgid int) (err error)
-//sysnb	Setresuid(ruid int, euid int, suid int) (err error)
 //sysnb	Setrlimit(resource int, rlim *Rlimit) (err error)
-//sysnb	Setreuid(ruid int, euid int) (err error)
 //sys	Shutdown(fd int, how int) (err error)
 //sys	Splice(rfd int, roff *int64, wfd int, woff *int64, len int, flags int) (n int64, err error)
 

vendor/golang.org/x/sys/unix/syscall_linux_arm.go

@@ -62,10 +62,6 @@ func Seek(fd int, offset int64, whence int) (newoffset int64, err error) {
 //sys	Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err error) = SYS__NEWSELECT
 //sys	setfsgid(gid int) (prev int, err error) = SYS_SETFSGID32
 //sys	setfsuid(uid int) (prev int, err error) = SYS_SETFSUID32
-//sysnb	Setregid(rgid int, egid int) (err error) = SYS_SETREGID32
-//sysnb	Setresgid(rgid int, egid int, sgid int) (err error) = SYS_SETRESGID32
-//sysnb	Setresuid(ruid int, euid int, suid int) (err error) = SYS_SETRESUID32
-//sysnb	Setreuid(ruid int, euid int) (err error) = SYS_SETREUID32
 //sys	Shutdown(fd int, how int) (err error)
 //sys	Splice(rfd int, roff *int64, wfd int, woff *int64, len int, flags int) (n int, err error)
 //sys	Stat(path string, stat *Stat_t) (err error) = SYS_STAT64

vendor/golang.org/x/sys/unix/syscall_linux_arm64.go

@@ -39,11 +39,7 @@ func Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err
 //sys	sendfile(outfd int, infd int, offset *int64, count int) (written int, err error)
 //sys	setfsgid(gid int) (prev int, err error)
 //sys	setfsuid(uid int) (prev int, err error)
-//sysnb	Setregid(rgid int, egid int) (err error)
-//sysnb	Setresgid(rgid int, egid int, sgid int) (err error)
-//sysnb	Setresuid(ruid int, euid int, suid int) (err error)
 //sysnb	setrlimit(resource int, rlim *Rlimit) (err error)
-//sysnb	Setreuid(ruid int, euid int) (err error)
 //sys	Shutdown(fd int, how int) (err error)
 //sys	Splice(rfd int, roff *int64, wfd int, woff *int64, len int, flags int) (n int64, err error)
 

vendor/golang.org/x/sys/unix/syscall_linux_mips64x.go

@@ -37,11 +37,7 @@ func Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err
 //sys	sendfile(outfd int, infd int, offset *int64, count int) (written int, err error)
 //sys	setfsgid(gid int) (prev int, err error)
 //sys	setfsuid(uid int) (prev int, err error)
-//sysnb	Setregid(rgid int, egid int) (err error)
-//sysnb	Setresgid(rgid int, egid int, sgid int) (err error)
-//sysnb	Setresuid(ruid int, euid int, suid int) (err error)
 //sysnb	Setrlimit(resource int, rlim *Rlimit) (err error)
-//sysnb	Setreuid(ruid int, euid int) (err error)
 //sys	Shutdown(fd int, how int) (err error)
 //sys	Splice(rfd int, roff *int64, wfd int, woff *int64, len int, flags int) (n int64, err error)
 //sys	Statfs(path string, buf *Statfs_t) (err error)

vendor/golang.org/x/sys/unix/syscall_linux_mipsx.go

@@ -32,10 +32,6 @@ func Syscall9(trap, a1, a2, a3, a4, a5, a6, a7, a8, a9 uintptr) (r1, r2 uintptr,
 //sys	sendfile(outfd int, infd int, offset *int64, count int) (written int, err error) = SYS_SENDFILE64
 //sys	setfsgid(gid int) (prev int, err error)
 //sys	setfsuid(uid int) (prev int, err error)
-//sysnb	Setregid(rgid int, egid int) (err error)
-//sysnb	Setresgid(rgid int, egid int, sgid int) (err error)
-//sysnb	Setresuid(ruid int, euid int, suid int) (err error)
-//sysnb	Setreuid(ruid int, euid int) (err error)
 //sys	Shutdown(fd int, how int) (err error)
 //sys	Splice(rfd int, roff *int64, wfd int, woff *int64, len int, flags int) (n int, err error)
 //sys	SyncFileRange(fd int, off int64, n int64, flags int) (err error)

vendor/golang.org/x/sys/unix/syscall_linux_ppc.go

@@ -34,10 +34,6 @@ import (
 //sys	sendfile(outfd int, infd int, offset *int64, count int) (written int, err error) = SYS_SENDFILE64
 //sys	setfsgid(gid int) (prev int, err error)
 //sys	setfsuid(uid int) (prev int, err error)
-//sysnb	Setregid(rgid int, egid int) (err error)
-//sysnb	Setresgid(rgid int, egid int, sgid int) (err error)
-//sysnb	Setresuid(ruid int, euid int, suid int) (err error)
-//sysnb	Setreuid(ruid int, euid int) (err error)
 //sys	Shutdown(fd int, how int) (err error)
 //sys	Splice(rfd int, roff *int64, wfd int, woff *int64, len int, flags int) (n int, err error)
 //sys	Stat(path string, stat *Stat_t) (err error) = SYS_STAT64

vendor/golang.org/x/sys/unix/syscall_linux_ppc64x.go

@@ -34,11 +34,7 @@ package unix
 //sys	sendfile(outfd int, infd int, offset *int64, count int) (written int, err error)
 //sys	setfsgid(gid int) (prev int, err error)
 //sys	setfsuid(uid int) (prev int, err error)
-//sysnb	Setregid(rgid int, egid int) (err error)
-//sysnb	Setresgid(rgid int, egid int, sgid int) (err error)
-//sysnb	Setresuid(ruid int, euid int, suid int) (err error)
 //sysnb	Setrlimit(resource int, rlim *Rlimit) (err error)
-//sysnb	Setreuid(ruid int, euid int) (err error)
 //sys	Shutdown(fd int, how int) (err error)
 //sys	Splice(rfd int, roff *int64, wfd int, woff *int64, len int, flags int) (n int64, err error)
 //sys	Stat(path string, stat *Stat_t) (err error)

vendor/golang.org/x/sys/unix/syscall_linux_riscv64.go

@@ -22,6 +22,7 @@ import "unsafe"
 //sysnb	Getrlimit(resource int, rlim *Rlimit) (err error)
 //sysnb	Getuid() (uid int)
 //sys	Listen(s int, n int) (err error)
+//sys	MemfdSecret(flags int) (fd int, err error)
 //sys	pread(fd int, p []byte, offset int64) (n int, err error) = SYS_PREAD64
 //sys	pwrite(fd int, p []byte, offset int64) (n int, err error) = SYS_PWRITE64
 //sys	Seek(fd int, offset int64, whence int) (off int64, err error) = SYS_LSEEK
@@ -37,11 +38,7 @@ func Select(nfd int, r *FdSet, w *FdSet, e *FdSet, timeout *Timeval) (n int, err
 //sys	sendfile(outfd int, infd int, offset *int64, count int) (written int, err error)
 //sys	setfsgid(gid int) (prev int, err error)
 //sys	setfsuid(uid int) (prev int, err error)
-//sysnb	Setregid(rgid int, egid int) (err error)
-//sysnb	Setresgid(rgid int, egid int, sgid int) (err error)
-//sysnb	Setresuid(ruid int, euid int, suid int) (err error)
 //sysnb	Setrlimit(resource int, rlim *Rlimit) (err error)
-//sysnb	Setreuid(ruid int, euid int) (err error)
 //sys	Shutdown(fd int, how int) (err error)
 //sys	Splice(rfd int, roff *int64, wfd int, woff *int64, len int, flags int) (n int64, err error)
 

vendor/golang.org/x/sys/unix/syscall_linux_s390x.go

@@ -34,11 +34,7 @@ import (
 //sys	sendfile(outfd int, infd int, offset *int64, count int) (written int, err error)
 //sys	setfsgid(gid int) (prev int, err error)
 //sys	setfsuid(uid int) (prev int, err error)
-//sysnb	Setregid(rgid int, egid int) (err error)
-//sysnb	Setresgid(rgid int, egid int, sgid int) (err error)
-//sysnb	Setresuid(ruid int, euid int, suid int) (err error)
 //sysnb	Setrlimit(resource int, rlim *Rlimit) (err error)
-//sysnb	Setreuid(ruid int, euid int) (err error)
 //sys	Splice(rfd int, roff *int64, wfd int, woff *int64, len int, flags int) (n int64, err error)
 //sys	Stat(path string, stat *Stat_t) (err error)
 //sys	Statfs(path string, buf *Statfs_t) (err error)

vendor/golang.org/x/sys/unix/syscall_linux_sparc64.go

@@ -31,11 +31,7 @@ package unix
 //sys	sendfile(outfd int, infd int, offset *int64, count int) (written int, err error)
 //sys	setfsgid(gid int) (prev int, err error)
 //sys	setfsuid(uid int) (prev int, err error)
-//sysnb	Setregid(rgid int, egid int) (err error)
-//sysnb	Setresgid(rgid int, egid int, sgid int) (err error)
-//sysnb	Setresuid(ruid int, euid int, suid int) (err error)
 //sysnb	Setrlimit(resource int, rlim *Rlimit) (err error)
-//sysnb	Setreuid(ruid int, euid int) (err error)
 //sys	Shutdown(fd int, how int) (err error)
 //sys	Splice(rfd int, roff *int64, wfd int, woff *int64, len int, flags int) (n int64, err error)
 //sys	Stat(path string, stat *Stat_t) (err error)

vendor/golang.org/x/sys/unix/syscall_openbsd.go

@@ -81,6 +81,7 @@ func Pipe(p []int) (err error) {
 }
 
 //sysnb	pipe2(p *[2]_C_int, flags int) (err error)
+
 func Pipe2(p []int, flags int) error {
 	if len(p) != 2 {
 		return EINVAL
@@ -95,6 +96,7 @@ func Pipe2(p []int, flags int) error {
 }
 
 //sys	Getdents(fd int, buf []byte) (n int, err error)
+
 func Getdirentries(fd int, buf []byte, basep *uintptr) (n int, err error) {
 	n, err = Getdents(fd, buf)
 	if err != nil || basep == nil {

vendor/golang.org/x/sys/unix/syscall_openbsd_mips64.go

@@ -26,6 +26,10 @@ func (msghdr *Msghdr) SetControllen(length int) {
 	msghdr.Controllen = uint32(length)
 }
 
+func (msghdr *Msghdr) SetIovlen(length int) {
+	msghdr.Iovlen = uint32(length)
+}
+
 func (cmsg *Cmsghdr) SetLen(length int) {
 	cmsg.Len = uint32(length)
 }

vendor/golang.org/x/sys/unix/syscall_solaris.go

@@ -451,26 +451,25 @@ func Accept(fd int) (nfd int, sa Sockaddr, err error) {
 
 //sys	recvmsg(s int, msg *Msghdr, flags int) (n int, err error) = libsocket.__xnet_recvmsg
 
-func recvmsgRaw(fd int, p, oob []byte, flags int, rsa *RawSockaddrAny) (n, oobn int, recvflags int, err error) {
+func recvmsgRaw(fd int, iov []Iovec, oob []byte, flags int, rsa *RawSockaddrAny) (n, oobn int, recvflags int, err error) {
 	var msg Msghdr
 	msg.Name = (*byte)(unsafe.Pointer(rsa))
 	msg.Namelen = uint32(SizeofSockaddrAny)
-	var iov Iovec
+	var dummy byte
-	if len(p) > 0 {
-		iov.Base = (*int8)(unsafe.Pointer(&p[0]))
-		iov.SetLen(len(p))
-	}
-	var dummy int8
 	if len(oob) > 0 {
 		// receive at least one normal byte
-		if len(p) == 0 {
+		if emptyIovecs(iov) {
-			iov.Base = &dummy
+			var iova [1]Iovec
-			iov.SetLen(1)
+			iova[0].Base = &dummy
+			iova[0].SetLen(1)
+			iov = iova[:]
 		}
 		msg.Accrightslen = int32(len(oob))
 	}
-	msg.Iov = &iov
+	if len(iov) > 0 {
-	msg.Iovlen = 1
+		msg.Iov = &iov[0]
+		msg.SetIovlen(len(iov))
+	}
 	if n, err = recvmsg(fd, &msg, flags); n == -1 {
 		return
 	}
@@ -480,30 +479,31 @@ func recvmsgRaw(fd int, p, oob []byte, flags int, rsa *RawSockaddrAny) (n, oobn
 
 //sys	sendmsg(s int, msg *Msghdr, flags int) (n int, err error) = libsocket.__xnet_sendmsg
 
-func sendmsgN(fd int, p, oob []byte, ptr unsafe.Pointer, salen _Socklen, flags int) (n int, err error) {
+func sendmsgN(fd int, iov []Iovec, oob []byte, ptr unsafe.Pointer, salen _Socklen, flags int) (n int, err error) {
 	var msg Msghdr
 	msg.Name = (*byte)(unsafe.Pointer(ptr))
 	msg.Namelen = uint32(salen)
-	var iov Iovec
+	var dummy byte
-	if len(p) > 0 {
+	var empty bool
-		iov.Base = (*int8)(unsafe.Pointer(&p[0]))
-		iov.SetLen(len(p))
-	}
-	var dummy int8
 	if len(oob) > 0 {
 		// send at least one normal byte
-		if len(p) == 0 {
+		empty = emptyIovecs(iov)
-			iov.Base = &dummy
+		if empty {
-			iov.SetLen(1)
+			var iova [1]Iovec
+			iova[0].Base = &dummy
+			iova[0].SetLen(1)
+			iov = iova[:]
 		}
 		msg.Accrightslen = int32(len(oob))
 	}
-	msg.Iov = &iov
+	if len(iov) > 0 {
-	msg.Iovlen = 1
+		msg.Iov = &iov[0]
+		msg.SetIovlen(len(iov))
+	}
 	if n, err = sendmsg(fd, &msg, flags); err != nil {
 		return 0, err
 	}
-	if len(oob) > 0 && len(p) == 0 {
+	if len(oob) > 0 && empty {
 		n = 0
 	}
 	return n, nil
@@ -618,6 +618,7 @@ func Sendfile(outfd int, infd int, offset *int64, count int) (written int, err e
 //sys	Getpriority(which int, who int) (n int, err error)
 //sysnb	Getrlimit(which int, lim *Rlimit) (err error)
 //sysnb	Getrusage(who int, rusage *Rusage) (err error)
+//sysnb	Getsid(pid int) (sid int, err error)
 //sysnb	Gettimeofday(tv *Timeval) (err error)
 //sysnb	Getuid() (uid int)
 //sys	Kill(pid int, signum syscall.Signal) (err error)
@@ -749,8 +750,8 @@ type EventPort struct {
 	// we should handle things gracefully. To do so, we need to keep an extra
 	// reference to the cookie around until the event is processed
 	// thus the otherwise seemingly extraneous "cookies" map
-	// The key of this map is a pointer to the corresponding &fCookie.cookie
+	// The key of this map is a pointer to the corresponding fCookie
-	cookies map[*interface{}]*fileObjCookie
+	cookies map[*fileObjCookie]struct{}
 }
 
 // PortEvent is an abstraction of the port_event C struct.
@@ -777,7 +778,7 @@ func NewEventPort() (*EventPort, error) {
 		port:    port,
 		fds:     make(map[uintptr]*fileObjCookie),
 		paths:   make(map[string]*fileObjCookie),
-		cookies: make(map[*interface{}]*fileObjCookie),
+		cookies: make(map[*fileObjCookie]struct{}),
 	}
 	return e, nil
 }
@@ -798,6 +799,7 @@ func (e *EventPort) Close() error {
 	}
 	e.fds = nil
 	e.paths = nil
+	e.cookies = nil
 	return nil
 }
 
@@ -825,17 +827,16 @@ func (e *EventPort) AssociatePath(path string, stat os.FileInfo, events int, coo
 	if _, found := e.paths[path]; found {
 		return fmt.Errorf("%v is already associated with this Event Port", path)
 	}
-	fobj, err := createFileObj(path, stat)
+	fCookie, err := createFileObjCookie(path, stat, cookie)
 	if err != nil {
 		return err
 	}
-	fCookie := &fileObjCookie{fobj, cookie}
+	_, err = port_associate(e.port, PORT_SOURCE_FILE, uintptr(unsafe.Pointer(fCookie.fobj)), events, (*byte)(unsafe.Pointer(fCookie)))
-	_, err = port_associate(e.port, PORT_SOURCE_FILE, uintptr(unsafe.Pointer(fobj)), events, (*byte)(unsafe.Pointer(&fCookie.cookie)))
 	if err != nil {
 		return err
 	}
 	e.paths[path] = fCookie
-	e.cookies[&fCookie.cookie] = fCookie
+	e.cookies[fCookie] = struct{}{}
 	return nil
 }
 
@@ -857,7 +858,7 @@ func (e *EventPort) DissociatePath(path string) error {
 	if err == nil {
 		// dissociate was successful, safe to delete the cookie
 		fCookie := e.paths[path]
-		delete(e.cookies, &fCookie.cookie)
+		delete(e.cookies, fCookie)
 	}
 	delete(e.paths, path)
 	return err
@@ -870,13 +871,16 @@ func (e *EventPort) AssociateFd(fd uintptr, events int, cookie interface{}) erro
 	if _, found := e.fds[fd]; found {
 		return fmt.Errorf("%v is already associated with this Event Port", fd)
 	}
-	fCookie := &fileObjCookie{nil, cookie}
+	fCookie, err := createFileObjCookie("", nil, cookie)
-	_, err := port_associate(e.port, PORT_SOURCE_FD, fd, events, (*byte)(unsafe.Pointer(&fCookie.cookie)))
+	if err != nil {
+		return err
+	}
+	_, err = port_associate(e.port, PORT_SOURCE_FD, fd, events, (*byte)(unsafe.Pointer(fCookie)))
 	if err != nil {
 		return err
 	}
 	e.fds[fd] = fCookie
-	e.cookies[&fCookie.cookie] = fCookie
+	e.cookies[fCookie] = struct{}{}
 	return nil
 }
 
@@ -895,27 +899,31 @@ func (e *EventPort) DissociateFd(fd uintptr) error {
 	if err == nil {
 		// dissociate was successful, safe to delete the cookie
 		fCookie := e.fds[fd]
-		delete(e.cookies, &fCookie.cookie)
+		delete(e.cookies, fCookie)
 	}
 	delete(e.fds, fd)
 	return err
 }
 
-func createFileObj(name string, stat os.FileInfo) (*fileObj, error) {
+func createFileObjCookie(name string, stat os.FileInfo, cookie interface{}) (*fileObjCookie, error) {
-	fobj := new(fileObj)
+	fCookie := new(fileObjCookie)
-	bs, err := ByteSliceFromString(name)
+	fCookie.cookie = cookie
-	if err != nil {
+	if name != "" && stat != nil {
-		return nil, err
+		fCookie.fobj = new(fileObj)
+		bs, err := ByteSliceFromString(name)
+		if err != nil {
+			return nil, err
+		}
+		fCookie.fobj.Name = (*int8)(unsafe.Pointer(&bs[0]))
+		s := stat.Sys().(*syscall.Stat_t)
+		fCookie.fobj.Atim.Sec = s.Atim.Sec
+		fCookie.fobj.Atim.Nsec = s.Atim.Nsec
+		fCookie.fobj.Mtim.Sec = s.Mtim.Sec
+		fCookie.fobj.Mtim.Nsec = s.Mtim.Nsec
+		fCookie.fobj.Ctim.Sec = s.Ctim.Sec
+		fCookie.fobj.Ctim.Nsec = s.Ctim.Nsec
 	}
-	fobj.Name = (*int8)(unsafe.Pointer(&bs[0]))
+	return fCookie, nil
-	s := stat.Sys().(*syscall.Stat_t)
-	fobj.Atim.Sec = s.Atim.Sec
-	fobj.Atim.Nsec = s.Atim.Nsec
-	fobj.Mtim.Sec = s.Mtim.Sec
-	fobj.Mtim.Nsec = s.Mtim.Nsec
-	fobj.Ctim.Sec = s.Ctim.Sec
-	fobj.Ctim.Nsec = s.Ctim.Nsec
-	return fobj, nil
 }
 
 // GetOne wraps port_get(3c) and returns a single PortEvent.
@@ -928,44 +936,50 @@ func (e *EventPort) GetOne(t *Timespec) (*PortEvent, error) {
 	p := new(PortEvent)
 	e.mu.Lock()
 	defer e.mu.Unlock()
-	e.peIntToExt(pe, p)
+	err = e.peIntToExt(pe, p)
+	if err != nil {
+		return nil, err
+	}
 	return p, nil
 }
 
 // peIntToExt converts a cgo portEvent struct into the friendlier PortEvent
 // NOTE: Always call this function while holding the e.mu mutex
-func (e *EventPort) peIntToExt(peInt *portEvent, peExt *PortEvent) {
+func (e *EventPort) peIntToExt(peInt *portEvent, peExt *PortEvent) error {
+	if e.cookies == nil {
+		return fmt.Errorf("this EventPort is already closed")
+	}
 	peExt.Events = peInt.Events
 	peExt.Source = peInt.Source
-	cookie := (*interface{})(unsafe.Pointer(peInt.User))
+	fCookie := (*fileObjCookie)(unsafe.Pointer(peInt.User))
-	peExt.Cookie = *cookie
+	_, found := e.cookies[fCookie]
+
+	if !found {
+		panic("unexpected event port address; may be due to kernel bug; see https://go.dev/issue/54254")
+	}
+	peExt.Cookie = fCookie.cookie
+	delete(e.cookies, fCookie)
+
 	switch peInt.Source {
 	case PORT_SOURCE_FD:
-		delete(e.cookies, cookie)
 		peExt.Fd = uintptr(peInt.Object)
 		// Only remove the fds entry if it exists and this cookie matches
 		if fobj, ok := e.fds[peExt.Fd]; ok {
-			if &fobj.cookie == cookie {
+			if fobj == fCookie {
 				delete(e.fds, peExt.Fd)
 			}
 		}
 	case PORT_SOURCE_FILE:
-		if fCookie, ok := e.cookies[cookie]; ok && uintptr(unsafe.Pointer(fCookie.fobj)) == uintptr(peInt.Object) {
+		peExt.fobj = fCookie.fobj
-			// Use our stashed reference rather than using unsafe on what we got back
-			// the unsafe version would be (*fileObj)(unsafe.Pointer(uintptr(peInt.Object)))
-			peExt.fobj = fCookie.fobj
-		} else {
-			panic("mismanaged memory")
-		}
-		delete(e.cookies, cookie)
 		peExt.Path = BytePtrToString((*byte)(unsafe.Pointer(peExt.fobj.Name)))
 		// Only remove the paths entry if it exists and this cookie matches
 		if fobj, ok := e.paths[peExt.Path]; ok {
-			if &fobj.cookie == cookie {
+			if fobj == fCookie {
 				delete(e.paths, peExt.Path)
 			}
 		}
 	}
+	return nil
 }
 
 // Pending wraps port_getn(3c) and returns how many events are pending.
@@ -989,7 +1003,7 @@ func (e *EventPort) Get(s []PortEvent, min int, timeout *Timespec) (int, error)
 	got := uint32(min)
 	max := uint32(len(s))
 	var err error
-	ps := make([]portEvent, max, max)
+	ps := make([]portEvent, max)
 	_, err = port_getn(e.port, &ps[0], max, &got, timeout)
 	// got will be trustworthy with ETIME, but not any other error.
 	if err != nil && err != ETIME {
@@ -997,8 +1011,18 @@ func (e *EventPort) Get(s []PortEvent, min int, timeout *Timespec) (int, error)
 	}
 	e.mu.Lock()
 	defer e.mu.Unlock()
+	valid := 0
 	for i := 0; i < int(got); i++ {
-		e.peIntToExt(&ps[i], &s[i])
+		err2 := e.peIntToExt(&ps[i], &s[i])
+		if err2 != nil {
+			if valid == 0 && err == nil {
+				// If err2 is the only error and there are no valid events
+				// to return, return it to the caller.
+				err = err2
+			}
+			break
+		}
+		valid = i + 1
 	}
-	return int(got), err
+	return valid, err
 }

vendor/golang.org/x/sys/unix/syscall_unix.go

@@ -13,8 +13,6 @@ import (
 	"sync"
 	"syscall"
 	"unsafe"
-
-	"golang.org/x/sys/internal/unsafeheader"
 )
 
 var (
@@ -117,11 +115,7 @@ func (m *mmapper) Mmap(fd int, offset int64, length int, prot int, flags int) (d
 	}
 
 	// Use unsafe to convert addr into a []byte.
-	var b []byte
+	b := unsafe.Slice((*byte)(unsafe.Pointer(addr)), length)
-	hdr := (*unsafeheader.Slice)(unsafe.Pointer(&b))
-	hdr.Data = unsafe.Pointer(addr)
-	hdr.Cap = length
-	hdr.Len = length
 
 	// Register mapping in m and return it.
 	p := &b[cap(b)-1]
@@ -338,8 +332,13 @@ func Recvfrom(fd int, p []byte, flags int) (n int, from Sockaddr, err error) {
 }
 
 func Recvmsg(fd int, p, oob []byte, flags int) (n, oobn int, recvflags int, from Sockaddr, err error) {
+	var iov [1]Iovec
+	if len(p) > 0 {
+		iov[0].Base = &p[0]
+		iov[0].SetLen(len(p))
+	}
 	var rsa RawSockaddrAny
-	n, oobn, recvflags, err = recvmsgRaw(fd, p, oob, flags, &rsa)
+	n, oobn, recvflags, err = recvmsgRaw(fd, iov[:], oob, flags, &rsa)
 	// source address is only specified if the socket is unconnected
 	if rsa.Addr.Family != AF_UNSPEC {
 		from, err = anyToSockaddr(fd, &rsa)
@@ -347,12 +346,42 @@ func Recvmsg(fd int, p, oob []byte, flags int) (n, oobn int, recvflags int, from
 	return
 }
 
+// RecvmsgBuffers receives a message from a socket using the recvmsg
+// system call. The flags are passed to recvmsg. Any non-control data
+// read is scattered into the buffers slices. The results are:
+//   - n is the number of non-control data read into bufs
+//   - oobn is the number of control data read into oob; this may be interpreted using [ParseSocketControlMessage]
+//   - recvflags is flags returned by recvmsg
+//   - from is the address of the sender
+func RecvmsgBuffers(fd int, buffers [][]byte, oob []byte, flags int) (n, oobn int, recvflags int, from Sockaddr, err error) {
+	iov := make([]Iovec, len(buffers))
+	for i := range buffers {
+		if len(buffers[i]) > 0 {
+			iov[i].Base = &buffers[i][0]
+			iov[i].SetLen(len(buffers[i]))
+		} else {
+			iov[i].Base = (*byte)(unsafe.Pointer(&_zero))
+		}
+	}
+	var rsa RawSockaddrAny
+	n, oobn, recvflags, err = recvmsgRaw(fd, iov, oob, flags, &rsa)
+	if err == nil && rsa.Addr.Family != AF_UNSPEC {
+		from, err = anyToSockaddr(fd, &rsa)
+	}
+	return
+}
+
 func Sendmsg(fd int, p, oob []byte, to Sockaddr, flags int) (err error) {
 	_, err = SendmsgN(fd, p, oob, to, flags)
 	return
 }
 
 func SendmsgN(fd int, p, oob []byte, to Sockaddr, flags int) (n int, err error) {
+	var iov [1]Iovec
+	if len(p) > 0 {
+		iov[0].Base = &p[0]
+		iov[0].SetLen(len(p))
+	}
 	var ptr unsafe.Pointer
 	var salen _Socklen
 	if to != nil {
@@ -361,7 +390,32 @@ func SendmsgN(fd int, p, oob []byte, to Sockaddr, flags int) (n int, err error)
 			return 0, err
 		}
 	}
-	return sendmsgN(fd, p, oob, ptr, salen, flags)
+	return sendmsgN(fd, iov[:], oob, ptr, salen, flags)
+}
+
+// SendmsgBuffers sends a message on a socket to an address using the sendmsg
+// system call. The flags are passed to sendmsg. Any non-control data written
+// is gathered from buffers. The function returns the number of bytes written
+// to the socket.
+func SendmsgBuffers(fd int, buffers [][]byte, oob []byte, to Sockaddr, flags int) (n int, err error) {
+	iov := make([]Iovec, len(buffers))
+	for i := range buffers {
+		if len(buffers[i]) > 0 {
+			iov[i].Base = &buffers[i][0]
+			iov[i].SetLen(len(buffers[i]))
+		} else {
+			iov[i].Base = (*byte)(unsafe.Pointer(&_zero))
+		}
+	}
+	var ptr unsafe.Pointer
+	var salen _Socklen
+	if to != nil {
+		ptr, salen, err = to.sockaddr()
+		if err != nil {
+			return 0, err
+		}
+	}
+	return sendmsgN(fd, iov, oob, ptr, salen, flags)
 }
 
 func Send(s int, buf []byte, flags int) (err error) {
@@ -484,3 +538,13 @@ func Lutimes(path string, tv []Timeval) error {
 	}
 	return UtimesNanoAt(AT_FDCWD, path, ts, AT_SYMLINK_NOFOLLOW)
 }
+
+// emptyIovec reports whether there are no bytes in the slice of Iovec.
+func emptyIovecs(iov []Iovec) bool {
+	for i := range iov {
+		if iov[i].Len > 0 {
+			return false
+		}
+	}
+	return true
+}

vendor/golang.org/x/sys/unix/sysvshm_unix.go

@@ -7,11 +7,7 @@
 
 package unix
 
-import (
+import "unsafe"
-	"unsafe"
-
-	"golang.org/x/sys/internal/unsafeheader"
-)
 
 // SysvShmAttach attaches the Sysv shared memory segment associated with the
 // shared memory identifier id.
@@ -34,12 +30,7 @@ func SysvShmAttach(id int, addr uintptr, flag int) ([]byte, error) {
 	}
 
 	// Use unsafe to convert addr into a []byte.
-	// TODO: convert to unsafe.Slice once we can assume Go 1.17
+	b := unsafe.Slice((*byte)(unsafe.Pointer(addr)), int(info.Segsz))
-	var b []byte
-	hdr := (*unsafeheader.Slice)(unsafe.Pointer(&b))
-	hdr.Data = unsafe.Pointer(addr)
-	hdr.Cap = int(info.Segsz)
-	hdr.Len = int(info.Segsz)
 	return b, nil
 }
 

vendor/golang.org/x/sys/unix/zerrors_freebsd_386.go

@@ -151,6 +151,7 @@ const (
 	BIOCSETF                       = 0x80084267
 	BIOCSETFNR                     = 0x80084282
 	BIOCSETIF                      = 0x8020426c
+	BIOCSETVLANPCP                 = 0x80044285
 	BIOCSETWF                      = 0x8008427b
 	BIOCSETZBUF                    = 0x800c4281
 	BIOCSHDRCMPLT                  = 0x80044275
@@ -447,7 +448,7 @@ const (
 	DLT_IEEE802_16_MAC_CPS_RADIO   = 0xc1
 	DLT_INFINIBAND                 = 0xf7
 	DLT_IPFILTER                   = 0x74
-	DLT_IPMB                       = 0xc7
+	DLT_IPMB_KONTRON               = 0xc7
 	DLT_IPMB_LINUX                 = 0xd1
 	DLT_IPMI_HPM_2                 = 0x104
 	DLT_IPNET                      = 0xe2
@@ -487,10 +488,11 @@ const (
 	DLT_LINUX_LAPD                 = 0xb1
 	DLT_LINUX_PPP_WITHDIRECTION    = 0xa6
 	DLT_LINUX_SLL                  = 0x71
+	DLT_LINUX_SLL2                 = 0x114
 	DLT_LOOP                       = 0x6c
 	DLT_LORATAP                    = 0x10e
 	DLT_LTALK                      = 0x72
-	DLT_MATCHING_MAX               = 0x113
+	DLT_MATCHING_MAX               = 0x114
 	DLT_MATCHING_MIN               = 0x68
 	DLT_MFR                        = 0xb6
 	DLT_MOST                       = 0xd3
@@ -734,6 +736,7 @@ const (
 	IPPROTO_CMTP                   = 0x26
 	IPPROTO_CPHB                   = 0x49
 	IPPROTO_CPNX                   = 0x48
+	IPPROTO_DCCP                   = 0x21
 	IPPROTO_DDP                    = 0x25
 	IPPROTO_DGP                    = 0x56
 	IPPROTO_DIVERT                 = 0x102
@@ -814,7 +817,6 @@ const (
 	IPPROTO_SCTP                   = 0x84
 	IPPROTO_SDRP                   = 0x2a
 	IPPROTO_SEND                   = 0x103
-	IPPROTO_SEP                    = 0x21
 	IPPROTO_SHIM6                  = 0x8c
 	IPPROTO_SKIP                   = 0x39
 	IPPROTO_SPACER                 = 0x7fff
@@ -911,6 +913,7 @@ const (
 	IPV6_V6ONLY                    = 0x1b
 	IPV6_VERSION                   = 0x60
 	IPV6_VERSION_MASK              = 0xf0
+	IPV6_VLAN_PCP                  = 0x4b
 	IP_ADD_MEMBERSHIP              = 0xc
 	IP_ADD_SOURCE_MEMBERSHIP       = 0x46
 	IP_BINDANY                     = 0x18
@@ -989,8 +992,12 @@ const (
 	IP_TOS                         = 0x3
 	IP_TTL                         = 0x4
 	IP_UNBLOCK_SOURCE              = 0x49
+	IP_VLAN_PCP                    = 0x4b
 	ISIG                           = 0x80
 	ISTRIP                         = 0x20
+	ITIMER_PROF                    = 0x2
+	ITIMER_REAL                    = 0x0
+	ITIMER_VIRTUAL                 = 0x1
 	IXANY                          = 0x800
 	IXOFF                          = 0x400
 	IXON                           = 0x200
@@ -1000,7 +1007,6 @@ const (
 	KERN_VERSION                   = 0x4
 	LOCAL_CONNWAIT                 = 0x4
 	LOCAL_CREDS                    = 0x2
-	LOCAL_CREDS_PERSISTENT         = 0x3
 	LOCAL_PEERCRED                 = 0x1
 	LOCAL_VENDOR                   = 0x80000000
 	LOCK_EX                        = 0x2
@@ -1179,6 +1185,8 @@ const (
 	O_NONBLOCK                     = 0x4
 	O_RDONLY                       = 0x0
 	O_RDWR                         = 0x2
+	O_RESOLVE_BENEATH              = 0x800000
+	O_SEARCH                       = 0x40000
 	O_SHLOCK                       = 0x10
 	O_SYNC                         = 0x80
 	O_TRUNC                        = 0x400
@@ -1189,6 +1197,10 @@ const (
 	PARMRK                         = 0x8
 	PARODD                         = 0x2000
 	PENDIN                         = 0x20000000
+	PIOD_READ_D                    = 0x1
+	PIOD_READ_I                    = 0x3
+	PIOD_WRITE_D                   = 0x2
+	PIOD_WRITE_I                   = 0x4
 	PRIO_PGRP                      = 0x1
 	PRIO_PROCESS                   = 0x0
 	PRIO_USER                      = 0x2
@@ -1196,6 +1208,60 @@ const (
 	PROT_NONE                      = 0x0
 	PROT_READ                      = 0x1
 	PROT_WRITE                     = 0x2
+	PTRACE_DEFAULT                 = 0x1
+	PTRACE_EXEC                    = 0x1
+	PTRACE_FORK                    = 0x8
+	PTRACE_LWP                     = 0x10
+	PTRACE_SCE                     = 0x2
+	PTRACE_SCX                     = 0x4
+	PTRACE_SYSCALL                 = 0x6
+	PTRACE_VFORK                   = 0x20
+	PT_ATTACH                      = 0xa
+	PT_CLEARSTEP                   = 0x10
+	PT_CONTINUE                    = 0x7
+	PT_DETACH                      = 0xb
+	PT_FIRSTMACH                   = 0x40
+	PT_FOLLOW_FORK                 = 0x17
+	PT_GETDBREGS                   = 0x25
+	PT_GETFPREGS                   = 0x23
+	PT_GETFSBASE                   = 0x47
+	PT_GETGSBASE                   = 0x49
+	PT_GETLWPLIST                  = 0xf
+	PT_GETNUMLWPS                  = 0xe
+	PT_GETREGS                     = 0x21
+	PT_GETXMMREGS                  = 0x40
+	PT_GETXSTATE                   = 0x45
+	PT_GETXSTATE_INFO              = 0x44
+	PT_GET_EVENT_MASK              = 0x19
+	PT_GET_SC_ARGS                 = 0x1b
+	PT_GET_SC_RET                  = 0x1c
+	PT_IO                          = 0xc
+	PT_KILL                        = 0x8
+	PT_LWPINFO                     = 0xd
+	PT_LWP_EVENTS                  = 0x18
+	PT_READ_D                      = 0x2
+	PT_READ_I                      = 0x1
+	PT_RESUME                      = 0x13
+	PT_SETDBREGS                   = 0x26
+	PT_SETFPREGS                   = 0x24
+	PT_SETFSBASE                   = 0x48
+	PT_SETGSBASE                   = 0x4a
+	PT_SETREGS                     = 0x22
+	PT_SETSTEP                     = 0x11
+	PT_SETXMMREGS                  = 0x41
+	PT_SETXSTATE                   = 0x46
+	PT_SET_EVENT_MASK              = 0x1a
+	PT_STEP                        = 0x9
+	PT_SUSPEND                     = 0x12
+	PT_SYSCALL                     = 0x16
+	PT_TO_SCE                      = 0x14
+	PT_TO_SCX                      = 0x15
+	PT_TRACE_ME                    = 0x0
+	PT_VM_ENTRY                    = 0x29
+	PT_VM_TIMESTAMP                = 0x28
+	PT_WRITE_D                     = 0x5
+	PT_WRITE_I                     = 0x4
+	P_ZONEID                       = 0xc
 	RLIMIT_AS                      = 0xa
 	RLIMIT_CORE                    = 0x4
 	RLIMIT_CPU                     = 0x0
@@ -1320,10 +1386,12 @@ const (
 	SIOCGHWADDR                    = 0xc020693e
 	SIOCGI2C                       = 0xc020693d
 	SIOCGIFADDR                    = 0xc0206921
+	SIOCGIFALIAS                   = 0xc044692d
 	SIOCGIFBRDADDR                 = 0xc0206923
 	SIOCGIFCAP                     = 0xc020691f
 	SIOCGIFCONF                    = 0xc0086924
 	SIOCGIFDESCR                   = 0xc020692a
+	SIOCGIFDOWNREASON              = 0xc058699a
 	SIOCGIFDSTADDR                 = 0xc0206922
 	SIOCGIFFIB                     = 0xc020695c
 	SIOCGIFFLAGS                   = 0xc0206911
@@ -1414,6 +1482,7 @@ const (
 	SO_RCVBUF                      = 0x1002
 	SO_RCVLOWAT                    = 0x1004
 	SO_RCVTIMEO                    = 0x1006
+	SO_RERROR                      = 0x20000
 	SO_REUSEADDR                   = 0x4
 	SO_REUSEPORT                   = 0x200
 	SO_REUSEPORT_LB                = 0x10000
@@ -1472,22 +1541,40 @@ const (
 	TCOFLUSH                       = 0x2
 	TCOOFF                         = 0x1
 	TCOON                          = 0x2
+	TCPOPT_EOL                     = 0x0
+	TCPOPT_FAST_OPEN               = 0x22
+	TCPOPT_MAXSEG                  = 0x2
+	TCPOPT_NOP                     = 0x1
+	TCPOPT_PAD                     = 0x0
+	TCPOPT_SACK                    = 0x5
+	TCPOPT_SACK_PERMITTED          = 0x4
+	TCPOPT_SIGNATURE               = 0x13
+	TCPOPT_TIMESTAMP               = 0x8
+	TCPOPT_WINDOW                  = 0x3
 	TCP_BBR_ACK_COMP_ALG           = 0x448
+	TCP_BBR_ALGORITHM              = 0x43b
 	TCP_BBR_DRAIN_INC_EXTRA        = 0x43c
 	TCP_BBR_DRAIN_PG               = 0x42e
 	TCP_BBR_EXTRA_GAIN             = 0x449
+	TCP_BBR_EXTRA_STATE            = 0x453
+	TCP_BBR_FLOOR_MIN_TSO          = 0x454
+	TCP_BBR_HDWR_PACE              = 0x451
+	TCP_BBR_HOLD_TARGET            = 0x436
 	TCP_BBR_IWINTSO                = 0x42b
 	TCP_BBR_LOWGAIN_FD             = 0x436
 	TCP_BBR_LOWGAIN_HALF           = 0x435
 	TCP_BBR_LOWGAIN_THRESH         = 0x434
 	TCP_BBR_MAX_RTO                = 0x439
 	TCP_BBR_MIN_RTO                = 0x438
+	TCP_BBR_MIN_TOPACEOUT          = 0x455
 	TCP_BBR_ONE_RETRAN             = 0x431
 	TCP_BBR_PACE_CROSS             = 0x442
 	TCP_BBR_PACE_DEL_TAR           = 0x43f
+	TCP_BBR_PACE_OH                = 0x435
 	TCP_BBR_PACE_PER_SEC           = 0x43e
 	TCP_BBR_PACE_SEG_MAX           = 0x440
 	TCP_BBR_PACE_SEG_MIN           = 0x441
+	TCP_BBR_POLICER_DETECT         = 0x457
 	TCP_BBR_PROBE_RTT_GAIN         = 0x44d
 	TCP_BBR_PROBE_RTT_INT          = 0x430
 	TCP_BBR_PROBE_RTT_LEN          = 0x44e
@@ -1496,12 +1583,18 @@ const (
 	TCP_BBR_REC_OVER_HPTS          = 0x43a
 	TCP_BBR_RETRAN_WTSO            = 0x44b
 	TCP_BBR_RWND_IS_APP            = 0x42f
+	TCP_BBR_SEND_IWND_IN_TSO       = 0x44f
 	TCP_BBR_STARTUP_EXIT_EPOCH     = 0x43d
 	TCP_BBR_STARTUP_LOSS_EXIT      = 0x432
 	TCP_BBR_STARTUP_PG             = 0x42d
+	TCP_BBR_TMR_PACE_OH            = 0x448
+	TCP_BBR_TSLIMITS               = 0x434
+	TCP_BBR_TSTMP_RAISES           = 0x456
 	TCP_BBR_UNLIMITED              = 0x43b
 	TCP_BBR_USEDEL_RATE            = 0x437
 	TCP_BBR_USE_LOWGAIN            = 0x433
+	TCP_BBR_USE_RACK_CHEAT         = 0x450
+	TCP_BBR_UTTER_MAX_TSO          = 0x452
 	TCP_CA_NAME_MAX                = 0x10
 	TCP_CCALGOOPT                  = 0x41
 	TCP_CONGESTION                 = 0x40
@@ -1541,6 +1634,7 @@ const (
 	TCP_PCAP_OUT                   = 0x800
 	TCP_RACK_EARLY_RECOV           = 0x423
 	TCP_RACK_EARLY_SEG             = 0x424
+	TCP_RACK_GP_INCREASE           = 0x446
 	TCP_RACK_IDLE_REDUCE_HIGH      = 0x444
 	TCP_RACK_MIN_PACE              = 0x445
 	TCP_RACK_MIN_PACE_SEG          = 0x446
@@ -1554,7 +1648,6 @@ const (
 	TCP_RACK_PRR_SENDALOT          = 0x421
 	TCP_RACK_REORD_FADE            = 0x426
 	TCP_RACK_REORD_THRESH          = 0x425
-	TCP_RACK_SESS_CWV              = 0x42a
 	TCP_RACK_TLP_INC_VAR           = 0x429
 	TCP_RACK_TLP_REDUCE            = 0x41c
 	TCP_RACK_TLP_THRESH            = 0x427
@@ -1694,12 +1787,13 @@ const (
 	EIDRM           = syscall.Errno(0x52)
 	EILSEQ          = syscall.Errno(0x56)
 	EINPROGRESS     = syscall.Errno(0x24)
+	EINTEGRITY      = syscall.Errno(0x61)
 	EINTR           = syscall.Errno(0x4)
 	EINVAL          = syscall.Errno(0x16)
 	EIO             = syscall.Errno(0x5)
 	EISCONN         = syscall.Errno(0x38)
 	EISDIR          = syscall.Errno(0x15)
-	ELAST           = syscall.Errno(0x60)
+	ELAST           = syscall.Errno(0x61)
 	ELOOP           = syscall.Errno(0x3e)
 	EMFILE          = syscall.Errno(0x18)
 	EMLINK          = syscall.Errno(0x1f)
@@ -1842,7 +1936,7 @@ var errorList = [...]struct {
 	{32, "EPIPE", "broken pipe"},
 	{33, "EDOM", "numerical argument out of domain"},
 	{34, "ERANGE", "result too large"},
-	{35, "EAGAIN", "resource temporarily unavailable"},
+	{35, "EWOULDBLOCK", "resource temporarily unavailable"},
 	{36, "EINPROGRESS", "operation now in progress"},
 	{37, "EALREADY", "operation already in progress"},
 	{38, "ENOTSOCK", "socket operation on non-socket"},
@@ -1904,6 +1998,7 @@ var errorList = [...]struct {
 	{94, "ECAPMODE", "not permitted in capability mode"},
 	{95, "ENOTRECOVERABLE", "state not recoverable"},
 	{96, "EOWNERDEAD", "previous owner died"},
+	{97, "EINTEGRITY", "integrity check failed"},
 }
 
 // Signal table

vendor/golang.org/x/sys/unix/zerrors_freebsd_amd64.go

@@ -151,6 +151,7 @@ const (
 	BIOCSETF                       = 0x80104267
 	BIOCSETFNR                     = 0x80104282
 	BIOCSETIF                      = 0x8020426c
+	BIOCSETVLANPCP                 = 0x80044285
 	BIOCSETWF                      = 0x8010427b
 	BIOCSETZBUF                    = 0x80184281
 	BIOCSHDRCMPLT                  = 0x80044275
@@ -447,7 +448,7 @@ const (
 	DLT_IEEE802_16_MAC_CPS_RADIO   = 0xc1
 	DLT_INFINIBAND                 = 0xf7
 	DLT_IPFILTER                   = 0x74
-	DLT_IPMB                       = 0xc7
+	DLT_IPMB_KONTRON               = 0xc7
 	DLT_IPMB_LINUX                 = 0xd1
 	DLT_IPMI_HPM_2                 = 0x104
 	DLT_IPNET                      = 0xe2
@@ -487,10 +488,11 @@ const (
 	DLT_LINUX_LAPD                 = 0xb1
 	DLT_LINUX_PPP_WITHDIRECTION    = 0xa6
 	DLT_LINUX_SLL                  = 0x71
+	DLT_LINUX_SLL2                 = 0x114
 	DLT_LOOP                       = 0x6c
 	DLT_LORATAP                    = 0x10e
 	DLT_LTALK                      = 0x72
-	DLT_MATCHING_MAX               = 0x113
+	DLT_MATCHING_MAX               = 0x114
 	DLT_MATCHING_MIN               = 0x68
 	DLT_MFR                        = 0xb6
 	DLT_MOST                       = 0xd3
@@ -734,6 +736,7 @@ const (
 	IPPROTO_CMTP                   = 0x26
 	IPPROTO_CPHB                   = 0x49
 	IPPROTO_CPNX                   = 0x48
+	IPPROTO_DCCP                   = 0x21
 	IPPROTO_DDP                    = 0x25
 	IPPROTO_DGP                    = 0x56
 	IPPROTO_DIVERT                 = 0x102
@@ -814,7 +817,6 @@ const (
 	IPPROTO_SCTP                   = 0x84
 	IPPROTO_SDRP                   = 0x2a
 	IPPROTO_SEND                   = 0x103
-	IPPROTO_SEP                    = 0x21
 	IPPROTO_SHIM6                  = 0x8c
 	IPPROTO_SKIP                   = 0x39
 	IPPROTO_SPACER                 = 0x7fff
@@ -911,6 +913,7 @@ const (
 	IPV6_V6ONLY                    = 0x1b
 	IPV6_VERSION                   = 0x60
 	IPV6_VERSION_MASK              = 0xf0
+	IPV6_VLAN_PCP                  = 0x4b
 	IP_ADD_MEMBERSHIP              = 0xc
 	IP_ADD_SOURCE_MEMBERSHIP       = 0x46
 	IP_BINDANY                     = 0x18
@@ -989,8 +992,12 @@ const (
 	IP_TOS                         = 0x3
 	IP_TTL                         = 0x4
 	IP_UNBLOCK_SOURCE              = 0x49
+	IP_VLAN_PCP                    = 0x4b
 	ISIG                           = 0x80
 	ISTRIP                         = 0x20
+	ITIMER_PROF                    = 0x2
+	ITIMER_REAL                    = 0x0
+	ITIMER_VIRTUAL                 = 0x1
 	IXANY                          = 0x800
 	IXOFF                          = 0x400
 	IXON                           = 0x200
@@ -1000,7 +1007,6 @@ const (
 	KERN_VERSION                   = 0x4
 	LOCAL_CONNWAIT                 = 0x4
 	LOCAL_CREDS                    = 0x2
-	LOCAL_CREDS_PERSISTENT         = 0x3
 	LOCAL_PEERCRED                 = 0x1
 	LOCAL_VENDOR                   = 0x80000000
 	LOCK_EX                        = 0x2
@@ -1180,6 +1186,8 @@ const (
 	O_NONBLOCK                     = 0x4
 	O_RDONLY                       = 0x0
 	O_RDWR                         = 0x2
+	O_RESOLVE_BENEATH              = 0x800000
+	O_SEARCH                       = 0x40000
 	O_SHLOCK                       = 0x10
 	O_SYNC                         = 0x80
 	O_TRUNC                        = 0x400
@@ -1190,6 +1198,10 @@ const (
 	PARMRK                         = 0x8
 	PARODD                         = 0x2000
 	PENDIN                         = 0x20000000
+	PIOD_READ_D                    = 0x1
+	PIOD_READ_I                    = 0x3
+	PIOD_WRITE_D                   = 0x2
+	PIOD_WRITE_I                   = 0x4
 	PRIO_PGRP                      = 0x1
 	PRIO_PROCESS                   = 0x0
 	PRIO_USER                      = 0x2
@@ -1197,6 +1209,58 @@ const (
 	PROT_NONE                      = 0x0
 	PROT_READ                      = 0x1
 	PROT_WRITE                     = 0x2
+	PTRACE_DEFAULT                 = 0x1
+	PTRACE_EXEC                    = 0x1
+	PTRACE_FORK                    = 0x8
+	PTRACE_LWP                     = 0x10
+	PTRACE_SCE                     = 0x2
+	PTRACE_SCX                     = 0x4
+	PTRACE_SYSCALL                 = 0x6
+	PTRACE_VFORK                   = 0x20
+	PT_ATTACH                      = 0xa
+	PT_CLEARSTEP                   = 0x10
+	PT_CONTINUE                    = 0x7
+	PT_DETACH                      = 0xb
+	PT_FIRSTMACH                   = 0x40
+	PT_FOLLOW_FORK                 = 0x17
+	PT_GETDBREGS                   = 0x25
+	PT_GETFPREGS                   = 0x23
+	PT_GETFSBASE                   = 0x47
+	PT_GETGSBASE                   = 0x49
+	PT_GETLWPLIST                  = 0xf
+	PT_GETNUMLWPS                  = 0xe
+	PT_GETREGS                     = 0x21
+	PT_GETXSTATE                   = 0x45
+	PT_GETXSTATE_INFO              = 0x44
+	PT_GET_EVENT_MASK              = 0x19
+	PT_GET_SC_ARGS                 = 0x1b
+	PT_GET_SC_RET                  = 0x1c
+	PT_IO                          = 0xc
+	PT_KILL                        = 0x8
+	PT_LWPINFO                     = 0xd
+	PT_LWP_EVENTS                  = 0x18
+	PT_READ_D                      = 0x2
+	PT_READ_I                      = 0x1
+	PT_RESUME                      = 0x13
+	PT_SETDBREGS                   = 0x26
+	PT_SETFPREGS                   = 0x24
+	PT_SETFSBASE                   = 0x48
+	PT_SETGSBASE                   = 0x4a
+	PT_SETREGS                     = 0x22
+	PT_SETSTEP                     = 0x11
+	PT_SETXSTATE                   = 0x46
+	PT_SET_EVENT_MASK              = 0x1a
+	PT_STEP                        = 0x9
+	PT_SUSPEND                     = 0x12
+	PT_SYSCALL                     = 0x16
+	PT_TO_SCE                      = 0x14
+	PT_TO_SCX                      = 0x15
+	PT_TRACE_ME                    = 0x0
+	PT_VM_ENTRY                    = 0x29
+	PT_VM_TIMESTAMP                = 0x28
+	PT_WRITE_D                     = 0x5
+	PT_WRITE_I                     = 0x4
+	P_ZONEID                       = 0xc
 	RLIMIT_AS                      = 0xa
 	RLIMIT_CORE                    = 0x4
 	RLIMIT_CPU                     = 0x0
@@ -1321,10 +1385,12 @@ const (
 	SIOCGHWADDR                    = 0xc020693e
 	SIOCGI2C                       = 0xc020693d
 	SIOCGIFADDR                    = 0xc0206921
+	SIOCGIFALIAS                   = 0xc044692d
 	SIOCGIFBRDADDR                 = 0xc0206923
 	SIOCGIFCAP                     = 0xc020691f
 	SIOCGIFCONF                    = 0xc0106924
 	SIOCGIFDESCR                   = 0xc020692a
+	SIOCGIFDOWNREASON              = 0xc058699a
 	SIOCGIFDSTADDR                 = 0xc0206922
 	SIOCGIFFIB                     = 0xc020695c
 	SIOCGIFFLAGS                   = 0xc0206911
@@ -1415,6 +1481,7 @@ const (
 	SO_RCVBUF                      = 0x1002
 	SO_RCVLOWAT                    = 0x1004
 	SO_RCVTIMEO                    = 0x1006
+	SO_RERROR                      = 0x20000
 	SO_REUSEADDR                   = 0x4
 	SO_REUSEPORT                   = 0x200
 	SO_REUSEPORT_LB                = 0x10000
@@ -1473,22 +1540,40 @@ const (
 	TCOFLUSH                       = 0x2
 	TCOOFF                         = 0x1
 	TCOON                          = 0x2
+	TCPOPT_EOL                     = 0x0
+	TCPOPT_FAST_OPEN               = 0x22
+	TCPOPT_MAXSEG                  = 0x2
+	TCPOPT_NOP                     = 0x1
+	TCPOPT_PAD                     = 0x0
+	TCPOPT_SACK                    = 0x5
+	TCPOPT_SACK_PERMITTED          = 0x4
+	TCPOPT_SIGNATURE               = 0x13
+	TCPOPT_TIMESTAMP               = 0x8
+	TCPOPT_WINDOW                  = 0x3
 	TCP_BBR_ACK_COMP_ALG           = 0x448
+	TCP_BBR_ALGORITHM              = 0x43b
 	TCP_BBR_DRAIN_INC_EXTRA        = 0x43c
 	TCP_BBR_DRAIN_PG               = 0x42e
 	TCP_BBR_EXTRA_GAIN             = 0x449
+	TCP_BBR_EXTRA_STATE            = 0x453
+	TCP_BBR_FLOOR_MIN_TSO          = 0x454
+	TCP_BBR_HDWR_PACE              = 0x451
+	TCP_BBR_HOLD_TARGET            = 0x436
 	TCP_BBR_IWINTSO                = 0x42b
 	TCP_BBR_LOWGAIN_FD             = 0x436
 	TCP_BBR_LOWGAIN_HALF           = 0x435
 	TCP_BBR_LOWGAIN_THRESH         = 0x434
 	TCP_BBR_MAX_RTO                = 0x439
 	TCP_BBR_MIN_RTO                = 0x438
+	TCP_BBR_MIN_TOPACEOUT          = 0x455
 	TCP_BBR_ONE_RETRAN             = 0x431
 	TCP_BBR_PACE_CROSS             = 0x442
 	TCP_BBR_PACE_DEL_TAR           = 0x43f
+	TCP_BBR_PACE_OH                = 0x435
 	TCP_BBR_PACE_PER_SEC           = 0x43e
 	TCP_BBR_PACE_SEG_MAX           = 0x440
 	TCP_BBR_PACE_SEG_MIN           = 0x441
+	TCP_BBR_POLICER_DETECT         = 0x457
 	TCP_BBR_PROBE_RTT_GAIN         = 0x44d
 	TCP_BBR_PROBE_RTT_INT          = 0x430
 	TCP_BBR_PROBE_RTT_LEN          = 0x44e
@@ -1497,12 +1582,18 @@ const (
 	TCP_BBR_REC_OVER_HPTS          = 0x43a
 	TCP_BBR_RETRAN_WTSO            = 0x44b
 	TCP_BBR_RWND_IS_APP            = 0x42f
+	TCP_BBR_SEND_IWND_IN_TSO       = 0x44f
 	TCP_BBR_STARTUP_EXIT_EPOCH     = 0x43d
 	TCP_BBR_STARTUP_LOSS_EXIT      = 0x432
 	TCP_BBR_STARTUP_PG             = 0x42d
+	TCP_BBR_TMR_PACE_OH            = 0x448
+	TCP_BBR_TSLIMITS               = 0x434
+	TCP_BBR_TSTMP_RAISES           = 0x456
 	TCP_BBR_UNLIMITED              = 0x43b
 	TCP_BBR_USEDEL_RATE            = 0x437
 	TCP_BBR_USE_LOWGAIN            = 0x433
+	TCP_BBR_USE_RACK_CHEAT         = 0x450
+	TCP_BBR_UTTER_MAX_TSO          = 0x452
 	TCP_CA_NAME_MAX                = 0x10
 	TCP_CCALGOOPT                  = 0x41
 	TCP_CONGESTION                 = 0x40
@@ -1542,6 +1633,7 @@ const (
 	TCP_PCAP_OUT                   = 0x800
 	TCP_RACK_EARLY_RECOV           = 0x423
 	TCP_RACK_EARLY_SEG             = 0x424
+	TCP_RACK_GP_INCREASE           = 0x446
 	TCP_RACK_IDLE_REDUCE_HIGH      = 0x444
 	TCP_RACK_MIN_PACE              = 0x445
 	TCP_RACK_MIN_PACE_SEG          = 0x446
@@ -1555,7 +1647,6 @@ const (
 	TCP_RACK_PRR_SENDALOT          = 0x421
 	TCP_RACK_REORD_FADE            = 0x426
 	TCP_RACK_REORD_THRESH          = 0x425
-	TCP_RACK_SESS_CWV              = 0x42a
 	TCP_RACK_TLP_INC_VAR           = 0x429
 	TCP_RACK_TLP_REDUCE            = 0x41c
 	TCP_RACK_TLP_THRESH            = 0x427
@@ -1693,12 +1784,13 @@ const (
 	EIDRM           = syscall.Errno(0x52)
 	EILSEQ          = syscall.Errno(0x56)
 	EINPROGRESS     = syscall.Errno(0x24)
+	EINTEGRITY      = syscall.Errno(0x61)
 	EINTR           = syscall.Errno(0x4)
 	EINVAL          = syscall.Errno(0x16)
 	EIO             = syscall.Errno(0x5)
 	EISCONN         = syscall.Errno(0x38)
 	EISDIR          = syscall.Errno(0x15)
-	ELAST           = syscall.Errno(0x60)
+	ELAST           = syscall.Errno(0x61)
 	ELOOP           = syscall.Errno(0x3e)
 	EMFILE          = syscall.Errno(0x18)
 	EMLINK          = syscall.Errno(0x1f)
@@ -1841,7 +1933,7 @@ var errorList = [...]struct {
 	{32, "EPIPE", "broken pipe"},
 	{33, "EDOM", "numerical argument out of domain"},
 	{34, "ERANGE", "result too large"},
-	{35, "EAGAIN", "resource temporarily unavailable"},
+	{35, "EWOULDBLOCK", "resource temporarily unavailable"},
 	{36, "EINPROGRESS", "operation now in progress"},
 	{37, "EALREADY", "operation already in progress"},
 	{38, "ENOTSOCK", "socket operation on non-socket"},
@@ -1903,6 +1995,7 @@ var errorList = [...]struct {
 	{94, "ECAPMODE", "not permitted in capability mode"},
 	{95, "ENOTRECOVERABLE", "state not recoverable"},
 	{96, "EOWNERDEAD", "previous owner died"},
+	{97, "EINTEGRITY", "integrity check failed"},
 }
 
 // Signal table

vendor/golang.org/x/sys/unix/zerrors_freebsd_arm.go

@@ -151,6 +151,7 @@ const (
 	BIOCSETF                       = 0x80084267
 	BIOCSETFNR                     = 0x80084282
 	BIOCSETIF                      = 0x8020426c
+	BIOCSETVLANPCP                 = 0x80044285
 	BIOCSETWF                      = 0x8008427b
 	BIOCSETZBUF                    = 0x800c4281
 	BIOCSHDRCMPLT                  = 0x80044275
@@ -362,7 +363,7 @@ const (
 	CTL_KERN                       = 0x1
 	CTL_MAXNAME                    = 0x18
 	CTL_NET                        = 0x4
-	DIOCGATTR                      = 0xc144648e
+	DIOCGATTR                      = 0xc148648e
 	DIOCGDELETE                    = 0x80106488
 	DIOCGFLUSH                     = 0x20006487
 	DIOCGFRONTSTUFF                = 0x40086486
@@ -377,7 +378,7 @@ const (
 	DIOCGSTRIPESIZE                = 0x4008648b
 	DIOCSKERNELDUMP                = 0x804c6490
 	DIOCSKERNELDUMP_FREEBSD11      = 0x80046485
-	DIOCZONECMD                    = 0xc06c648f
+	DIOCZONECMD                    = 0xc078648f
 	DLT_A429                       = 0xb8
 	DLT_A653_ICM                   = 0xb9
 	DLT_AIRONET_HEADER             = 0x78
@@ -407,7 +408,9 @@ const (
 	DLT_C_HDLC_WITH_DIR            = 0xcd
 	DLT_DBUS                       = 0xe7
 	DLT_DECT                       = 0xdd
+	DLT_DISPLAYPORT_AUX            = 0x113
 	DLT_DOCSIS                     = 0x8f
+	DLT_DOCSIS31_XRA31             = 0x111
 	DLT_DVB_CI                     = 0xeb
 	DLT_ECONET                     = 0x73
 	DLT_EN10MB                     = 0x1
@@ -417,6 +420,7 @@ const (
 	DLT_ERF                        = 0xc5
 	DLT_ERF_ETH                    = 0xaf
 	DLT_ERF_POS                    = 0xb0
+	DLT_ETHERNET_MPACKET           = 0x112
 	DLT_FC_2                       = 0xe0
 	DLT_FC_2_WITH_FRAME_DELIMS     = 0xe1
 	DLT_FDDI                       = 0xa
@@ -444,7 +448,7 @@ const (
 	DLT_IEEE802_16_MAC_CPS_RADIO   = 0xc1
 	DLT_INFINIBAND                 = 0xf7
 	DLT_IPFILTER                   = 0x74
-	DLT_IPMB                       = 0xc7
+	DLT_IPMB_KONTRON               = 0xc7
 	DLT_IPMB_LINUX                 = 0xd1
 	DLT_IPMI_HPM_2                 = 0x104
 	DLT_IPNET                      = 0xe2
@@ -484,9 +488,11 @@ const (
 	DLT_LINUX_LAPD                 = 0xb1
 	DLT_LINUX_PPP_WITHDIRECTION    = 0xa6
 	DLT_LINUX_SLL                  = 0x71
+	DLT_LINUX_SLL2                 = 0x114
 	DLT_LOOP                       = 0x6c
+	DLT_LORATAP                    = 0x10e
 	DLT_LTALK                      = 0x72
-	DLT_MATCHING_MAX               = 0x109
+	DLT_MATCHING_MAX               = 0x114
 	DLT_MATCHING_MIN               = 0x68
 	DLT_MFR                        = 0xb6
 	DLT_MOST                       = 0xd3
@@ -502,7 +508,9 @@ const (
 	DLT_NFC_LLCP                   = 0xf5
 	DLT_NFLOG                      = 0xef
 	DLT_NG40                       = 0xf4
+	DLT_NORDIC_BLE                 = 0x110
 	DLT_NULL                       = 0x0
+	DLT_OPENFLOW                   = 0x10b
 	DLT_PCI_EXP                    = 0x7d
 	DLT_PFLOG                      = 0x75
 	DLT_PFSYNC                     = 0x79
@@ -526,15 +534,18 @@ const (
 	DLT_RTAC_SERIAL                = 0xfa
 	DLT_SCCP                       = 0x8e
 	DLT_SCTP                       = 0xf8
+	DLT_SDLC                       = 0x10c
 	DLT_SITA                       = 0xc4
 	DLT_SLIP                       = 0x8
 	DLT_SLIP_BSDOS                 = 0xd
 	DLT_STANAG_5066_D_PDU          = 0xed
 	DLT_SUNATM                     = 0x7b
 	DLT_SYMANTEC_FIREWALL          = 0x63
+	DLT_TI_LLN_SNIFFER             = 0x10d
 	DLT_TZSP                       = 0x80
 	DLT_USB                        = 0xba
 	DLT_USBPCAP                    = 0xf9
+	DLT_USB_DARWIN                 = 0x10a
 	DLT_USB_FREEBSD                = 0xba
 	DLT_USB_LINUX                  = 0xbd
 	DLT_USB_LINUX_MMAPPED          = 0xdc
@@ -554,6 +565,7 @@ const (
 	DLT_USER7                      = 0x9a
 	DLT_USER8                      = 0x9b
 	DLT_USER9                      = 0x9c
+	DLT_VSOCK                      = 0x10f
 	DLT_WATTSTOPPER_DLM            = 0x107
 	DLT_WIHART                     = 0xdf
 	DLT_WIRESHARK_UPPER_PDU        = 0xfc
@@ -578,6 +590,7 @@ const (
 	ECHONL                         = 0x10
 	ECHOPRT                        = 0x20
 	EVFILT_AIO                     = -0x3
+	EVFILT_EMPTY                   = -0xd
 	EVFILT_FS                      = -0x9
 	EVFILT_LIO                     = -0xa
 	EVFILT_PROC                    = -0x5
@@ -585,11 +598,12 @@ const (
 	EVFILT_READ                    = -0x1
 	EVFILT_SENDFILE                = -0xc
 	EVFILT_SIGNAL                  = -0x6
-	EVFILT_SYSCOUNT                = 0xc
+	EVFILT_SYSCOUNT                = 0xd
 	EVFILT_TIMER                   = -0x7
 	EVFILT_USER                    = -0xb
 	EVFILT_VNODE                   = -0x4
 	EVFILT_WRITE                   = -0x2
+	EVNAMEMAP_NAME_SIZE            = 0x40
 	EV_ADD                         = 0x1
 	EV_CLEAR                       = 0x20
 	EV_DELETE                      = 0x2
@@ -606,6 +620,7 @@ const (
 	EV_RECEIPT                     = 0x40
 	EV_SYSFLAGS                    = 0xf000
 	EXTA                           = 0x4b00
+	EXTATTR_MAXNAMELEN             = 0xff
 	EXTATTR_NAMESPACE_EMPTY        = 0x0
 	EXTATTR_NAMESPACE_SYSTEM       = 0x2
 	EXTATTR_NAMESPACE_USER         = 0x1
@@ -647,6 +662,7 @@ const (
 	IEXTEN                         = 0x400
 	IFAN_ARRIVAL                   = 0x0
 	IFAN_DEPARTURE                 = 0x1
+	IFCAP_WOL_MAGIC                = 0x2000
 	IFF_ALLMULTI                   = 0x200
 	IFF_ALTPHYS                    = 0x4000
 	IFF_BROADCAST                  = 0x2
@@ -663,6 +679,7 @@ const (
 	IFF_MONITOR                    = 0x40000
 	IFF_MULTICAST                  = 0x8000
 	IFF_NOARP                      = 0x80
+	IFF_NOGROUP                    = 0x800000
 	IFF_OACTIVE                    = 0x400
 	IFF_POINTOPOINT                = 0x10
 	IFF_PPROMISC                   = 0x20000
@@ -719,6 +736,7 @@ const (
 	IPPROTO_CMTP                   = 0x26
 	IPPROTO_CPHB                   = 0x49
 	IPPROTO_CPNX                   = 0x48
+	IPPROTO_DCCP                   = 0x21
 	IPPROTO_DDP                    = 0x25
 	IPPROTO_DGP                    = 0x56
 	IPPROTO_DIVERT                 = 0x102
@@ -799,7 +817,6 @@ const (
 	IPPROTO_SCTP                   = 0x84
 	IPPROTO_SDRP                   = 0x2a
 	IPPROTO_SEND                   = 0x103
-	IPPROTO_SEP                    = 0x21
 	IPPROTO_SHIM6                  = 0x8c
 	IPPROTO_SKIP                   = 0x39
 	IPPROTO_SPACER                 = 0x7fff
@@ -837,6 +854,7 @@ const (
 	IPV6_DSTOPTS                   = 0x32
 	IPV6_FLOWID                    = 0x43
 	IPV6_FLOWINFO_MASK             = 0xffffff0f
+	IPV6_FLOWLABEL_LEN             = 0x14
 	IPV6_FLOWLABEL_MASK            = 0xffff0f00
 	IPV6_FLOWTYPE                  = 0x44
 	IPV6_FRAGTTL                   = 0x78
@@ -857,13 +875,13 @@ const (
 	IPV6_MAX_GROUP_SRC_FILTER      = 0x200
 	IPV6_MAX_MEMBERSHIPS           = 0xfff
 	IPV6_MAX_SOCK_SRC_FILTER       = 0x80
-	IPV6_MIN_MEMBERSHIPS           = 0x1f
 	IPV6_MMTU                      = 0x500
 	IPV6_MSFILTER                  = 0x4a
 	IPV6_MULTICAST_HOPS            = 0xa
 	IPV6_MULTICAST_IF              = 0x9
 	IPV6_MULTICAST_LOOP            = 0xb
 	IPV6_NEXTHOP                   = 0x30
+	IPV6_ORIGDSTADDR               = 0x48
 	IPV6_PATHMTU                   = 0x2c
 	IPV6_PKTINFO                   = 0x2e
 	IPV6_PORTRANGE                 = 0xe
@@ -875,6 +893,7 @@ const (
 	IPV6_RECVFLOWID                = 0x46
 	IPV6_RECVHOPLIMIT              = 0x25
 	IPV6_RECVHOPOPTS               = 0x27
+	IPV6_RECVORIGDSTADDR           = 0x48
 	IPV6_RECVPATHMTU               = 0x2b
 	IPV6_RECVPKTINFO               = 0x24
 	IPV6_RECVRSSBUCKETID           = 0x47
@@ -894,6 +913,7 @@ const (
 	IPV6_V6ONLY                    = 0x1b
 	IPV6_VERSION                   = 0x60
 	IPV6_VERSION_MASK              = 0xf0
+	IPV6_VLAN_PCP                  = 0x4b
 	IP_ADD_MEMBERSHIP              = 0xc
 	IP_ADD_SOURCE_MEMBERSHIP       = 0x46
 	IP_BINDANY                     = 0x18
@@ -935,10 +955,8 @@ const (
 	IP_MAX_MEMBERSHIPS             = 0xfff
 	IP_MAX_SOCK_MUTE_FILTER        = 0x80
 	IP_MAX_SOCK_SRC_FILTER         = 0x80
-	IP_MAX_SOURCE_FILTER           = 0x400
 	IP_MF                          = 0x2000
 	IP_MINTTL                      = 0x42
-	IP_MIN_MEMBERSHIPS             = 0x1f
 	IP_MSFILTER                    = 0x4a
 	IP_MSS                         = 0x240
 	IP_MULTICAST_IF                = 0x9
@@ -948,6 +966,7 @@ const (
 	IP_OFFMASK                     = 0x1fff
 	IP_ONESBCAST                   = 0x17
 	IP_OPTIONS                     = 0x1
+	IP_ORIGDSTADDR                 = 0x1b
 	IP_PORTRANGE                   = 0x13
 	IP_PORTRANGE_DEFAULT           = 0x0
 	IP_PORTRANGE_HIGH              = 0x1
@@ -956,6 +975,7 @@ const (
 	IP_RECVFLOWID                  = 0x5d
 	IP_RECVIF                      = 0x14
 	IP_RECVOPTS                    = 0x5
+	IP_RECVORIGDSTADDR             = 0x1b
 	IP_RECVRETOPTS                 = 0x6
 	IP_RECVRSSBUCKETID             = 0x5e
 	IP_RECVTOS                     = 0x44
@@ -972,8 +992,12 @@ const (
 	IP_TOS                         = 0x3
 	IP_TTL                         = 0x4
 	IP_UNBLOCK_SOURCE              = 0x49
+	IP_VLAN_PCP                    = 0x4b
 	ISIG                           = 0x80
 	ISTRIP                         = 0x20
+	ITIMER_PROF                    = 0x2
+	ITIMER_REAL                    = 0x0
+	ITIMER_VIRTUAL                 = 0x1
 	IXANY                          = 0x800
 	IXOFF                          = 0x400
 	IXON                           = 0x200
@@ -983,7 +1007,6 @@ const (
 	KERN_VERSION                   = 0x4
 	LOCAL_CONNWAIT                 = 0x4
 	LOCAL_CREDS                    = 0x2
-	LOCAL_CREDS_PERSISTENT         = 0x3
 	LOCAL_PEERCRED                 = 0x1
 	LOCAL_VENDOR                   = 0x80000000
 	LOCK_EX                        = 0x2
@@ -1071,10 +1094,12 @@ const (
 	MNT_SUSPEND                    = 0x4
 	MNT_SYNCHRONOUS                = 0x2
 	MNT_UNION                      = 0x20
+	MNT_UNTRUSTED                  = 0x800000000
 	MNT_UPDATE                     = 0x10000
-	MNT_UPDATEMASK                 = 0x2d8d0807e
+	MNT_UPDATEMASK                 = 0xad8d0807e
 	MNT_USER                       = 0x8000
-	MNT_VISFLAGMASK                = 0x3fef0ffff
+	MNT_VERIFIED                   = 0x400000000
+	MNT_VISFLAGMASK                = 0xffef0ffff
 	MNT_WAIT                       = 0x1
 	MSG_CMSG_CLOEXEC               = 0x40000
 	MSG_COMPAT                     = 0x8000
@@ -1103,6 +1128,7 @@ const (
 	NFDBITS                        = 0x20
 	NOFLSH                         = 0x80000000
 	NOKERNINFO                     = 0x2000000
+	NOTE_ABSTIME                   = 0x10
 	NOTE_ATTRIB                    = 0x8
 	NOTE_CHILD                     = 0x4
 	NOTE_CLOSE                     = 0x100
@@ -1159,6 +1185,8 @@ const (
 	O_NONBLOCK                     = 0x4
 	O_RDONLY                       = 0x0
 	O_RDWR                         = 0x2
+	O_RESOLVE_BENEATH              = 0x800000
+	O_SEARCH                       = 0x40000
 	O_SHLOCK                       = 0x10
 	O_SYNC                         = 0x80
 	O_TRUNC                        = 0x400
@@ -1169,6 +1197,10 @@ const (
 	PARMRK                         = 0x8
 	PARODD                         = 0x2000
 	PENDIN                         = 0x20000000
+	PIOD_READ_D                    = 0x1
+	PIOD_READ_I                    = 0x3
+	PIOD_WRITE_D                   = 0x2
+	PIOD_WRITE_I                   = 0x4
 	PRIO_PGRP                      = 0x1
 	PRIO_PROCESS                   = 0x0
 	PRIO_USER                      = 0x2
@@ -1176,6 +1208,53 @@ const (
 	PROT_NONE                      = 0x0
 	PROT_READ                      = 0x1
 	PROT_WRITE                     = 0x2
+	PTRACE_DEFAULT                 = 0x1
+	PTRACE_EXEC                    = 0x1
+	PTRACE_FORK                    = 0x8
+	PTRACE_LWP                     = 0x10
+	PTRACE_SCE                     = 0x2
+	PTRACE_SCX                     = 0x4
+	PTRACE_SYSCALL                 = 0x6
+	PTRACE_VFORK                   = 0x20
+	PT_ATTACH                      = 0xa
+	PT_CLEARSTEP                   = 0x10
+	PT_CONTINUE                    = 0x7
+	PT_DETACH                      = 0xb
+	PT_FIRSTMACH                   = 0x40
+	PT_FOLLOW_FORK                 = 0x17
+	PT_GETDBREGS                   = 0x25
+	PT_GETFPREGS                   = 0x23
+	PT_GETLWPLIST                  = 0xf
+	PT_GETNUMLWPS                  = 0xe
+	PT_GETREGS                     = 0x21
+	PT_GETVFPREGS                  = 0x40
+	PT_GET_EVENT_MASK              = 0x19
+	PT_GET_SC_ARGS                 = 0x1b
+	PT_GET_SC_RET                  = 0x1c
+	PT_IO                          = 0xc
+	PT_KILL                        = 0x8
+	PT_LWPINFO                     = 0xd
+	PT_LWP_EVENTS                  = 0x18
+	PT_READ_D                      = 0x2
+	PT_READ_I                      = 0x1
+	PT_RESUME                      = 0x13
+	PT_SETDBREGS                   = 0x26
+	PT_SETFPREGS                   = 0x24
+	PT_SETREGS                     = 0x22
+	PT_SETSTEP                     = 0x11
+	PT_SETVFPREGS                  = 0x41
+	PT_SET_EVENT_MASK              = 0x1a
+	PT_STEP                        = 0x9
+	PT_SUSPEND                     = 0x12
+	PT_SYSCALL                     = 0x16
+	PT_TO_SCE                      = 0x14
+	PT_TO_SCX                      = 0x15
+	PT_TRACE_ME                    = 0x0
+	PT_VM_ENTRY                    = 0x29
+	PT_VM_TIMESTAMP                = 0x28
+	PT_WRITE_D                     = 0x5
+	PT_WRITE_I                     = 0x4
+	P_ZONEID                       = 0xc
 	RLIMIT_AS                      = 0xa
 	RLIMIT_CORE                    = 0x4
 	RLIMIT_CPU                     = 0x0
@@ -1257,7 +1336,6 @@ const (
 	RTV_WEIGHT                     = 0x100
 	RT_ALL_FIBS                    = -0x1
 	RT_BLACKHOLE                   = 0x40
-	RT_CACHING_CONTEXT             = 0x1
 	RT_DEFAULT_FIB                 = 0x0
 	RT_HAS_GW                      = 0x80
 	RT_HAS_HEADER                  = 0x10
@@ -1267,15 +1345,17 @@ const (
 	RT_LLE_CACHE                   = 0x100
 	RT_MAY_LOOP                    = 0x8
 	RT_MAY_LOOP_BIT                = 0x3
-	RT_NORTREF                     = 0x2
 	RT_REJECT                      = 0x20
 	RUSAGE_CHILDREN                = -0x1
 	RUSAGE_SELF                    = 0x0
 	RUSAGE_THREAD                  = 0x1
 	SCM_BINTIME                    = 0x4
 	SCM_CREDS                      = 0x3
+	SCM_MONOTONIC                  = 0x6
+	SCM_REALTIME                   = 0x5
 	SCM_RIGHTS                     = 0x1
 	SCM_TIMESTAMP                  = 0x2
+	SCM_TIME_INFO                  = 0x7
 	SEEK_CUR                       = 0x1
 	SEEK_DATA                      = 0x3
 	SEEK_END                       = 0x2
@@ -1299,10 +1379,12 @@ const (
 	SIOCGHWADDR                    = 0xc020693e
 	SIOCGI2C                       = 0xc020693d
 	SIOCGIFADDR                    = 0xc0206921
+	SIOCGIFALIAS                   = 0xc044692d
 	SIOCGIFBRDADDR                 = 0xc0206923
 	SIOCGIFCAP                     = 0xc020691f
 	SIOCGIFCONF                    = 0xc0086924
 	SIOCGIFDESCR                   = 0xc020692a
+	SIOCGIFDOWNREASON              = 0xc058699a
 	SIOCGIFDSTADDR                 = 0xc0206922
 	SIOCGIFFIB                     = 0xc020695c
 	SIOCGIFFLAGS                   = 0xc0206911
@@ -1318,8 +1400,11 @@ const (
 	SIOCGIFPDSTADDR                = 0xc0206948
 	SIOCGIFPHYS                    = 0xc0206935
 	SIOCGIFPSRCADDR                = 0xc0206947
+	SIOCGIFRSSHASH                 = 0xc0186997
+	SIOCGIFRSSKEY                  = 0xc0946996
 	SIOCGIFSTATUS                  = 0xc331693b
 	SIOCGIFXMEDIA                  = 0xc028698b
+	SIOCGLANPCP                    = 0xc0206998
 	SIOCGLOWAT                     = 0x40047303
 	SIOCGPGRP                      = 0x40047309
 	SIOCGPRIVATE_0                 = 0xc0206950
@@ -1350,6 +1435,7 @@ const (
 	SIOCSIFPHYS                    = 0x80206936
 	SIOCSIFRVNET                   = 0xc020695b
 	SIOCSIFVNET                    = 0xc020695a
+	SIOCSLANPCP                    = 0x80206999
 	SIOCSLOWAT                     = 0x80047302
 	SIOCSPGRP                      = 0x80047308
 	SIOCSTUNFIB                    = 0x8020695f
@@ -1369,6 +1455,7 @@ const (
 	SO_BINTIME                     = 0x2000
 	SO_BROADCAST                   = 0x20
 	SO_DEBUG                       = 0x1
+	SO_DOMAIN                      = 0x1019
 	SO_DONTROUTE                   = 0x10
 	SO_ERROR                       = 0x1007
 	SO_KEEPALIVE                   = 0x8
@@ -1377,6 +1464,7 @@ const (
 	SO_LISTENINCQLEN               = 0x1013
 	SO_LISTENQLEN                  = 0x1012
 	SO_LISTENQLIMIT                = 0x1011
+	SO_MAX_PACING_RATE             = 0x1018
 	SO_NOSIGPIPE                   = 0x800
 	SO_NO_DDP                      = 0x8000
 	SO_NO_OFFLOAD                  = 0x4000
@@ -1387,13 +1475,22 @@ const (
 	SO_RCVBUF                      = 0x1002
 	SO_RCVLOWAT                    = 0x1004
 	SO_RCVTIMEO                    = 0x1006
+	SO_RERROR                      = 0x20000
 	SO_REUSEADDR                   = 0x4
 	SO_REUSEPORT                   = 0x200
+	SO_REUSEPORT_LB                = 0x10000
 	SO_SETFIB                      = 0x1014
 	SO_SNDBUF                      = 0x1001
 	SO_SNDLOWAT                    = 0x1003
 	SO_SNDTIMEO                    = 0x1005
 	SO_TIMESTAMP                   = 0x400
+	SO_TS_BINTIME                  = 0x1
+	SO_TS_CLOCK                    = 0x1017
+	SO_TS_CLOCK_MAX                = 0x3
+	SO_TS_DEFAULT                  = 0x0
+	SO_TS_MONOTONIC                = 0x3
+	SO_TS_REALTIME                 = 0x2
+	SO_TS_REALTIME_MICRO           = 0x0
 	SO_TYPE                        = 0x1008
 	SO_USELOOPBACK                 = 0x40
 	SO_USER_COOKIE                 = 0x1015
@@ -1437,10 +1534,69 @@ const (
 	TCOFLUSH                       = 0x2
 	TCOOFF                         = 0x1
 	TCOON                          = 0x2
+	TCPOPT_EOL                     = 0x0
+	TCPOPT_FAST_OPEN               = 0x22
+	TCPOPT_MAXSEG                  = 0x2
+	TCPOPT_NOP                     = 0x1
+	TCPOPT_PAD                     = 0x0
+	TCPOPT_SACK                    = 0x5
+	TCPOPT_SACK_PERMITTED          = 0x4
+	TCPOPT_SIGNATURE               = 0x13
+	TCPOPT_TIMESTAMP               = 0x8
+	TCPOPT_WINDOW                  = 0x3
+	TCP_BBR_ACK_COMP_ALG           = 0x448
+	TCP_BBR_ALGORITHM              = 0x43b
+	TCP_BBR_DRAIN_INC_EXTRA        = 0x43c
+	TCP_BBR_DRAIN_PG               = 0x42e
+	TCP_BBR_EXTRA_GAIN             = 0x449
+	TCP_BBR_EXTRA_STATE            = 0x453
+	TCP_BBR_FLOOR_MIN_TSO          = 0x454
+	TCP_BBR_HDWR_PACE              = 0x451
+	TCP_BBR_HOLD_TARGET            = 0x436
+	TCP_BBR_IWINTSO                = 0x42b
+	TCP_BBR_LOWGAIN_FD             = 0x436
+	TCP_BBR_LOWGAIN_HALF           = 0x435
+	TCP_BBR_LOWGAIN_THRESH         = 0x434
+	TCP_BBR_MAX_RTO                = 0x439
+	TCP_BBR_MIN_RTO                = 0x438
+	TCP_BBR_MIN_TOPACEOUT          = 0x455
+	TCP_BBR_ONE_RETRAN             = 0x431
+	TCP_BBR_PACE_CROSS             = 0x442
+	TCP_BBR_PACE_DEL_TAR           = 0x43f
+	TCP_BBR_PACE_OH                = 0x435
+	TCP_BBR_PACE_PER_SEC           = 0x43e
+	TCP_BBR_PACE_SEG_MAX           = 0x440
+	TCP_BBR_PACE_SEG_MIN           = 0x441
+	TCP_BBR_POLICER_DETECT         = 0x457
+	TCP_BBR_PROBE_RTT_GAIN         = 0x44d
+	TCP_BBR_PROBE_RTT_INT          = 0x430
+	TCP_BBR_PROBE_RTT_LEN          = 0x44e
+	TCP_BBR_RACK_RTT_USE           = 0x44a
+	TCP_BBR_RECFORCE               = 0x42c
+	TCP_BBR_REC_OVER_HPTS          = 0x43a
+	TCP_BBR_RETRAN_WTSO            = 0x44b
+	TCP_BBR_RWND_IS_APP            = 0x42f
+	TCP_BBR_SEND_IWND_IN_TSO       = 0x44f
+	TCP_BBR_STARTUP_EXIT_EPOCH     = 0x43d
+	TCP_BBR_STARTUP_LOSS_EXIT      = 0x432
+	TCP_BBR_STARTUP_PG             = 0x42d
+	TCP_BBR_TMR_PACE_OH            = 0x448
+	TCP_BBR_TSLIMITS               = 0x434
+	TCP_BBR_TSTMP_RAISES           = 0x456
+	TCP_BBR_UNLIMITED              = 0x43b
+	TCP_BBR_USEDEL_RATE            = 0x437
+	TCP_BBR_USE_LOWGAIN            = 0x433
+	TCP_BBR_USE_RACK_CHEAT         = 0x450
+	TCP_BBR_UTTER_MAX_TSO          = 0x452
 	TCP_CA_NAME_MAX                = 0x10
 	TCP_CCALGOOPT                  = 0x41
 	TCP_CONGESTION                 = 0x40
+	TCP_DATA_AFTER_CLOSE           = 0x44c
+	TCP_DELACK                     = 0x48
 	TCP_FASTOPEN                   = 0x401
+	TCP_FASTOPEN_MAX_COOKIE_LEN    = 0x10
+	TCP_FASTOPEN_MIN_COOKIE_LEN    = 0x4
+	TCP_FASTOPEN_PSK_LEN           = 0x10
 	TCP_FUNCTION_BLK               = 0x2000
 	TCP_FUNCTION_NAME_LEN_MAX      = 0x20
 	TCP_INFO                       = 0x20
@@ -1448,6 +1604,12 @@ const (
 	TCP_KEEPIDLE                   = 0x100
 	TCP_KEEPINIT                   = 0x80
 	TCP_KEEPINTVL                  = 0x200
+	TCP_LOG                        = 0x22
+	TCP_LOGBUF                     = 0x23
+	TCP_LOGDUMP                    = 0x25
+	TCP_LOGDUMPID                  = 0x26
+	TCP_LOGID                      = 0x24
+	TCP_LOG_ID_LEN                 = 0x40
 	TCP_MAXBURST                   = 0x4
 	TCP_MAXHLEN                    = 0x3c
 	TCP_MAXOLEN                    = 0x28
@@ -1463,8 +1625,30 @@ const (
 	TCP_NOPUSH                     = 0x4
 	TCP_PCAP_IN                    = 0x1000
 	TCP_PCAP_OUT                   = 0x800
+	TCP_RACK_EARLY_RECOV           = 0x423
+	TCP_RACK_EARLY_SEG             = 0x424
+	TCP_RACK_GP_INCREASE           = 0x446
+	TCP_RACK_IDLE_REDUCE_HIGH      = 0x444
+	TCP_RACK_MIN_PACE              = 0x445
+	TCP_RACK_MIN_PACE_SEG          = 0x446
+	TCP_RACK_MIN_TO                = 0x422
+	TCP_RACK_PACE_ALWAYS           = 0x41f
+	TCP_RACK_PACE_MAX_SEG          = 0x41e
+	TCP_RACK_PACE_REDUCE           = 0x41d
+	TCP_RACK_PKT_DELAY             = 0x428
+	TCP_RACK_PROP                  = 0x41b
+	TCP_RACK_PROP_RATE             = 0x420
+	TCP_RACK_PRR_SENDALOT          = 0x421
+	TCP_RACK_REORD_FADE            = 0x426
+	TCP_RACK_REORD_THRESH          = 0x425
+	TCP_RACK_TLP_INC_VAR           = 0x429
+	TCP_RACK_TLP_REDUCE            = 0x41c
+	TCP_RACK_TLP_THRESH            = 0x427
+	TCP_RACK_TLP_USE               = 0x447
 	TCP_VENDOR                     = 0x80000000
 	TCSAFLUSH                      = 0x2
+	TIMER_ABSTIME                  = 0x1
+	TIMER_RELTIME                  = 0x0
 	TIOCCBRK                       = 0x2000747a
 	TIOCCDTR                       = 0x20007478
 	TIOCCONS                       = 0x80047462
@@ -1528,6 +1712,8 @@ const (
 	TIOCTIMESTAMP                  = 0x40107459
 	TIOCUCNTL                      = 0x80047466
 	TOSTOP                         = 0x400000
+	UTIME_NOW                      = -0x1
+	UTIME_OMIT                     = -0x2
 	VDISCARD                       = 0xf
 	VDSUSP                         = 0xb
 	VEOF                           = 0x0
@@ -1592,12 +1778,13 @@ const (
 	EIDRM           = syscall.Errno(0x52)
 	EILSEQ          = syscall.Errno(0x56)
 	EINPROGRESS     = syscall.Errno(0x24)
+	EINTEGRITY      = syscall.Errno(0x61)
 	EINTR           = syscall.Errno(0x4)
 	EINVAL          = syscall.Errno(0x16)
 	EIO             = syscall.Errno(0x5)
 	EISCONN         = syscall.Errno(0x38)
 	EISDIR          = syscall.Errno(0x15)
-	ELAST           = syscall.Errno(0x60)
+	ELAST           = syscall.Errno(0x61)
 	ELOOP           = syscall.Errno(0x3e)
 	EMFILE          = syscall.Errno(0x18)
 	EMLINK          = syscall.Errno(0x1f)
@@ -1740,7 +1927,7 @@ var errorList = [...]struct {
 	{32, "EPIPE", "broken pipe"},
 	{33, "EDOM", "numerical argument out of domain"},
 	{34, "ERANGE", "result too large"},
-	{35, "EAGAIN", "resource temporarily unavailable"},
+	{35, "EWOULDBLOCK", "resource temporarily unavailable"},
 	{36, "EINPROGRESS", "operation now in progress"},
 	{37, "EALREADY", "operation already in progress"},
 	{38, "ENOTSOCK", "socket operation on non-socket"},
@@ -1802,6 +1989,7 @@ var errorList = [...]struct {
 	{94, "ECAPMODE", "not permitted in capability mode"},
 	{95, "ENOTRECOVERABLE", "state not recoverable"},
 	{96, "EOWNERDEAD", "previous owner died"},
+	{97, "EINTEGRITY", "integrity check failed"},
 }
 
 // Signal table

vendor/golang.org/x/sys/unix/zerrors_freebsd_arm64.go

@@ -151,6 +151,7 @@ const (
 	BIOCSETF                       = 0x80104267
 	BIOCSETFNR                     = 0x80104282
 	BIOCSETIF                      = 0x8020426c
+	BIOCSETVLANPCP                 = 0x80044285
 	BIOCSETWF                      = 0x8010427b
 	BIOCSETZBUF                    = 0x80184281
 	BIOCSHDRCMPLT                  = 0x80044275
@@ -447,7 +448,7 @@ const (
 	DLT_IEEE802_16_MAC_CPS_RADIO   = 0xc1
 	DLT_INFINIBAND                 = 0xf7
 	DLT_IPFILTER                   = 0x74
-	DLT_IPMB                       = 0xc7
+	DLT_IPMB_KONTRON               = 0xc7
 	DLT_IPMB_LINUX                 = 0xd1
 	DLT_IPMI_HPM_2                 = 0x104
 	DLT_IPNET                      = 0xe2
@@ -487,10 +488,11 @@ const (
 	DLT_LINUX_LAPD                 = 0xb1
 	DLT_LINUX_PPP_WITHDIRECTION    = 0xa6
 	DLT_LINUX_SLL                  = 0x71
+	DLT_LINUX_SLL2                 = 0x114
 	DLT_LOOP                       = 0x6c
 	DLT_LORATAP                    = 0x10e
 	DLT_LTALK                      = 0x72
-	DLT_MATCHING_MAX               = 0x113
+	DLT_MATCHING_MAX               = 0x114
 	DLT_MATCHING_MIN               = 0x68
 	DLT_MFR                        = 0xb6
 	DLT_MOST                       = 0xd3
@@ -734,6 +736,7 @@ const (
 	IPPROTO_CMTP                   = 0x26
 	IPPROTO_CPHB                   = 0x49
 	IPPROTO_CPNX                   = 0x48
+	IPPROTO_DCCP                   = 0x21
 	IPPROTO_DDP                    = 0x25
 	IPPROTO_DGP                    = 0x56
 	IPPROTO_DIVERT                 = 0x102
@@ -814,7 +817,6 @@ const (
 	IPPROTO_SCTP                   = 0x84
 	IPPROTO_SDRP                   = 0x2a
 	IPPROTO_SEND                   = 0x103
-	IPPROTO_SEP                    = 0x21
 	IPPROTO_SHIM6                  = 0x8c
 	IPPROTO_SKIP                   = 0x39
 	IPPROTO_SPACER                 = 0x7fff
@@ -911,6 +913,7 @@ const (
 	IPV6_V6ONLY                    = 0x1b
 	IPV6_VERSION                   = 0x60
 	IPV6_VERSION_MASK              = 0xf0
+	IPV6_VLAN_PCP                  = 0x4b
 	IP_ADD_MEMBERSHIP              = 0xc
 	IP_ADD_SOURCE_MEMBERSHIP       = 0x46
 	IP_BINDANY                     = 0x18
@@ -989,8 +992,12 @@ const (
 	IP_TOS                         = 0x3
 	IP_TTL                         = 0x4
 	IP_UNBLOCK_SOURCE              = 0x49
+	IP_VLAN_PCP                    = 0x4b
 	ISIG                           = 0x80
 	ISTRIP                         = 0x20
+	ITIMER_PROF                    = 0x2
+	ITIMER_REAL                    = 0x0
+	ITIMER_VIRTUAL                 = 0x1
 	IXANY                          = 0x800
 	IXOFF                          = 0x400
 	IXON                           = 0x200
@@ -1000,7 +1007,6 @@ const (
 	KERN_VERSION                   = 0x4
 	LOCAL_CONNWAIT                 = 0x4
 	LOCAL_CREDS                    = 0x2
-	LOCAL_CREDS_PERSISTENT         = 0x3
 	LOCAL_PEERCRED                 = 0x1
 	LOCAL_VENDOR                   = 0x80000000
 	LOCK_EX                        = 0x2
@@ -1180,6 +1186,8 @@ const (
 	O_NONBLOCK                     = 0x4
 	O_RDONLY                       = 0x0
 	O_RDWR                         = 0x2
+	O_RESOLVE_BENEATH              = 0x800000
+	O_SEARCH                       = 0x40000
 	O_SHLOCK                       = 0x10
 	O_SYNC                         = 0x80
 	O_TRUNC                        = 0x400
@@ -1190,6 +1198,10 @@ const (
 	PARMRK                         = 0x8
 	PARODD                         = 0x2000
 	PENDIN                         = 0x20000000
+	PIOD_READ_D                    = 0x1
+	PIOD_READ_I                    = 0x3
+	PIOD_WRITE_D                   = 0x2
+	PIOD_WRITE_I                   = 0x4
 	PRIO_PGRP                      = 0x1
 	PRIO_PROCESS                   = 0x0
 	PRIO_USER                      = 0x2
@@ -1197,6 +1209,51 @@ const (
 	PROT_NONE                      = 0x0
 	PROT_READ                      = 0x1
 	PROT_WRITE                     = 0x2
+	PTRACE_DEFAULT                 = 0x1
+	PTRACE_EXEC                    = 0x1
+	PTRACE_FORK                    = 0x8
+	PTRACE_LWP                     = 0x10
+	PTRACE_SCE                     = 0x2
+	PTRACE_SCX                     = 0x4
+	PTRACE_SYSCALL                 = 0x6
+	PTRACE_VFORK                   = 0x20
+	PT_ATTACH                      = 0xa
+	PT_CLEARSTEP                   = 0x10
+	PT_CONTINUE                    = 0x7
+	PT_DETACH                      = 0xb
+	PT_FIRSTMACH                   = 0x40
+	PT_FOLLOW_FORK                 = 0x17
+	PT_GETDBREGS                   = 0x25
+	PT_GETFPREGS                   = 0x23
+	PT_GETLWPLIST                  = 0xf
+	PT_GETNUMLWPS                  = 0xe
+	PT_GETREGS                     = 0x21
+	PT_GET_EVENT_MASK              = 0x19
+	PT_GET_SC_ARGS                 = 0x1b
+	PT_GET_SC_RET                  = 0x1c
+	PT_IO                          = 0xc
+	PT_KILL                        = 0x8
+	PT_LWPINFO                     = 0xd
+	PT_LWP_EVENTS                  = 0x18
+	PT_READ_D                      = 0x2
+	PT_READ_I                      = 0x1
+	PT_RESUME                      = 0x13
+	PT_SETDBREGS                   = 0x26
+	PT_SETFPREGS                   = 0x24
+	PT_SETREGS                     = 0x22
+	PT_SETSTEP                     = 0x11
+	PT_SET_EVENT_MASK              = 0x1a
+	PT_STEP                        = 0x9
+	PT_SUSPEND                     = 0x12
+	PT_SYSCALL                     = 0x16
+	PT_TO_SCE                      = 0x14
+	PT_TO_SCX                      = 0x15
+	PT_TRACE_ME                    = 0x0
+	PT_VM_ENTRY                    = 0x29
+	PT_VM_TIMESTAMP                = 0x28
+	PT_WRITE_D                     = 0x5
+	PT_WRITE_I                     = 0x4
+	P_ZONEID                       = 0xc
 	RLIMIT_AS                      = 0xa
 	RLIMIT_CORE                    = 0x4
 	RLIMIT_CPU                     = 0x0
@@ -1321,10 +1378,12 @@ const (
 	SIOCGHWADDR                    = 0xc020693e
 	SIOCGI2C                       = 0xc020693d
 	SIOCGIFADDR                    = 0xc0206921
+	SIOCGIFALIAS                   = 0xc044692d
 	SIOCGIFBRDADDR                 = 0xc0206923
 	SIOCGIFCAP                     = 0xc020691f
 	SIOCGIFCONF                    = 0xc0106924
 	SIOCGIFDESCR                   = 0xc020692a
+	SIOCGIFDOWNREASON              = 0xc058699a
 	SIOCGIFDSTADDR                 = 0xc0206922
 	SIOCGIFFIB                     = 0xc020695c
 	SIOCGIFFLAGS                   = 0xc0206911
@@ -1415,6 +1474,7 @@ const (
 	SO_RCVBUF                      = 0x1002
 	SO_RCVLOWAT                    = 0x1004
 	SO_RCVTIMEO                    = 0x1006
+	SO_RERROR                      = 0x20000
 	SO_REUSEADDR                   = 0x4
 	SO_REUSEPORT                   = 0x200
 	SO_REUSEPORT_LB                = 0x10000
@@ -1473,22 +1533,40 @@ const (
 	TCOFLUSH                       = 0x2
 	TCOOFF                         = 0x1
 	TCOON                          = 0x2
+	TCPOPT_EOL                     = 0x0
+	TCPOPT_FAST_OPEN               = 0x22
+	TCPOPT_MAXSEG                  = 0x2
+	TCPOPT_NOP                     = 0x1
+	TCPOPT_PAD                     = 0x0
+	TCPOPT_SACK                    = 0x5
+	TCPOPT_SACK_PERMITTED          = 0x4
+	TCPOPT_SIGNATURE               = 0x13
+	TCPOPT_TIMESTAMP               = 0x8
+	TCPOPT_WINDOW                  = 0x3
 	TCP_BBR_ACK_COMP_ALG           = 0x448
+	TCP_BBR_ALGORITHM              = 0x43b
 	TCP_BBR_DRAIN_INC_EXTRA        = 0x43c
 	TCP_BBR_DRAIN_PG               = 0x42e
 	TCP_BBR_EXTRA_GAIN             = 0x449
+	TCP_BBR_EXTRA_STATE            = 0x453
+	TCP_BBR_FLOOR_MIN_TSO          = 0x454
+	TCP_BBR_HDWR_PACE              = 0x451
+	TCP_BBR_HOLD_TARGET            = 0x436
 	TCP_BBR_IWINTSO                = 0x42b
 	TCP_BBR_LOWGAIN_FD             = 0x436
 	TCP_BBR_LOWGAIN_HALF           = 0x435
 	TCP_BBR_LOWGAIN_THRESH         = 0x434
 	TCP_BBR_MAX_RTO                = 0x439
 	TCP_BBR_MIN_RTO                = 0x438
+	TCP_BBR_MIN_TOPACEOUT          = 0x455
 	TCP_BBR_ONE_RETRAN             = 0x431
 	TCP_BBR_PACE_CROSS             = 0x442
 	TCP_BBR_PACE_DEL_TAR           = 0x43f
+	TCP_BBR_PACE_OH                = 0x435
 	TCP_BBR_PACE_PER_SEC           = 0x43e
 	TCP_BBR_PACE_SEG_MAX           = 0x440
 	TCP_BBR_PACE_SEG_MIN           = 0x441
+	TCP_BBR_POLICER_DETECT         = 0x457
 	TCP_BBR_PROBE_RTT_GAIN         = 0x44d
 	TCP_BBR_PROBE_RTT_INT          = 0x430
 	TCP_BBR_PROBE_RTT_LEN          = 0x44e
@@ -1497,12 +1575,18 @@ const (
 	TCP_BBR_REC_OVER_HPTS          = 0x43a
 	TCP_BBR_RETRAN_WTSO            = 0x44b
 	TCP_BBR_RWND_IS_APP            = 0x42f
+	TCP_BBR_SEND_IWND_IN_TSO       = 0x44f
 	TCP_BBR_STARTUP_EXIT_EPOCH     = 0x43d
 	TCP_BBR_STARTUP_LOSS_EXIT      = 0x432
 	TCP_BBR_STARTUP_PG             = 0x42d
+	TCP_BBR_TMR_PACE_OH            = 0x448
+	TCP_BBR_TSLIMITS               = 0x434
+	TCP_BBR_TSTMP_RAISES           = 0x456
 	TCP_BBR_UNLIMITED              = 0x43b
 	TCP_BBR_USEDEL_RATE            = 0x437
 	TCP_BBR_USE_LOWGAIN            = 0x433
+	TCP_BBR_USE_RACK_CHEAT         = 0x450
+	TCP_BBR_UTTER_MAX_TSO          = 0x452
 	TCP_CA_NAME_MAX                = 0x10
 	TCP_CCALGOOPT                  = 0x41
 	TCP_CONGESTION                 = 0x40
@@ -1542,6 +1626,7 @@ const (
 	TCP_PCAP_OUT                   = 0x800
 	TCP_RACK_EARLY_RECOV           = 0x423
 	TCP_RACK_EARLY_SEG             = 0x424
+	TCP_RACK_GP_INCREASE           = 0x446
 	TCP_RACK_IDLE_REDUCE_HIGH      = 0x444
 	TCP_RACK_MIN_PACE              = 0x445
 	TCP_RACK_MIN_PACE_SEG          = 0x446
@@ -1555,7 +1640,6 @@ const (
 	TCP_RACK_PRR_SENDALOT          = 0x421
 	TCP_RACK_REORD_FADE            = 0x426
 	TCP_RACK_REORD_THRESH          = 0x425
-	TCP_RACK_SESS_CWV              = 0x42a
 	TCP_RACK_TLP_INC_VAR           = 0x429
 	TCP_RACK_TLP_REDUCE            = 0x41c
 	TCP_RACK_TLP_THRESH            = 0x427
@@ -1694,12 +1778,13 @@ const (
 	EIDRM           = syscall.Errno(0x52)
 	EILSEQ          = syscall.Errno(0x56)
 	EINPROGRESS     = syscall.Errno(0x24)
+	EINTEGRITY      = syscall.Errno(0x61)
 	EINTR           = syscall.Errno(0x4)
 	EINVAL          = syscall.Errno(0x16)
 	EIO             = syscall.Errno(0x5)
 	EISCONN         = syscall.Errno(0x38)
 	EISDIR          = syscall.Errno(0x15)
-	ELAST           = syscall.Errno(0x60)
+	ELAST           = syscall.Errno(0x61)
 	ELOOP           = syscall.Errno(0x3e)
 	EMFILE          = syscall.Errno(0x18)
 	EMLINK          = syscall.Errno(0x1f)
@@ -1842,7 +1927,7 @@ var errorList = [...]struct {
 	{32, "EPIPE", "broken pipe"},
 	{33, "EDOM", "numerical argument out of domain"},
 	{34, "ERANGE", "result too large"},
-	{35, "EAGAIN", "resource temporarily unavailable"},
+	{35, "EWOULDBLOCK", "resource temporarily unavailable"},
 	{36, "EINPROGRESS", "operation now in progress"},
 	{37, "EALREADY", "operation already in progress"},
 	{38, "ENOTSOCK", "socket operation on non-socket"},
@@ -1904,6 +1989,7 @@ var errorList = [...]struct {
 	{94, "ECAPMODE", "not permitted in capability mode"},
 	{95, "ENOTRECOVERABLE", "state not recoverable"},
 	{96, "EOWNERDEAD", "previous owner died"},
+	{97, "EINTEGRITY", "integrity check failed"},
 }
 
 // Signal table

vendor/golang.org/x/sys/unix/zerrors_linux.go

@@ -140,6 +140,306 @@ const (
 	ARPHRD_VOID                                 = 0xffff
 	ARPHRD_VSOCKMON                             = 0x33a
 	ARPHRD_X25                                  = 0x10f
+	AUDIT_ADD                                   = 0x3eb
+	AUDIT_ADD_RULE                              = 0x3f3
+	AUDIT_ALWAYS                                = 0x2
+	AUDIT_ANOM_ABEND                            = 0x6a5
+	AUDIT_ANOM_CREAT                            = 0x6a7
+	AUDIT_ANOM_LINK                             = 0x6a6
+	AUDIT_ANOM_PROMISCUOUS                      = 0x6a4
+	AUDIT_ARCH                                  = 0xb
+	AUDIT_ARCH_AARCH64                          = 0xc00000b7
+	AUDIT_ARCH_ALPHA                            = 0xc0009026
+	AUDIT_ARCH_ARCOMPACT                        = 0x4000005d
+	AUDIT_ARCH_ARCOMPACTBE                      = 0x5d
+	AUDIT_ARCH_ARCV2                            = 0x400000c3
+	AUDIT_ARCH_ARCV2BE                          = 0xc3
+	AUDIT_ARCH_ARM                              = 0x40000028
+	AUDIT_ARCH_ARMEB                            = 0x28
+	AUDIT_ARCH_C6X                              = 0x4000008c
+	AUDIT_ARCH_C6XBE                            = 0x8c
+	AUDIT_ARCH_CRIS                             = 0x4000004c
+	AUDIT_ARCH_CSKY                             = 0x400000fc
+	AUDIT_ARCH_FRV                              = 0x5441
+	AUDIT_ARCH_H8300                            = 0x2e
+	AUDIT_ARCH_HEXAGON                          = 0xa4
+	AUDIT_ARCH_I386                             = 0x40000003
+	AUDIT_ARCH_IA64                             = 0xc0000032
+	AUDIT_ARCH_LOONGARCH32                      = 0x40000102
+	AUDIT_ARCH_LOONGARCH64                      = 0xc0000102
+	AUDIT_ARCH_M32R                             = 0x58
+	AUDIT_ARCH_M68K                             = 0x4
+	AUDIT_ARCH_MICROBLAZE                       = 0xbd
+	AUDIT_ARCH_MIPS                             = 0x8
+	AUDIT_ARCH_MIPS64                           = 0x80000008
+	AUDIT_ARCH_MIPS64N32                        = 0xa0000008
+	AUDIT_ARCH_MIPSEL                           = 0x40000008
+	AUDIT_ARCH_MIPSEL64                         = 0xc0000008
+	AUDIT_ARCH_MIPSEL64N32                      = 0xe0000008
+	AUDIT_ARCH_NDS32                            = 0x400000a7
+	AUDIT_ARCH_NDS32BE                          = 0xa7
+	AUDIT_ARCH_NIOS2                            = 0x40000071
+	AUDIT_ARCH_OPENRISC                         = 0x5c
+	AUDIT_ARCH_PARISC                           = 0xf
+	AUDIT_ARCH_PARISC64                         = 0x8000000f
+	AUDIT_ARCH_PPC                              = 0x14
+	AUDIT_ARCH_PPC64                            = 0x80000015
+	AUDIT_ARCH_PPC64LE                          = 0xc0000015
+	AUDIT_ARCH_RISCV32                          = 0x400000f3
+	AUDIT_ARCH_RISCV64                          = 0xc00000f3
+	AUDIT_ARCH_S390                             = 0x16
+	AUDIT_ARCH_S390X                            = 0x80000016
+	AUDIT_ARCH_SH                               = 0x2a
+	AUDIT_ARCH_SH64                             = 0x8000002a
+	AUDIT_ARCH_SHEL                             = 0x4000002a
+	AUDIT_ARCH_SHEL64                           = 0xc000002a
+	AUDIT_ARCH_SPARC                            = 0x2
+	AUDIT_ARCH_SPARC64                          = 0x8000002b
+	AUDIT_ARCH_TILEGX                           = 0xc00000bf
+	AUDIT_ARCH_TILEGX32                         = 0x400000bf
+	AUDIT_ARCH_TILEPRO                          = 0x400000bc
+	AUDIT_ARCH_UNICORE                          = 0x4000006e
+	AUDIT_ARCH_X86_64                           = 0xc000003e
+	AUDIT_ARCH_XTENSA                           = 0x5e
+	AUDIT_ARG0                                  = 0xc8
+	AUDIT_ARG1                                  = 0xc9
+	AUDIT_ARG2                                  = 0xca
+	AUDIT_ARG3                                  = 0xcb
+	AUDIT_AVC                                   = 0x578
+	AUDIT_AVC_PATH                              = 0x57a
+	AUDIT_BITMASK_SIZE                          = 0x40
+	AUDIT_BIT_MASK                              = 0x8000000
+	AUDIT_BIT_TEST                              = 0x48000000
+	AUDIT_BPF                                   = 0x536
+	AUDIT_BPRM_FCAPS                            = 0x529
+	AUDIT_CAPSET                                = 0x52a
+	AUDIT_CLASS_CHATTR                          = 0x2
+	AUDIT_CLASS_CHATTR_32                       = 0x3
+	AUDIT_CLASS_DIR_WRITE                       = 0x0
+	AUDIT_CLASS_DIR_WRITE_32                    = 0x1
+	AUDIT_CLASS_READ                            = 0x4
+	AUDIT_CLASS_READ_32                         = 0x5
+	AUDIT_CLASS_SIGNAL                          = 0x8
+	AUDIT_CLASS_SIGNAL_32                       = 0x9
+	AUDIT_CLASS_WRITE                           = 0x6
+	AUDIT_CLASS_WRITE_32                        = 0x7
+	AUDIT_COMPARE_AUID_TO_EUID                  = 0x10
+	AUDIT_COMPARE_AUID_TO_FSUID                 = 0xe
+	AUDIT_COMPARE_AUID_TO_OBJ_UID               = 0x5
+	AUDIT_COMPARE_AUID_TO_SUID                  = 0xf
+	AUDIT_COMPARE_EGID_TO_FSGID                 = 0x17
+	AUDIT_COMPARE_EGID_TO_OBJ_GID               = 0x4
+	AUDIT_COMPARE_EGID_TO_SGID                  = 0x18
+	AUDIT_COMPARE_EUID_TO_FSUID                 = 0x12
+	AUDIT_COMPARE_EUID_TO_OBJ_UID               = 0x3
+	AUDIT_COMPARE_EUID_TO_SUID                  = 0x11
+	AUDIT_COMPARE_FSGID_TO_OBJ_GID              = 0x9
+	AUDIT_COMPARE_FSUID_TO_OBJ_UID              = 0x8
+	AUDIT_COMPARE_GID_TO_EGID                   = 0x14
+	AUDIT_COMPARE_GID_TO_FSGID                  = 0x15
+	AUDIT_COMPARE_GID_TO_OBJ_GID                = 0x2
+	AUDIT_COMPARE_GID_TO_SGID                   = 0x16
+	AUDIT_COMPARE_SGID_TO_FSGID                 = 0x19
+	AUDIT_COMPARE_SGID_TO_OBJ_GID               = 0x7
+	AUDIT_COMPARE_SUID_TO_FSUID                 = 0x13
+	AUDIT_COMPARE_SUID_TO_OBJ_UID               = 0x6
+	AUDIT_COMPARE_UID_TO_AUID                   = 0xa
+	AUDIT_COMPARE_UID_TO_EUID                   = 0xb
+	AUDIT_COMPARE_UID_TO_FSUID                  = 0xc
+	AUDIT_COMPARE_UID_TO_OBJ_UID                = 0x1
+	AUDIT_COMPARE_UID_TO_SUID                   = 0xd
+	AUDIT_CONFIG_CHANGE                         = 0x519
+	AUDIT_CWD                                   = 0x51b
+	AUDIT_DAEMON_ABORT                          = 0x4b2
+	AUDIT_DAEMON_CONFIG                         = 0x4b3
+	AUDIT_DAEMON_END                            = 0x4b1
+	AUDIT_DAEMON_START                          = 0x4b0
+	AUDIT_DEL                                   = 0x3ec
+	AUDIT_DEL_RULE                              = 0x3f4
+	AUDIT_DEVMAJOR                              = 0x64
+	AUDIT_DEVMINOR                              = 0x65
+	AUDIT_DIR                                   = 0x6b
+	AUDIT_DM_CTRL                               = 0x53a
+	AUDIT_DM_EVENT                              = 0x53b
+	AUDIT_EGID                                  = 0x6
+	AUDIT_EOE                                   = 0x528
+	AUDIT_EQUAL                                 = 0x40000000
+	AUDIT_EUID                                  = 0x2
+	AUDIT_EVENT_LISTENER                        = 0x537
+	AUDIT_EXE                                   = 0x70
+	AUDIT_EXECVE                                = 0x51d
+	AUDIT_EXIT                                  = 0x67
+	AUDIT_FAIL_PANIC                            = 0x2
+	AUDIT_FAIL_PRINTK                           = 0x1
+	AUDIT_FAIL_SILENT                           = 0x0
+	AUDIT_FANOTIFY                              = 0x533
+	AUDIT_FD_PAIR                               = 0x525
+	AUDIT_FEATURE_BITMAP_ALL                    = 0x7f
+	AUDIT_FEATURE_BITMAP_BACKLOG_LIMIT          = 0x1
+	AUDIT_FEATURE_BITMAP_BACKLOG_WAIT_TIME      = 0x2
+	AUDIT_FEATURE_BITMAP_EXCLUDE_EXTEND         = 0x8
+	AUDIT_FEATURE_BITMAP_EXECUTABLE_PATH        = 0x4
+	AUDIT_FEATURE_BITMAP_FILTER_FS              = 0x40
+	AUDIT_FEATURE_BITMAP_LOST_RESET             = 0x20
+	AUDIT_FEATURE_BITMAP_SESSIONID_FILTER       = 0x10
+	AUDIT_FEATURE_CHANGE                        = 0x530
+	AUDIT_FEATURE_LOGINUID_IMMUTABLE            = 0x1
+	AUDIT_FEATURE_ONLY_UNSET_LOGINUID           = 0x0
+	AUDIT_FEATURE_VERSION                       = 0x1
+	AUDIT_FIELD_COMPARE                         = 0x6f
+	AUDIT_FILETYPE                              = 0x6c
+	AUDIT_FILTERKEY                             = 0xd2
+	AUDIT_FILTER_ENTRY                          = 0x2
+	AUDIT_FILTER_EXCLUDE                        = 0x5
+	AUDIT_FILTER_EXIT                           = 0x4
+	AUDIT_FILTER_FS                             = 0x6
+	AUDIT_FILTER_PREPEND                        = 0x10
+	AUDIT_FILTER_TASK                           = 0x1
+	AUDIT_FILTER_TYPE                           = 0x5
+	AUDIT_FILTER_URING_EXIT                     = 0x7
+	AUDIT_FILTER_USER                           = 0x0
+	AUDIT_FILTER_WATCH                          = 0x3
+	AUDIT_FIRST_KERN_ANOM_MSG                   = 0x6a4
+	AUDIT_FIRST_USER_MSG                        = 0x44c
+	AUDIT_FIRST_USER_MSG2                       = 0x834
+	AUDIT_FSGID                                 = 0x8
+	AUDIT_FSTYPE                                = 0x1a
+	AUDIT_FSUID                                 = 0x4
+	AUDIT_GET                                   = 0x3e8
+	AUDIT_GET_FEATURE                           = 0x3fb
+	AUDIT_GID                                   = 0x5
+	AUDIT_GREATER_THAN                          = 0x20000000
+	AUDIT_GREATER_THAN_OR_EQUAL                 = 0x60000000
+	AUDIT_INODE                                 = 0x66
+	AUDIT_INTEGRITY_DATA                        = 0x708
+	AUDIT_INTEGRITY_EVM_XATTR                   = 0x70e
+	AUDIT_INTEGRITY_HASH                        = 0x70b
+	AUDIT_INTEGRITY_METADATA                    = 0x709
+	AUDIT_INTEGRITY_PCR                         = 0x70c
+	AUDIT_INTEGRITY_POLICY_RULE                 = 0x70f
+	AUDIT_INTEGRITY_RULE                        = 0x70d
+	AUDIT_INTEGRITY_STATUS                      = 0x70a
+	AUDIT_IPC                                   = 0x517
+	AUDIT_IPC_SET_PERM                          = 0x51f
+	AUDIT_KERNEL                                = 0x7d0
+	AUDIT_KERNEL_OTHER                          = 0x524
+	AUDIT_KERN_MODULE                           = 0x532
+	AUDIT_LAST_FEATURE                          = 0x1
+	AUDIT_LAST_KERN_ANOM_MSG                    = 0x707
+	AUDIT_LAST_USER_MSG                         = 0x4af
+	AUDIT_LAST_USER_MSG2                        = 0xbb7
+	AUDIT_LESS_THAN                             = 0x10000000
+	AUDIT_LESS_THAN_OR_EQUAL                    = 0x50000000
+	AUDIT_LIST                                  = 0x3ea
+	AUDIT_LIST_RULES                            = 0x3f5
+	AUDIT_LOGIN                                 = 0x3ee
+	AUDIT_LOGINUID                              = 0x9
+	AUDIT_LOGINUID_SET                          = 0x18
+	AUDIT_MAC_CALIPSO_ADD                       = 0x58a
+	AUDIT_MAC_CALIPSO_DEL                       = 0x58b
+	AUDIT_MAC_CIPSOV4_ADD                       = 0x57f
+	AUDIT_MAC_CIPSOV4_DEL                       = 0x580
+	AUDIT_MAC_CONFIG_CHANGE                     = 0x57d
+	AUDIT_MAC_IPSEC_ADDSA                       = 0x583
+	AUDIT_MAC_IPSEC_ADDSPD                      = 0x585
+	AUDIT_MAC_IPSEC_DELSA                       = 0x584
+	AUDIT_MAC_IPSEC_DELSPD                      = 0x586
+	AUDIT_MAC_IPSEC_EVENT                       = 0x587
+	AUDIT_MAC_MAP_ADD                           = 0x581
+	AUDIT_MAC_MAP_DEL                           = 0x582
+	AUDIT_MAC_POLICY_LOAD                       = 0x57b
+	AUDIT_MAC_STATUS                            = 0x57c
+	AUDIT_MAC_UNLBL_ALLOW                       = 0x57e
+	AUDIT_MAC_UNLBL_STCADD                      = 0x588
+	AUDIT_MAC_UNLBL_STCDEL                      = 0x589
+	AUDIT_MAKE_EQUIV                            = 0x3f7
+	AUDIT_MAX_FIELDS                            = 0x40
+	AUDIT_MAX_FIELD_COMPARE                     = 0x19
+	AUDIT_MAX_KEY_LEN                           = 0x100
+	AUDIT_MESSAGE_TEXT_MAX                      = 0x2170
+	AUDIT_MMAP                                  = 0x52b
+	AUDIT_MQ_GETSETATTR                         = 0x523
+	AUDIT_MQ_NOTIFY                             = 0x522
+	AUDIT_MQ_OPEN                               = 0x520
+	AUDIT_MQ_SENDRECV                           = 0x521
+	AUDIT_MSGTYPE                               = 0xc
+	AUDIT_NEGATE                                = 0x80000000
+	AUDIT_NETFILTER_CFG                         = 0x52d
+	AUDIT_NETFILTER_PKT                         = 0x52c
+	AUDIT_NEVER                                 = 0x0
+	AUDIT_NLGRP_MAX                             = 0x1
+	AUDIT_NOT_EQUAL                             = 0x30000000
+	AUDIT_NR_FILTERS                            = 0x8
+	AUDIT_OBJ_GID                               = 0x6e
+	AUDIT_OBJ_LEV_HIGH                          = 0x17
+	AUDIT_OBJ_LEV_LOW                           = 0x16
+	AUDIT_OBJ_PID                               = 0x526
+	AUDIT_OBJ_ROLE                              = 0x14
+	AUDIT_OBJ_TYPE                              = 0x15
+	AUDIT_OBJ_UID                               = 0x6d
+	AUDIT_OBJ_USER                              = 0x13
+	AUDIT_OPENAT2                               = 0x539
+	AUDIT_OPERATORS                             = 0x78000000
+	AUDIT_PATH                                  = 0x516
+	AUDIT_PERM                                  = 0x6a
+	AUDIT_PERM_ATTR                             = 0x8
+	AUDIT_PERM_EXEC                             = 0x1
+	AUDIT_PERM_READ                             = 0x4
+	AUDIT_PERM_WRITE                            = 0x2
+	AUDIT_PERS                                  = 0xa
+	AUDIT_PID                                   = 0x0
+	AUDIT_POSSIBLE                              = 0x1
+	AUDIT_PPID                                  = 0x12
+	AUDIT_PROCTITLE                             = 0x52f
+	AUDIT_REPLACE                               = 0x531
+	AUDIT_SADDR_FAM                             = 0x71
+	AUDIT_SECCOMP                               = 0x52e
+	AUDIT_SELINUX_ERR                           = 0x579
+	AUDIT_SESSIONID                             = 0x19
+	AUDIT_SET                                   = 0x3e9
+	AUDIT_SET_FEATURE                           = 0x3fa
+	AUDIT_SGID                                  = 0x7
+	AUDIT_SID_UNSET                             = 0xffffffff
+	AUDIT_SIGNAL_INFO                           = 0x3f2
+	AUDIT_SOCKADDR                              = 0x51a
+	AUDIT_SOCKETCALL                            = 0x518
+	AUDIT_STATUS_BACKLOG_LIMIT                  = 0x10
+	AUDIT_STATUS_BACKLOG_WAIT_TIME              = 0x20
+	AUDIT_STATUS_BACKLOG_WAIT_TIME_ACTUAL       = 0x80
+	AUDIT_STATUS_ENABLED                        = 0x1
+	AUDIT_STATUS_FAILURE                        = 0x2
+	AUDIT_STATUS_LOST                           = 0x40
+	AUDIT_STATUS_PID                            = 0x4
+	AUDIT_STATUS_RATE_LIMIT                     = 0x8
+	AUDIT_SUBJ_CLR                              = 0x11
+	AUDIT_SUBJ_ROLE                             = 0xe
+	AUDIT_SUBJ_SEN                              = 0x10
+	AUDIT_SUBJ_TYPE                             = 0xf
+	AUDIT_SUBJ_USER                             = 0xd
+	AUDIT_SUCCESS                               = 0x68
+	AUDIT_SUID                                  = 0x3
+	AUDIT_SYSCALL                               = 0x514
+	AUDIT_SYSCALL_CLASSES                       = 0x10
+	AUDIT_TIME_ADJNTPVAL                        = 0x535
+	AUDIT_TIME_INJOFFSET                        = 0x534
+	AUDIT_TRIM                                  = 0x3f6
+	AUDIT_TTY                                   = 0x527
+	AUDIT_TTY_GET                               = 0x3f8
+	AUDIT_TTY_SET                               = 0x3f9
+	AUDIT_UID                                   = 0x1
+	AUDIT_UID_UNSET                             = 0xffffffff
+	AUDIT_UNUSED_BITS                           = 0x7fffc00
+	AUDIT_URINGOP                               = 0x538
+	AUDIT_USER                                  = 0x3ed
+	AUDIT_USER_AVC                              = 0x453
+	AUDIT_USER_TTY                              = 0x464
+	AUDIT_VERSION_BACKLOG_LIMIT                 = 0x1
+	AUDIT_VERSION_BACKLOG_WAIT_TIME             = 0x2
+	AUDIT_VERSION_LATEST                        = 0x7f
+	AUDIT_WATCH                                 = 0x69
+	AUDIT_WATCH_INS                             = 0x3ef
+	AUDIT_WATCH_LIST                            = 0x3f1
+	AUDIT_WATCH_REM                             = 0x3f0
 	AUTOFS_SUPER_MAGIC                          = 0x187
 	B0                                          = 0x0
 	B110                                        = 0x3
@@ -184,6 +484,7 @@ const (
 	BPF_F_ALLOW_MULTI                           = 0x2
 	BPF_F_ALLOW_OVERRIDE                        = 0x1
 	BPF_F_ANY_ALIGNMENT                         = 0x2
+	BPF_F_KPROBE_MULTI_RETURN                   = 0x1
 	BPF_F_QUERY_EFFECTIVE                       = 0x1
 	BPF_F_REPLACE                               = 0x4
 	BPF_F_SLEEPABLE                             = 0x10
@@ -191,6 +492,8 @@ const (
 	BPF_F_TEST_RND_HI32                         = 0x4
 	BPF_F_TEST_RUN_ON_CPU                       = 0x1
 	BPF_F_TEST_STATE_FREQ                       = 0x8
+	BPF_F_TEST_XDP_LIVE_FRAMES                  = 0x2
+	BPF_F_XDP_HAS_FRAGS                         = 0x20
 	BPF_H                                       = 0x8
 	BPF_IMM                                     = 0x0
 	BPF_IND                                     = 0x40
@@ -517,9 +820,9 @@ const (
 	DM_UUID_FLAG                                = 0x4000
 	DM_UUID_LEN                                 = 0x81
 	DM_VERSION                                  = 0xc138fd00
-	DM_VERSION_EXTRA                            = "-ioctl (2021-03-22)"
+	DM_VERSION_EXTRA                            = "-ioctl (2022-02-22)"
 	DM_VERSION_MAJOR                            = 0x4
-	DM_VERSION_MINOR                            = 0x2d
+	DM_VERSION_MINOR                            = 0x2e
 	DM_VERSION_PATCHLEVEL                       = 0x0
 	DT_BLK                                      = 0x6
 	DT_CHR                                      = 0x2
@@ -535,6 +838,55 @@ const (
 	EFD_SEMAPHORE                               = 0x1
 	EFIVARFS_MAGIC                              = 0xde5e81e4
 	EFS_SUPER_MAGIC                             = 0x414a53
+	EM_386                                      = 0x3
+	EM_486                                      = 0x6
+	EM_68K                                      = 0x4
+	EM_860                                      = 0x7
+	EM_88K                                      = 0x5
+	EM_AARCH64                                  = 0xb7
+	EM_ALPHA                                    = 0x9026
+	EM_ALTERA_NIOS2                             = 0x71
+	EM_ARCOMPACT                                = 0x5d
+	EM_ARCV2                                    = 0xc3
+	EM_ARM                                      = 0x28
+	EM_BLACKFIN                                 = 0x6a
+	EM_BPF                                      = 0xf7
+	EM_CRIS                                     = 0x4c
+	EM_CSKY                                     = 0xfc
+	EM_CYGNUS_M32R                              = 0x9041
+	EM_CYGNUS_MN10300                           = 0xbeef
+	EM_FRV                                      = 0x5441
+	EM_H8_300                                   = 0x2e
+	EM_HEXAGON                                  = 0xa4
+	EM_IA_64                                    = 0x32
+	EM_LOONGARCH                                = 0x102
+	EM_M32                                      = 0x1
+	EM_M32R                                     = 0x58
+	EM_MICROBLAZE                               = 0xbd
+	EM_MIPS                                     = 0x8
+	EM_MIPS_RS3_LE                              = 0xa
+	EM_MIPS_RS4_BE                              = 0xa
+	EM_MN10300                                  = 0x59
+	EM_NDS32                                    = 0xa7
+	EM_NONE                                     = 0x0
+	EM_OPENRISC                                 = 0x5c
+	EM_PARISC                                   = 0xf
+	EM_PPC                                      = 0x14
+	EM_PPC64                                    = 0x15
+	EM_RISCV                                    = 0xf3
+	EM_S390                                     = 0x16
+	EM_S390_OLD                                 = 0xa390
+	EM_SH                                       = 0x2a
+	EM_SPARC                                    = 0x2
+	EM_SPARC32PLUS                              = 0x12
+	EM_SPARCV9                                  = 0x2b
+	EM_SPU                                      = 0x17
+	EM_TILEGX                                   = 0xbf
+	EM_TILEPRO                                  = 0xbc
+	EM_TI_C6000                                 = 0x8c
+	EM_UNICORE                                  = 0x6e
+	EM_X86_64                                   = 0x3e
+	EM_XTENSA                                   = 0x5e
 	ENCODING_DEFAULT                            = 0x0
 	ENCODING_FM_MARK                            = 0x3
 	ENCODING_FM_SPACE                           = 0x4
@@ -712,6 +1064,7 @@ const (
 	ETH_P_EDSA                                  = 0xdada
 	ETH_P_ERSPAN                                = 0x88be
 	ETH_P_ERSPAN2                               = 0x22eb
+	ETH_P_ETHERCAT                              = 0x88a4
 	ETH_P_FCOE                                  = 0x8906
 	ETH_P_FIP                                   = 0x8914
 	ETH_P_HDLC                                  = 0x19
@@ -749,6 +1102,7 @@ const (
 	ETH_P_PPP_MP                                = 0x8
 	ETH_P_PPP_SES                               = 0x8864
 	ETH_P_PREAUTH                               = 0x88c7
+	ETH_P_PROFINET                              = 0x8892
 	ETH_P_PRP                                   = 0x88fb
 	ETH_P_PUP                                   = 0x200
 	ETH_P_PUPAT                                 = 0x201
@@ -837,6 +1191,7 @@ const (
 	FAN_FS_ERROR                                = 0x8000
 	FAN_MARK_ADD                                = 0x1
 	FAN_MARK_DONT_FOLLOW                        = 0x4
+	FAN_MARK_EVICTABLE                          = 0x200
 	FAN_MARK_FILESYSTEM                         = 0x100
 	FAN_MARK_FLUSH                              = 0x80
 	FAN_MARK_IGNORED_MASK                       = 0x20
@@ -1055,7 +1410,7 @@ const (
 	IFA_F_STABLE_PRIVACY                        = 0x800
 	IFA_F_TEMPORARY                             = 0x1
 	IFA_F_TENTATIVE                             = 0x40
-	IFA_MAX                                     = 0xa
+	IFA_MAX                                     = 0xb
 	IFF_ALLMULTI                                = 0x200
 	IFF_ATTACH_QUEUE                            = 0x200
 	IFF_AUTOMEDIA                               = 0x4000
@@ -1310,6 +1665,7 @@ const (
 	KEXEC_ARCH_ARM                              = 0x280000
 	KEXEC_ARCH_DEFAULT                          = 0x0
 	KEXEC_ARCH_IA_64                            = 0x320000
+	KEXEC_ARCH_LOONGARCH                        = 0x1020000
 	KEXEC_ARCH_MASK                             = 0xffff0000
 	KEXEC_ARCH_MIPS                             = 0x80000
 	KEXEC_ARCH_MIPS_LE                          = 0xa0000
@@ -1402,6 +1758,7 @@ const (
 	LANDLOCK_ACCESS_FS_MAKE_SYM                 = 0x1000
 	LANDLOCK_ACCESS_FS_READ_DIR                 = 0x8
 	LANDLOCK_ACCESS_FS_READ_FILE                = 0x4
+	LANDLOCK_ACCESS_FS_REFER                    = 0x2000
 	LANDLOCK_ACCESS_FS_REMOVE_DIR               = 0x10
 	LANDLOCK_ACCESS_FS_REMOVE_FILE              = 0x20
 	LANDLOCK_ACCESS_FS_WRITE_FILE               = 0x2
@@ -1757,6 +2114,7 @@ const (
 	NLM_F_ACK_TLVS                              = 0x200
 	NLM_F_APPEND                                = 0x800
 	NLM_F_ATOMIC                                = 0x400
+	NLM_F_BULK                                  = 0x200
 	NLM_F_CAPPED                                = 0x100
 	NLM_F_CREATE                                = 0x400
 	NLM_F_DUMP                                  = 0x300
@@ -2074,6 +2432,11 @@ const (
 	PR_SET_UNALIGN                              = 0x6
 	PR_SET_VMA                                  = 0x53564d41
 	PR_SET_VMA_ANON_NAME                        = 0x0
+	PR_SME_GET_VL                               = 0x40
+	PR_SME_SET_VL                               = 0x3f
+	PR_SME_SET_VL_ONEXEC                        = 0x40000
+	PR_SME_VL_INHERIT                           = 0x20000
+	PR_SME_VL_LEN_MASK                          = 0xffff
 	PR_SPEC_DISABLE                             = 0x4
 	PR_SPEC_DISABLE_NOEXEC                      = 0x10
 	PR_SPEC_ENABLE                              = 0x2
@@ -2226,8 +2589,9 @@ const (
 	RTC_FEATURE_ALARM                           = 0x0
 	RTC_FEATURE_ALARM_RES_2S                    = 0x3
 	RTC_FEATURE_ALARM_RES_MINUTE                = 0x1
+	RTC_FEATURE_ALARM_WAKEUP_ONLY               = 0x7
 	RTC_FEATURE_BACKUP_SWITCH_MODE              = 0x6
-	RTC_FEATURE_CNT                             = 0x7
+	RTC_FEATURE_CNT                             = 0x8
 	RTC_FEATURE_CORRECTION                      = 0x5
 	RTC_FEATURE_NEED_WEEK_DAY                   = 0x2
 	RTC_FEATURE_UPDATE_INTERRUPT                = 0x4
@@ -2301,6 +2665,7 @@ const (
 	RTM_DELRULE                                 = 0x21
 	RTM_DELTCLASS                               = 0x29
 	RTM_DELTFILTER                              = 0x2d
+	RTM_DELTUNNEL                               = 0x79
 	RTM_DELVLAN                                 = 0x71
 	RTM_F_CLONED                                = 0x200
 	RTM_F_EQUALIZE                              = 0x400
@@ -2333,8 +2698,9 @@ const (
 	RTM_GETSTATS                                = 0x5e
 	RTM_GETTCLASS                               = 0x2a
 	RTM_GETTFILTER                              = 0x2e
+	RTM_GETTUNNEL                               = 0x7a
 	RTM_GETVLAN                                 = 0x72
-	RTM_MAX                                     = 0x77
+	RTM_MAX                                     = 0x7b
 	RTM_NEWACTION                               = 0x30
 	RTM_NEWADDR                                 = 0x14
 	RTM_NEWADDRLABEL                            = 0x48
@@ -2358,11 +2724,13 @@ const (
 	RTM_NEWSTATS                                = 0x5c
 	RTM_NEWTCLASS                               = 0x28
 	RTM_NEWTFILTER                              = 0x2c
-	RTM_NR_FAMILIES                             = 0x1a
+	RTM_NEWTUNNEL                               = 0x78
-	RTM_NR_MSGTYPES                             = 0x68
+	RTM_NR_FAMILIES                             = 0x1b
+	RTM_NR_MSGTYPES                             = 0x6c
 	RTM_SETDCB                                  = 0x4f
 	RTM_SETLINK                                 = 0x13
 	RTM_SETNEIGHTBL                             = 0x43
+	RTM_SETSTATS                                = 0x5f
 	RTNH_ALIGNTO                                = 0x4
 	RTNH_COMPARE_MASK                           = 0x59
 	RTNH_F_DEAD                                 = 0x1
@@ -2543,6 +2911,9 @@ const (
 	SOCK_RDM                                    = 0x4
 	SOCK_SEQPACKET                              = 0x5
 	SOCK_SNDBUF_LOCK                            = 0x1
+	SOCK_TXREHASH_DEFAULT                       = 0xff
+	SOCK_TXREHASH_DISABLED                      = 0x0
+	SOCK_TXREHASH_ENABLED                       = 0x1
 	SOL_AAL                                     = 0x109
 	SOL_ALG                                     = 0x117
 	SOL_ATM                                     = 0x108
@@ -2558,6 +2929,8 @@ const (
 	SOL_IUCV                                    = 0x115
 	SOL_KCM                                     = 0x119
 	SOL_LLC                                     = 0x10c
+	SOL_MCTP                                    = 0x11d
+	SOL_MPTCP                                   = 0x11c
 	SOL_NETBEUI                                 = 0x10b
 	SOL_NETLINK                                 = 0x10e
 	SOL_NFC                                     = 0x118
@@ -2567,6 +2940,7 @@ const (
 	SOL_RAW                                     = 0xff
 	SOL_RDS                                     = 0x114
 	SOL_RXRPC                                   = 0x110
+	SOL_SMC                                     = 0x11e
 	SOL_TCP                                     = 0x6
 	SOL_TIPC                                    = 0x10f
 	SOL_TLS                                     = 0x11a
@@ -2673,7 +3047,7 @@ const (
 	TASKSTATS_GENL_NAME                         = "TASKSTATS"
 	TASKSTATS_GENL_VERSION                      = 0x1
 	TASKSTATS_TYPE_MAX                          = 0x6
-	TASKSTATS_VERSION                           = 0xb
+	TASKSTATS_VERSION                           = 0xd
 	TCIFLUSH                                    = 0x0
 	TCIOFF                                      = 0x2
 	TCIOFLUSH                                   = 0x2

vendor/golang.org/x/sys/unix/zerrors_linux_386.go

@@ -1,11 +1,11 @@
-// mkerrors.sh -Wall -Werror -static -I/tmp/include -m32
+// mkerrors.sh -Wall -Werror -static -I/tmp/386/include -m32
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build 386 && linux
 // +build 386,linux
 
 // Code generated by cmd/cgo -godefs; DO NOT EDIT.
-// cgo -godefs -- -Wall -Werror -static -I/tmp/include -m32 /build/unix/_const.go
+// cgo -godefs -- -Wall -Werror -static -I/tmp/386/include -m32 _const.go
 
 package unix
 
@@ -326,6 +326,7 @@ const (
 	SO_RCVBUF                        = 0x8
 	SO_RCVBUFFORCE                   = 0x21
 	SO_RCVLOWAT                      = 0x12
+	SO_RCVMARK                       = 0x4b
 	SO_RCVTIMEO                      = 0x14
 	SO_RCVTIMEO_NEW                  = 0x42
 	SO_RCVTIMEO_OLD                  = 0x14
@@ -350,6 +351,7 @@ const (
 	SO_TIMESTAMPNS_NEW               = 0x40
 	SO_TIMESTAMPNS_OLD               = 0x23
 	SO_TIMESTAMP_NEW                 = 0x3f
+	SO_TXREHASH                      = 0x4a
 	SO_TXTIME                        = 0x3d
 	SO_TYPE                          = 0x3
 	SO_WIFI_STATUS                   = 0x29

vendor/golang.org/x/sys/unix/zerrors_linux_amd64.go

@@ -1,11 +1,11 @@
-// mkerrors.sh -Wall -Werror -static -I/tmp/include -m64
+// mkerrors.sh -Wall -Werror -static -I/tmp/amd64/include -m64
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build amd64 && linux
 // +build amd64,linux
 
 // Code generated by cmd/cgo -godefs; DO NOT EDIT.
-// cgo -godefs -- -Wall -Werror -static -I/tmp/include -m64 /build/unix/_const.go
+// cgo -godefs -- -Wall -Werror -static -I/tmp/amd64/include -m64 _const.go
 
 package unix
 
@@ -327,6 +327,7 @@ const (
 	SO_RCVBUF                        = 0x8
 	SO_RCVBUFFORCE                   = 0x21
 	SO_RCVLOWAT                      = 0x12
+	SO_RCVMARK                       = 0x4b
 	SO_RCVTIMEO                      = 0x14
 	SO_RCVTIMEO_NEW                  = 0x42
 	SO_RCVTIMEO_OLD                  = 0x14
@@ -351,6 +352,7 @@ const (
 	SO_TIMESTAMPNS_NEW               = 0x40
 	SO_TIMESTAMPNS_OLD               = 0x23
 	SO_TIMESTAMP_NEW                 = 0x3f
+	SO_TXREHASH                      = 0x4a
 	SO_TXTIME                        = 0x3d
 	SO_TYPE                          = 0x3
 	SO_WIFI_STATUS                   = 0x29

vendor/golang.org/x/sys/unix/zerrors_linux_arm.go

@@ -1,11 +1,11 @@
-// mkerrors.sh -Wall -Werror -static -I/tmp/include
+// mkerrors.sh -Wall -Werror -static -I/tmp/arm/include
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build arm && linux
 // +build arm,linux
 
 // Code generated by cmd/cgo -godefs; DO NOT EDIT.
-// cgo -godefs -- -Wall -Werror -static -I/tmp/include /build/unix/_const.go
+// cgo -godefs -- -Wall -Werror -static -I/tmp/arm/include _const.go
 
 package unix
 
@@ -333,6 +333,7 @@ const (
 	SO_RCVBUF                        = 0x8
 	SO_RCVBUFFORCE                   = 0x21
 	SO_RCVLOWAT                      = 0x12
+	SO_RCVMARK                       = 0x4b
 	SO_RCVTIMEO                      = 0x14
 	SO_RCVTIMEO_NEW                  = 0x42
 	SO_RCVTIMEO_OLD                  = 0x14
@@ -357,6 +358,7 @@ const (
 	SO_TIMESTAMPNS_NEW               = 0x40
 	SO_TIMESTAMPNS_OLD               = 0x23
 	SO_TIMESTAMP_NEW                 = 0x3f
+	SO_TXREHASH                      = 0x4a
 	SO_TXTIME                        = 0x3d
 	SO_TYPE                          = 0x3
 	SO_WIFI_STATUS                   = 0x29

vendor/golang.org/x/sys/unix/zerrors_linux_arm64.go

@@ -1,11 +1,11 @@
-// mkerrors.sh -Wall -Werror -static -I/tmp/include -fsigned-char
+// mkerrors.sh -Wall -Werror -static -I/tmp/arm64/include -fsigned-char
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build arm64 && linux
 // +build arm64,linux
 
 // Code generated by cmd/cgo -godefs; DO NOT EDIT.
-// cgo -godefs -- -Wall -Werror -static -I/tmp/include -fsigned-char /build/unix/_const.go
+// cgo -godefs -- -Wall -Werror -static -I/tmp/arm64/include -fsigned-char _const.go
 
 package unix
 
@@ -323,6 +323,7 @@ const (
 	SO_RCVBUF                        = 0x8
 	SO_RCVBUFFORCE                   = 0x21
 	SO_RCVLOWAT                      = 0x12
+	SO_RCVMARK                       = 0x4b
 	SO_RCVTIMEO                      = 0x14
 	SO_RCVTIMEO_NEW                  = 0x42
 	SO_RCVTIMEO_OLD                  = 0x14
@@ -347,6 +348,7 @@ const (
 	SO_TIMESTAMPNS_NEW               = 0x40
 	SO_TIMESTAMPNS_OLD               = 0x23
 	SO_TIMESTAMP_NEW                 = 0x3f
+	SO_TXREHASH                      = 0x4a
 	SO_TXTIME                        = 0x3d
 	SO_TYPE                          = 0x3
 	SO_WIFI_STATUS                   = 0x29
@@ -511,6 +513,7 @@ const (
 	WORDSIZE                         = 0x40
 	XCASE                            = 0x4
 	XTABS                            = 0x1800
+	ZA_MAGIC                         = 0x54366345
 	_HIDIOCGRAWNAME                  = 0x80804804
 	_HIDIOCGRAWPHYS                  = 0x80404805
 	_HIDIOCGRAWUNIQ                  = 0x80404808

vendor/golang.org/x/sys/unix/zerrors_linux_mips.go

@@ -1,11 +1,11 @@
-// mkerrors.sh -Wall -Werror -static -I/tmp/include
+// mkerrors.sh -Wall -Werror -static -I/tmp/mips/include
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build mips && linux
 // +build mips,linux
 
 // Code generated by cmd/cgo -godefs; DO NOT EDIT.
-// cgo -godefs -- -Wall -Werror -static -I/tmp/include /build/unix/_const.go
+// cgo -godefs -- -Wall -Werror -static -I/tmp/mips/include _const.go
 
 package unix
 
@@ -326,6 +326,7 @@ const (
 	SO_RCVBUF                        = 0x1002
 	SO_RCVBUFFORCE                   = 0x21
 	SO_RCVLOWAT                      = 0x1004
+	SO_RCVMARK                       = 0x4b
 	SO_RCVTIMEO                      = 0x1006
 	SO_RCVTIMEO_NEW                  = 0x42
 	SO_RCVTIMEO_OLD                  = 0x1006
@@ -351,6 +352,7 @@ const (
 	SO_TIMESTAMPNS_NEW               = 0x40
 	SO_TIMESTAMPNS_OLD               = 0x23
 	SO_TIMESTAMP_NEW                 = 0x3f
+	SO_TXREHASH                      = 0x4a
 	SO_TXTIME                        = 0x3d
 	SO_TYPE                          = 0x1008
 	SO_WIFI_STATUS                   = 0x29

vendor/golang.org/x/sys/unix/zerrors_linux_mips64.go

@@ -1,11 +1,11 @@
-// mkerrors.sh -Wall -Werror -static -I/tmp/include
+// mkerrors.sh -Wall -Werror -static -I/tmp/mips64/include
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build mips64 && linux
 // +build mips64,linux
 
 // Code generated by cmd/cgo -godefs; DO NOT EDIT.
-// cgo -godefs -- -Wall -Werror -static -I/tmp/include /build/unix/_const.go
+// cgo -godefs -- -Wall -Werror -static -I/tmp/mips64/include _const.go
 
 package unix
 
@@ -326,6 +326,7 @@ const (
 	SO_RCVBUF                        = 0x1002
 	SO_RCVBUFFORCE                   = 0x21
 	SO_RCVLOWAT                      = 0x1004
+	SO_RCVMARK                       = 0x4b
 	SO_RCVTIMEO                      = 0x1006
 	SO_RCVTIMEO_NEW                  = 0x42
 	SO_RCVTIMEO_OLD                  = 0x1006
@@ -351,6 +352,7 @@ const (
 	SO_TIMESTAMPNS_NEW               = 0x40
 	SO_TIMESTAMPNS_OLD               = 0x23
 	SO_TIMESTAMP_NEW                 = 0x3f
+	SO_TXREHASH                      = 0x4a
 	SO_TXTIME                        = 0x3d
 	SO_TYPE                          = 0x1008
 	SO_WIFI_STATUS                   = 0x29

vendor/golang.org/x/sys/unix/zerrors_linux_mips64le.go

@@ -1,11 +1,11 @@
-// mkerrors.sh -Wall -Werror -static -I/tmp/include
+// mkerrors.sh -Wall -Werror -static -I/tmp/mips64le/include
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build mips64le && linux
 // +build mips64le,linux
 
 // Code generated by cmd/cgo -godefs; DO NOT EDIT.
-// cgo -godefs -- -Wall -Werror -static -I/tmp/include /build/unix/_const.go
+// cgo -godefs -- -Wall -Werror -static -I/tmp/mips64le/include _const.go
 
 package unix
 
@@ -326,6 +326,7 @@ const (
 	SO_RCVBUF                        = 0x1002
 	SO_RCVBUFFORCE                   = 0x21
 	SO_RCVLOWAT                      = 0x1004
+	SO_RCVMARK                       = 0x4b
 	SO_RCVTIMEO                      = 0x1006
 	SO_RCVTIMEO_NEW                  = 0x42
 	SO_RCVTIMEO_OLD                  = 0x1006
@@ -351,6 +352,7 @@ const (
 	SO_TIMESTAMPNS_NEW               = 0x40
 	SO_TIMESTAMPNS_OLD               = 0x23
 	SO_TIMESTAMP_NEW                 = 0x3f
+	SO_TXREHASH                      = 0x4a
 	SO_TXTIME                        = 0x3d
 	SO_TYPE                          = 0x1008
 	SO_WIFI_STATUS                   = 0x29

vendor/golang.org/x/sys/unix/zerrors_linux_mipsle.go

@@ -1,11 +1,11 @@
-// mkerrors.sh -Wall -Werror -static -I/tmp/include
+// mkerrors.sh -Wall -Werror -static -I/tmp/mipsle/include
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build mipsle && linux
 // +build mipsle,linux
 
 // Code generated by cmd/cgo -godefs; DO NOT EDIT.
-// cgo -godefs -- -Wall -Werror -static -I/tmp/include /build/unix/_const.go
+// cgo -godefs -- -Wall -Werror -static -I/tmp/mipsle/include _const.go
 
 package unix
 
@@ -326,6 +326,7 @@ const (
 	SO_RCVBUF                        = 0x1002
 	SO_RCVBUFFORCE                   = 0x21
 	SO_RCVLOWAT                      = 0x1004
+	SO_RCVMARK                       = 0x4b
 	SO_RCVTIMEO                      = 0x1006
 	SO_RCVTIMEO_NEW                  = 0x42
 	SO_RCVTIMEO_OLD                  = 0x1006
@@ -351,6 +352,7 @@ const (
 	SO_TIMESTAMPNS_NEW               = 0x40
 	SO_TIMESTAMPNS_OLD               = 0x23
 	SO_TIMESTAMP_NEW                 = 0x3f
+	SO_TXREHASH                      = 0x4a
 	SO_TXTIME                        = 0x3d
 	SO_TYPE                          = 0x1008
 	SO_WIFI_STATUS                   = 0x29

vendor/golang.org/x/sys/unix/zerrors_linux_ppc.go

@@ -1,11 +1,11 @@
-// mkerrors.sh -Wall -Werror -static -I/tmp/include
+// mkerrors.sh -Wall -Werror -static -I/tmp/ppc/include
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build ppc && linux
 // +build ppc,linux
 
 // Code generated by cmd/cgo -godefs; DO NOT EDIT.
-// cgo -godefs -- -Wall -Werror -static -I/tmp/include /build/unix/_const.go
+// cgo -godefs -- -Wall -Werror -static -I/tmp/ppc/include _const.go
 
 package unix
 
@@ -381,6 +381,7 @@ const (
 	SO_RCVBUF                        = 0x8
 	SO_RCVBUFFORCE                   = 0x21
 	SO_RCVLOWAT                      = 0x10
+	SO_RCVMARK                       = 0x4b
 	SO_RCVTIMEO                      = 0x12
 	SO_RCVTIMEO_NEW                  = 0x42
 	SO_RCVTIMEO_OLD                  = 0x12
@@ -405,6 +406,7 @@ const (
 	SO_TIMESTAMPNS_NEW               = 0x40
 	SO_TIMESTAMPNS_OLD               = 0x23
 	SO_TIMESTAMP_NEW                 = 0x3f
+	SO_TXREHASH                      = 0x4a
 	SO_TXTIME                        = 0x3d
 	SO_TYPE                          = 0x3
 	SO_WIFI_STATUS                   = 0x29

vendor/golang.org/x/sys/unix/zerrors_linux_ppc64.go

@@ -1,11 +1,11 @@
-// mkerrors.sh -Wall -Werror -static -I/tmp/include
+// mkerrors.sh -Wall -Werror -static -I/tmp/ppc64/include
 // Code generated by the command above; see README.md. DO NOT EDIT.
 
 //go:build ppc64 && linux
 // +build ppc64,linux
 
 // Code generated by cmd/cgo -godefs; DO NOT EDIT.
-// cgo -godefs -- -Wall -Werror -static -I/tmp/include /build/unix/_const.go
+// cgo -godefs -- -Wall -Werror -static -I/tmp/ppc64/include _const.go
 
 package unix
 
@@ -385,6 +385,7 @@ const (
 	SO_RCVBUF                        = 0x8
 	SO_RCVBUFFORCE                   = 0x21
 	SO_RCVLOWAT                      = 0x10
+	SO_RCVMARK                       = 0x4b
 	SO_RCVTIMEO                      = 0x12
 	SO_RCVTIMEO_NEW                  = 0x42
 	SO_RCVTIMEO_OLD                  = 0x12
@@ -409,6 +410,7 @@ const (
 	SO_TIMESTAMPNS_NEW               = 0x40
 	SO_TIMESTAMPNS_OLD               = 0x23
 	SO_TIMESTAMP_NEW                 = 0x3f
+	SO_TXREHASH                      = 0x4a
 	SO_TXTIME                        = 0x3d
 	SO_TYPE                          = 0x3
 	SO_WIFI_STATUS                   = 0x29